4QSPA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with acetyl-lysine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qspA00
5FG4A 4QYLA 2YEMA 4O72A 4QSTA 4HBXA 5ENEA 3HMHA 4DONA 5I1QA 5E3DA 4QUTA 5FE2A 5DYXA 5TB6A 5LUUA 4N4GA 5D3SA 4TTEA 4WIVA 5CQ6A 4NYVA 4YY6A 4QB3A 4TT6A 4YAXA 3U5OA 3QZTA 4YYKA 4UIVA 5EV9A 4QSSA 3U5PA 5FDZA 4IOQA 5CQ8A 2MJVB 5II2A 5FB1A 3TLPA 4MR4A 5EWDA 2R10A 5A85A 4J1PA 2F6JA 3JVJA 5LVRA 4ZQLA 4KCXA 3UV5A 5DW2A 2YELA 3GG3A 4AKNA 3U5NA 4YYGA 4QSPA 5CQTA 5II1A 5DKCA 4QR3A 5L8TA 2RNYA 5FB0A 4HXOA 4O75A 4YC9A 4ZC9A 5AD3A 4LZSA 4MEPA 4YK0A 4YYIA 4TT4A 4NR5A 2L5EA 5FE8A 4O7EA 4QC3A 4HBVA 2FSAA 5C8GA 5CRMA 5HLSA 2L84A 5BT5A 2GRCA 5H1VA 5KO4A 3U5KA 5I89A 5A5RA 5FBXA 5LKTA 4KV1A 5E73A 5ENFA 5F5ZA 5FE4A 5F2PA 5I7XA 5CQ4A 5HRWA 4QSXA 1ZS5A 5A5PA 5DLXA 5CUDA 5G4RA 4UYDA 5KTXA 5FE0A 5HCLA 3P1EA 1JSPB 4NS5A 4O77A 5G4SA 4UIWA 5E9MA 5CQ3A 3AADA 3UVXA 4Z1QA 3MB3A 4MENA 5I88A 4XY9A 4OUFA 2DATA 3G0LA 5C85A 1WUMA 5HFRA 4HXMA 5I86A 5CS8A 4TQNA 3MQMA 5D3PA 5CFWA 4TZ8A 4CUPA 5F63A 2E7OA 5L96A 3DAIA 4QR4A 2E7NA 3S92A 4LZ2A 5A5SA 2YEKA 4QZSA 5E9YA 3UV4A 3LXJA 4QY4A 4NXJA 4HBWA 4TS8A 2RNXA 4UIXA 4NYWA 2D9EA 5LJ0A 4QEWA 5DW1A 5FE1A 5I7YA 4NQMA 4HXSA 3U5JA 4UIYA 4BHWA 2DVQA 4Y03A 5IGNA 5IG6A 4QSRA 5EWVA 4CFLA 5COIA 5HQ6A 4Q0NA 5EQ1A 5D25A 4UYFB 4GPJA 5EU1A 5E9VA 5CUGA 5C7NA 5FH6A 5L98A 4LYSA 5F61A 3U5LA 5JWMA 5FFWA 2OO1A 3SVHA 4UIZA 4Z1SA 5FE5A 5CTLA 3O36A 4BJXA 5FH8A 4BW3A 5CQ7A 4OGJA 5A7CA 4CUQA 5LJ1A 4A9KA 4NUDA 2RS9B 4ALHA 5FE9A 5H85A 5KU3A 5EISA 4O7CA 4A9OA 4QEUA 5E9KA 4LR6A 4NRBA 4UITA 5DBMA 4Z6HA 5D3TA 4PS5A 5D26A 5L8UA 5EM3A 3DWYA 5EPSA 5EK9A 4CFKA 4LYWA 4TYLA 4N4HA 5E74A 4XYAA 5HENA 4NR9A 2YYNA 5LVQA 4Q0OA 3JVLA 5EA1A 4NQNA 5K29A 3P5OA 4TU6A 4PKLA 5EVAA 5IGKA 5D3LA 5L97A 3D7CA 4HBYA 4UYFA 5DX4A 4O71A 4LYIA 5F1HA 5ENHA 5F62A 5ENCA 4TZ2A 5FH7A 4IORA 4O7FA 3P1CA 4IR5A 4O78A 4E96A 5CY9A 5A5QA 4PTBA 4YYMA 3IU6A 4X2IA 5BT4A 3MXFA 4F3IA 3U5MA 4A9IA 3G0JA 4LDFA 5ENBA 3P1FA 4NRAA 5IBNA 3RCWA 3UVWA 5DFDA 5DKDA 3MULA 3O33A 4XUBA 1E6IA 5FG5A 4YBSA 4Z93A 5HRVA 4ALGA 4YATA 5CZGA 4TU4A 5CQ5A 4HXNA 4A9EA 2N9GA 2R0YA 3LJWA 5KTWA 2RO1A 4QUUA 4N3WA 5BT3A 5E0RA 5KHMA 4QSWA 4HXPA 4NUEA 5A82A 5HFQA 5EICA 5ENGA 5FE3A 5E9LA 5I80A 2DVSA 4IOOA 3JVKA 4QBMA 4CUUA 2RI7A 4N4IA 4CUSA 4NR6A 3S91A 4IR4A 5LKXA 4LRGA 5CUBA 4QR5A 3ONIA 4O70A 3I3JA 4J0RA 5AMEA 2YQDA 2YDWA 5F60A 5D3JA 5HQ5A 5DY7A 2DVRA 5I29A 5LKZA 2DWWA 2G4AA 5ENJA 4QNSA 3QZVA 2LSPB 4BW2A 4LC2A 4A9MA 4J0SA 3LQIA 4XUAA 4IR6A 5FFVA 4O7BA 4CURA 5DYAA 4O74A 5ENIA 4NUCA 4WHUA 5A5NA 5E3GA 5D3RA 4YYJA 5CGPA 4N4FA 3MUKA 4FLPA 4YYDA 3SVGA 5HM0A 4HXLA 5HELA 4YADA 3O34A 2KTBB 4MR6A 5D0CA 5ETBA 4A9JA 3SVFA 5EP7A 3LQHA 2I8NA 5EWWA 5HJCA 5C4QA 5CUEA 5D24A 4UYGA 4NRCA 2H60A 4RVRA 5D3NA 5D3HA 1F68A 4YH4A 5CUAA 2DVVA 3MB4A 4CL9A 2OSSA 4NR8A 4MR3A 5I40A 4C66A 5HRXA 2RFJA 5CU8A 5C87A 5IGLA 2F6NA 5D7XA 4TT2A 4XY8A 3NXBA 2R0VA 2E3KA 5JI8A 4OGIA 4YBMA 5CRZA 4YABA 3O37A 1N72A 4QEVA 5ACYA 5CP5A 5DYCA 3HMEA 4YY4A 4KV4A 4NR4A 5EGUA 4HXKA 5DLZA 5LJ2A 3ZYUA 5F36A 4A9FA 5L99A 5TCMA 5IGMA 5AMFA 3QZSA 1JM4B 4YH3A 5EWHA 4QYDA 1EQFA 5H1TA 5HQ7A 1X0JA 5HEMA 3AQAA 5CQAA 4NR7A 5J0DA 4A9LA 3UW9A 4PCIA 2WP2A 4MR5A 4BW4A 2L85A 5A5OA 3HMFA 5H1UA 4O7AA 2WP1A 4MEOA 3JVMA 4QSUA 4Z6IA 4YYNA 2R0SA 3Q2FA 4BW1A 4PCEA 3LQJA 5KTUA 5F1LA 5DKHA 3UV2A 5DFCA 4QSVA 3UVYA 5LKUA 5EPBA 5F3AA 2NXBA 5DYUA 4WHWA 4A9HA 5ETDA 5E9IA 4A9NA 5F25A 4UYHA 5E7DA 4J3IA 5I83A 5A83A 2OUOA 5EWCA 3K2JA 5EPRA 2YW5A 4CLBA 2D82A 3FKMX 3P1DA 2I7KA 2RNWA 4O76A 4C67A 5FFYA 3Q2EA 5C89A 3IU5A 4UYEA 4QSQA 5A81A 4UIUA 5IIDA 4YBTA 3UVDA 5FE6A 5EI4A 4IR3A 4PY6A 4YYHA 5AD2A 3O35A 1WUGA 4LZRA 5CUCA 5FE7A 4HXRA 4NYXA 5DFBA 5FG6A 4CUTA 4MEQA 2DKWA 4ZW1A 4QC1A 5CPEA
chains in the Genus database with same CATH superfamily
5FG4A 4QYLA 2YEMA 4O72A 4QSTA 4HBXA 5ENEA 3HMHA 4DONA 5I1QA 5E3DA 4QUTA 5FE2A 5DYXA 5TB6A 5LUUA 4N4GA 5D3SA 4TTEA 4WIVA 5CQ6A 4NYVA 4YY6A 4QB3A 4TT6A 4YAXA 3U5OA 3QZTA 4YYKA 4UIVA 2EJNA 5EV9A 4QSSA 3U5PA 5FDZA 4IOQA 5CQ8A 2MJVB 5II2A 5FB1A 3ERRA 3TLPA 4MR4A 5EWDA 2R10A 5A85A 4J1PA 2F6JA 3JVJA 5LVRA 4ZQLA 4KCXA 3UV5A 5DW2A 2YELA 3GG3A 4AKNA 3U5NA 4YYGA 3D1BA 4QSPA 5CQTA 5II1A 5DKCA 4QR3A 5L8TA 2RNYA 5FB0A 4HXOA 4O75A 4YC9A 4ZC9A 5AD3A 4LZSA 4MEPA 4YK0A 4YYIA 4TT4A 4NR5A 2L5EA 5FE8A 4O7EA 4QC3A 4HBVA 2FSAA 5C8GA 5CRMA 5HLSA 2L84A 5BT5A 2GRCA 5H1VA 5KO4A 3U5KA 5I89A 5A5RA 5FBXA 5LKTA 4KV1A 5E73A 5ENFA 5F5ZA 5FE4A 5F2PA 5I7XA 5CQ4A 5HRWA 4QSXA 1ZS5A 5A5PA 5DLXA 5CUDA 5G4RA 4UYDA 5KTXA 5FE0A 5HCLA 3P1EA 1JSPB 4NS5A 4O77A 5G4SA 4UIWA 5E9MA 5CQ3A 3AADA 3UVXA 4Z1QA 3MB3A 4MENA 5I88A 4XY9A 4OUFA 2DATA 3G0LA 5C85A 1WUMA 5HFRA 4HXMA 5I86A 5CS8A 4TQNA 3MQMA 5D3PA 5CFWA 4TZ8A 4CUPA 5F63A 2E7OA 5L96A 3DAIA 4QR4A 2E7NA 3S92A 4LZ2A 5A5SA 2YEKA 4QZSA 5E9YA 3UV4A 3LXJA 4QY4A 4NXJA 4HBWA 4TS8A 2RNXA 4UIXA 4NYWA 2D9EA 5LJ0A 4QEWA 5DW1A 5FE1A 5I7YA 4NQMA 4HXSA 3U5JA 4UIYA 4BHWA 2DVQA 4Y03A 5IGNA 5IG6A 4QSRA 5EWVA 4CFLA 5COIA 5HQ6A 4AKGA 4Q0NA 5EQ1A 5D25A 4UYFB 4GPJA 5EU1A 5E9VA 5CUGA 5C7NA 5FH6A 5L98A 4LYSA 5F61A 3U5LA 5JWMA 5FFWA 2OO1A 3SVHA 4UIZA 4Z1SA 5FE5A 3VKHA 5CTLA 3O36A 4BJXA 5FH8A 4BW3A 5CQ7A 4OGJA 5A7CA 4CUQA 5LJ1A 4A9KA 4NUDA 2RS9B 4ALHA 5FE9A 5H85A 5KU3A 5EISA 4O7CA 4A9OA 4QEUA 5E9KA 4LR6A 4NRBA 4UITA 5DBMA 4Z6HA 5D3TA 4PS5A 5D26A 5L8UA 5EM3A 3DWYA 5EPSA 5EK9A 4CFKA 4LYWA 4TYLA 4N4HA 5E74A 4XYAA 5HENA 4NR9A 2YYNA 5LVQA 4Q0OA 3JVLA 5EA1A 4NQNA 5K29A 3P5OA 4TU6A 4PKLA 5EVAA 5IGKA 5D3LA 5L97A 3D7CA 4HBYA 4UYFA 5DX4A 4O71A 4LYIA 5F1HA 5ENHA 5F62A 5ENCA 4TZ2A 5FH7A 4IORA 4O7FA 3P1CA 4IR5A 4O78A 4E96A 5CY9A 5A5QA 4PTBA 4YYMA 1ZKRA 3IU6A 4X2IA 5BT4A 3MXFA 4F3IA 1PUOA 3U5MA 4A9IA 3G0JA 4LDFA 5ENBA 3P1FA 4NRAA 5IBNA 3RCWA 3UVWA 5DFDA 5DKDA 3MULA 3O33A 4XUBA 1E6IA 5FG5A 4YBSA 4Z93A 5HRVA 4ALGA 4YATA 5CZGA 4TU4A 5CQ5A 4HXNA 4A9EA 2N9GA 2R0YA 3LJWA 5KTWA 2RO1A 4QUUA 4N3WA 5BT3A 5E0RA 5KHMA 4QSWA 4HXPA 4NUEA 5A82A 5HFQA 5EICA 5ENGA 5FE3A 5E9LA 5I80A 2DVSA 4IOOA 3JVKA 4QBMA 4CUUA 2RI7A 4N4IA 4CUSA 4NR6A 3S91A 4IR4A 5LKXA 4LRGA 5CUBA 4QR5A 3ONIA 4O70A 3I3JA 4J0RA 5AMEA 2YQDA 2YDWA 5F60A 5D3JA 5HQ5A 5DY7A 2DVRA 5I29A 5LKZA 2DWWA 2G4AA 5ENJA 4QNSA 4AKHA 3QZVA 2LSPB 4BW2A 4LC2A 4A9MA 4J0SA 3LQIA 4XUAA 4IR6A 5FFVA 4O7BA 4CURA 5DYAA 4O74A 5ENIA 4NUCA 4WHUA 5A5NA 5E3GA 5D3RA 4YYJA 5CGPA 4N4FA 3MUKA 4FLPA 4YYDA 3SVGA 5HM0A 4HXLA 5HELA 4YADA 3O34A 2KTBB 4MR6A 5D0CA 5ETBA 4A9JA 3SVFA 5EP7A 3LQHA 2I8NA 5EWWA 5HJCA 5C4QA 5CUEA 5D24A 4UYGA 4NRCA 2H60A 4RVRA 5D3NA 5D3HA 1F68A 4YH4A 5CUAA 2DVVA 3MB4A 4CL9A 4AI6A 2OSSA 4NR8A 4MR3A 5I40A 4C66A 5HRXA 2RFJA 5CU8A 5C87A 5IGLA 2F6NA 5D7XA 4TT2A 4XY8A 3NXBA 2R0VA 2E3KA 5JI8A 4OGIA 4YBMA 5CRZA 4YABA 3O37A 1N72A 4QEVA 5ACYA 5CP5A 5DYCA 3HMEA 4YY4A 3D1DA 4KV4A 4NR4A 5EGUA 4HXKA 5DLZA 5LJ2A 3ZYUA 5F36A 4A9FA 5L99A 5TCMA 5IGMA 5AMFA 3QZSA 1JM4B 4YH3A 5EWHA 4QYDA 3VKGA 1EQFA 5H1TA 5HQ7A 1X0JA 5HEMA 3AQAA 5CQAA 4NR7A 5J0DA 4A9LA 3UW9A 4PCIA 2WP2A 4MR5A 4BW4A 2L85A 5A5OA 3HMFA 5H1UA 4O7AA 2WP1A 4MEOA 3JVMA 4QSUA 4Z6IA 4YYNA 2R0SA 3Q2FA 4BW1A 4PCEA 3LQJA 5KTUA 5F1LA 5DKHA 3UV2A 5DFCA 4QSVA 3UVYA 5LKUA 5EPBA 5F3AA 2NXBA 5DYUA 4WHWA 4A9HA 5ETDA 5E9IA 4A9NA 5F25A 4UYHA 5E7DA 4J3IA 5I83A 5A83A 2OUOA 5EWCA 3K2JA 5EPRA 2YW5A 4CLBA 2D82A 3FKMX 3P1DA 2I7KA 2RNWA 4O76A 4C67A 4AKIA 5FFYA 3Q2EA 5C89A 3IU5A 4UYEA 4QSQA 5A81A 4UIUA 5IIDA 4YBTA 3UVDA 5FE6A 5EI4A 4IR3A 4PY6A 4YYHA 5AD2A 3O35A 1WUGA 4LZRA 5CUCA 5FE7A 4HXRA 4NYXA 5DFBA 5FG6A 4CUTA 4MEQA 2DKWA 4ZW1A 4QC1A 5CPEA
chains in the Genus database with same CATH topology
5FG4A 4QYLA 2YEMA 4O72A 4QSTA 4HBXA 5ENEA 3HMHA 4DONA 5I1QA 5E3DA 4QUTA 5FE2A 5DYXA 5TB6A 5LUUA 4N4GA 5D3SA 4TTEA 4WIVA 5CQ6A 4NYVA 4YY6A 4QB3A 4TT6A 4YAXA 3U5OA 3QZTA 4YYKA 4UIVA 5EV9A 4QSSA 3U5PA 5FDZA 4IOQA 5CQ8A 2MJVB 5II2A 5FB1A 3TLPA 4MR4A 5EWDA 2R10A 5A85A 4J1PA 2F6JA 3JVJA 5LVRA 4ZQLA 4KCXA 3UV5A 5DW2A 2YELA 3GG3A 4AKNA 3U5NA 4YYGA 4QSPA 5CQTA 5II1A 5DKCA 4QR3A 5L8TA 2RNYA 5FB0A 4HXOA 4O75A 4YC9A 4ZC9A 5AD3A 4LZSA 4MEPA 4YK0A 4YYIA 4TT4A 4NR5A 2L5EA 5FE8A 4O7EA 4QC3A 4HBVA 2FSAA 5C8GA 5CRMA 5HLSA 2L84A 5BT5A 2GRCA 5H1VA 5KO4A 3U5KA 5I89A 5A5RA 5FBXA 5LKTA 4KV1A 5E73A 5ENFA 5F5ZA 5FE4A 5F2PA 5I7XA 5CQ4A 5HRWA 4QSXA 1ZS5A 5A5PA 5DLXA 5CUDA 5G4RA 4UYDA 5KTXA 5FE0A 5HCLA 3P1EA 1JSPB 4NS5A 4O77A 5G4SA 4UIWA 5E9MA 5CQ3A 3AADA 3UVXA 4Z1QA 3MB3A 4MENA 5I88A 4XY9A 4OUFA 2DATA 3G0LA 5C85A 1WUMA 5HFRA 4HXMA 5I86A 5CS8A 4TQNA 3MQMA 5D3PA 5CFWA 4TZ8A 4CUPA 5F63A 2E7OA 5L96A 3DAIA 4QR4A 2E7NA 3S92A 4LZ2A 5A5SA 2YEKA 4QZSA 5E9YA 3UV4A 3LXJA 4QY4A 4NXJA 4HBWA 4TS8A 2RNXA 4UIXA 4NYWA 2D9EA 5LJ0A 4QEWA 5DW1A 5FE1A 5I7YA 4NQMA 4HXSA 3U5JA 4UIYA 4BHWA 2DVQA 4Y03A 5IGNA 5IG6A 4QSRA 5EWVA 4CFLA 5COIA 5HQ6A 4Q0NA 5EQ1A 5D25A 4UYFB 4GPJA 5EU1A 5E9VA 5CUGA 5C7NA 5FH6A 5L98A 4LYSA 5F61A 3U5LA 5JWMA 5FFWA 2OO1A 3SVHA 4UIZA 4Z1SA 5FE5A 5CTLA 3O36A 4BJXA 5FH8A 4BW3A 5CQ7A 4OGJA 5A7CA 4CUQA 5LJ1A 4A9KA 4NUDA 2RS9B 4ALHA 5FE9A 5H85A 5KU3A 5EISA 4O7CA 4A9OA 4QEUA 5E9KA 4LR6A 4NRBA 4UITA 5DBMA 4Z6HA 5D3TA 4PS5A 5D26A 5L8UA 5EM3A 3DWYA 5EPSA 5EK9A 4CFKA 4LYWA 4TYLA 4N4HA 5E74A 4XYAA 5HENA 4NR9A 2YYNA 5LVQA 4Q0OA 3JVLA 5EA1A 4NQNA 5K29A 3P5OA 4TU6A 4PKLA 5EVAA 5IGKA 5D3LA 5L97A 3D7CA 4HBYA 4UYFA 5DX4A 4O71A 4LYIA 5F1HA 5ENHA 5F62A 5ENCA 4TZ2A 5FH7A 4IORA 4O7FA 3P1CA 4IR5A 4O78A 4E96A 5CY9A 5A5QA 4PTBA 4YYMA 3IU6A 4X2IA 5BT4A 3MXFA 4F3IA 3U5MA 4A9IA 3G0JA 4LDFA 5ENBA 3P1FA 4NRAA 5IBNA 3RCWA 3UVWA 5DFDA 5DKDA 3MULA 3O33A 4XUBA 1E6IA 5FG5A 4YBSA 4Z93A 5HRVA 4ALGA 4YATA 5CZGA 4TU4A 5CQ5A 4HXNA 4A9EA 2N9GA 2R0YA 3LJWA 5KTWA 2RO1A 4QUUA 4N3WA 5BT3A 5E0RA 5KHMA 4QSWA 4HXPA 4NUEA 5A82A 5HFQA 5EICA 5ENGA 5FE3A 5E9LA 5I80A 2DVSA 4IOOA 3JVKA 4QBMA 4CUUA 2RI7A 4N4IA 4CUSA 4NR6A 3S91A 4IR4A 5LKXA 4LRGA 5CUBA 4QR5A 3ONIA 4O70A 3I3JA 4J0RA 5AMEA 2YQDA 2YDWA 5F60A 5D3JA 5HQ5A 5DY7A 2DVRA 5I29A 5LKZA 2DWWA 2G4AA 5ENJA 4QNSA 3QZVA 2LSPB 4BW2A 4LC2A 4A9MA 4J0SA 3LQIA 4XUAA 4IR6A 5FFVA 4O7BA 4CURA 5DYAA 4O74A 5ENIA 4NUCA 4WHUA 5A5NA 5E3GA 5D3RA 4YYJA 5CGPA 4N4FA 3MUKA 4FLPA 4YYDA 3SVGA 5HM0A 4HXLA 5HELA 4YADA 3O34A 2KTBB 4MR6A 5D0CA 5ETBA 4A9JA 3SVFA 5EP7A 3LQHA 2I8NA 5EWWA 5HJCA 5C4QA 5CUEA 5D24A 4UYGA 4NRCA 2H60A 4RVRA 5D3NA 5D3HA 1F68A 4YH4A 5CUAA 2DVVA 3MB4A 4CL9A 2OSSA 4NR8A 4MR3A 5I40A 4C66A 5HRXA 2RFJA 5CU8A 5C87A 5IGLA 2F6NA 5D7XA 4TT2A 4XY8A 3NXBA 2R0VA 2E3KA 5JI8A 4OGIA 4YBMA 5CRZA 4YABA 3O37A 1N72A 4QEVA 5ACYA 5CP5A 5DYCA 3HMEA 4YY4A 4KV4A 4NR4A 5EGUA 4HXKA 5DLZA 5LJ2A 3ZYUA 5F36A 4A9FA 5L99A 5TCMA 5IGMA 5AMFA 3QZSA 1JM4B 4YH3A 5EWHA 4QYDA 1EQFA 5H1TA 5HQ7A 1X0JA 5HEMA 3AQAA 5CQAA 4NR7A 5J0DA 4A9LA 3UW9A 4PCIA 2WP2A 4MR5A 4BW4A 2L85A 5A5OA 3HMFA 5H1UA 4O7AA 2WP1A 4MEOA 3JVMA 4QSUA 4Z6IA 4YYNA 2R0SA 3Q2FA 4BW1A 4PCEA 3LQJA 5KTUA 5F1LA 5DKHA 3UV2A 5DFCA 4QSVA 3UVYA 5LKUA 5EPBA 5F3AA 2NXBA 5DYUA 4WHWA 4A9HA 5ETDA 5E9IA 4A9NA 5F25A 4UYHA 5E7DA 4J3IA 5I83A 5A83A 2OUOA 5EWCA 3K2JA 5EPRA 2YW5A 4CLBA 2D82A 3FKMX 3P1DA 2I7KA 2RNWA 4O76A 4C67A 5FFYA 3Q2EA 5C89A 3IU5A 4UYEA 4QSQA 5A81A 4UIUA 5IIDA 4YBTA 3UVDA 5FE6A 5EI4A 4IR3A 4PY6A 4YYHA 5AD2A 3O35A 1WUGA 4LZRA 5CUCA 5FE7A 4HXRA 4NYXA 5DFBA 5FG6A 4CUTA 4MEQA 2DKWA 4ZW1A 4QC1A 5CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG4 A;  4QYL A;  2YEM A;  4O72 A;  4QST A;  4HBX A;  5ENE A;  3HMH A;  4DON A;  5I1Q A;  5E3D A;  4QUT A;  5FE2 A;  5DYX A;  5TB6 A;  5LUU A;  4N4G A;  5D3S A;  4TTE A;  4WIV A;  5CQ6 A;  4NYV A;  4YY6 A;  4QB3 A;  4TT6 A;  4YAX A;  3U5O A;  3QZT A;  4YYK A;  4UIV A;  5EV9 A;  4QSS A;  3U5P A;  5FDZ A;  4IOQ A;  5CQ8 A;  2MJV B;  5II2 A;  5FB1 A;  3TLP A;  4MR4 A;  5EWD A;  2R10 A;  5A85 A;  4J1P A;  2F6J A;  3JVJ A;  5LVR A;  4ZQL A;  4KCX A;  3UV5 A;  5DW2 A;  2YEL A;  3GG3 A;  4AKN A;  3U5N A;  4YYG A;  4QSP A;  5CQT A;  5II1 A;  5DKC A;  4QR3 A;  5L8T A;  2RNY A;  5FB0 A;  4HXO A;  4O75 A;  4YC9 A;  4ZC9 A;  5AD3 A;  4LZS A;  4MEP A;  4YK0 A;  4YYI A;  4TT4 A;  4NR5 A;  2L5E A;  5FE8 A;  4O7E A;  4QC3 A;  4HBV A;  2FSA A;  5C8G A;  5CRM A;  5HLS A;  2L84 A;  5BT5 A;  2GRC A;  5H1V A;  5KO4 A;  3U5K A;  5I89 A;  5A5R A;  5FBX A;  5LKT A;  4KV1 A;  5E73 A;  5ENF A;  5F5Z A;  5FE4 A;  5F2P A;  5I7X A;  5CQ4 A;  5HRW A;  4QSX A;  1ZS5 A;  5A5P A;  5DLX A;  5CUD A;  5G4R A;  4UYD A;  5KTX A;  5FE0 A;  5HCL A;  3P1E A;  1JSP B;  4NS5 A;  4O77 A;  5G4S A;  4UIW A;  5E9M A;  5CQ3 A;  3AAD A;  3UVX A;  4Z1Q A;  3MB3 A;  4MEN A;  5I88 A;  4XY9 A;  4OUF A;  2DAT A;  3G0L A;  5C85 A;  1WUM A;  5HFR A;  4HXM A;  5I86 A;  5CS8 A;  4TQN A;  3MQM A;  5D3P A;  5CFW A;  4TZ8 A;  4CUP A;  5F63 A;  2E7O A;  5L96 A;  3DAI A;  4QR4 A;  2E7N A;  3S92 A;  4LZ2 A;  5A5S A;  2YEK A;  4QZS A;  5E9Y A;  3UV4 A;  3LXJ A;  4QY4 A;  4NXJ A;  4HBW A;  4TS8 A;  2RNX A;  4UIX A;  4NYW A;  2D9E A;  5LJ0 A;  4QEW A;  5DW1 A;  5FE1 A;  5I7Y A;  4NQM A;  4HXS A;  3U5J A;  4UIY A;  4BHW A;  2DVQ A;  4Y03 A;  5IGN A;  5IG6 A;  4QSR A;  5EWV A;  4CFL A;  5COI A;  5HQ6 A;  4Q0N A;  5EQ1 A;  5D25 A;  4UYF B;  4GPJ A;  5EU1 A;  5E9V A;  5CUG A;  5C7N A;  5FH6 A;  5L98 A;  4LYS A;  5F61 A;  3U5L A;  5JWM A;  5FFW A;  2OO1 A;  3SVH A;  4UIZ A;  4Z1S A;  5FE5 A;  5CTL A;  3O36 A;  4BJX A;  5FH8 A;  4BW3 A;  5CQ7 A;  4OGJ A;  5A7C A;  4CUQ A;  5LJ1 A;  4A9K A;  4NUD A;  2RS9 B;  4ALH A;  5FE9 A;  5H85 A;  5KU3 A;  5EIS A;  4O7C A;  4A9O A;  4QEU A;  5E9K A;  4LR6 A;  4NRB A;  4UIT A;  5DBM A;  4Z6H A;  5D3T A;  4PS5 A;  5D26 A;  5L8U A;  5EM3 A;  3DWY A;  5EPS A;  5EK9 A;  4CFK A;  4LYW A;  4TYL A;  4N4H A;  5E74 A;  4XYA A;  5HEN A;  4NR9 A;  2YYN A;  5LVQ A;  4Q0O A;  3JVL A;  5EA1 A;  4NQN A;  5K29 A;  3P5O A;  4TU6 A;  4PKL A;  5EVA A;  5IGK A;  5D3L A;  5L97 A;  3D7C A;  4HBY A;  4UYF A;  5DX4 A;  4O71 A;  4LYI A;  5F1H A;  5ENH A;  5F62 A;  5ENC A;  4TZ2 A;  5FH7 A;  4IOR A;  4O7F A;  3P1C A;  4IR5 A;  4O78 A;  4E96 A;  5CY9 A;  5A5Q A;  4PTB A;  4YYM A;  3IU6 A;  4X2I A;  5BT4 A;  3MXF A;  4F3I A;  3U5M A;  4A9I A;  3G0J A;  4LDF A;  5ENB A;  3P1F A;  4NRA A;  5IBN A;  3RCW A;  3UVW A;  5DFD A;  5DKD A;  3MUL A;  3O33 A;  4XUB A;  1E6I A;  5FG5 A;  4YBS A;  4Z93 A;  5HRV A;  4ALG A;  4YAT A;  5CZG A;  4TU4 A;  5CQ5 A;  4HXN A;  4A9E A;  2N9G A;  2R0Y A;  3LJW A;  5KTW A;  2RO1 A;  4QUU A;  4N3W A;  5BT3 A;  5E0R A;  5KHM A;  4QSW A;  4HXP A;  4NUE A;  5A82 A;  5HFQ A;  5EIC A;  5ENG A;  5FE3 A;  5E9L A;  5I80 A;  2DVS A;  4IOO A;  3JVK A;  4QBM A;  4CUU A;  2RI7 A;  4N4I A;  4CUS A;  4NR6 A;  3S91 A;  4IR4 A;  5LKX A;  4LRG A;  5CUB A;  4QR5 A;  3ONI A;  4O70 A;  3I3J A;  4J0R A;  5AME A;  2YQD A;  2YDW A;  5F60 A;  5D3J A;  5HQ5 A;  5DY7 A;  2DVR A;  5I29 A;  5LKZ A;  2DWW A;  2G4A A;  5ENJ A;  4QNS A;  3QZV A;  2LSP B;  4BW2 A;  4LC2 A;  4A9M A;  4J0S A;  3LQI A;  4XUA A;  4IR6 A;  5FFV A;  4O7B A;  4CUR A;  5DYA A;  4O74 A;  5ENI A;  4NUC A;  4WHU A;  5A5N A;  5E3G A;  5D3R A;  4YYJ A;  5CGP A;  4N4F A;  3MUK A;  4FLP A;  4YYD A;  3SVG A;  5HM0 A;  4HXL A;  5HEL A;  4YAD A;  3O34 A;  2KTB B;  4MR6 A;  5D0C A;  5ETB A;  4A9J A;  3SVF A;  5EP7 A;  3LQH A;  2I8N A;  5EWW A;  5HJC A;  5C4Q A;  5CUE A;  5D24 A;  4UYG A;  4NRC A;  2H60 A;  4RVR A;  5D3N A;  5D3H A;  1F68 A;  4YH4 A;  5CUA A;  2DVV A;  3MB4 A;  4CL9 A;  2OSS A;  4NR8 A;  4MR3 A;  5I40 A;  4C66 A;  5HRX A;  2RFJ A;  5CU8 A;  5C87 A;  5IGL A;  2F6N A;  5D7X A;  4TT2 A;  4XY8 A;  3NXB A;  2R0V A;  2E3K A;  5JI8 A;  4OGI A;  4YBM A;  5CRZ A;  4YAB A;  3O37 A;  1N72 A;  4QEV A;  5ACY A;  5CP5 A;  5DYC A;  3HME A;  4YY4 A;  4KV4 A;  4NR4 A;  5EGU A;  4HXK A;  5DLZ A;  5LJ2 A;  3ZYU A;  5F36 A;  4A9F A;  5L99 A;  5TCM A;  5IGM A;  5AMF A;  3QZS A;  1JM4 B;  4YH3 A;  5EWH A;  4QYD A;  1EQF A;  5H1T A;  5HQ7 A;  1X0J A;  5HEM A;  3AQA A;  5CQA A;  4NR7 A;  5J0D A;  4A9L A;  3UW9 A;  4PCI A;  2WP2 A;  4MR5 A;  4BW4 A;  2L85 A;  5A5O A;  3HMF A;  5H1U A;  4O7A A;  2WP1 A;  4MEO A;  3JVM A;  4QSU A;  4Z6I A;  4YYN A;  2R0S A;  3Q2F A;  4BW1 A;  4PCE A;  3LQJ A;  5KTU A;  5F1L A;  5DKH A;  3UV2 A;  5DFC A;  4QSV A;  3UVY A;  5LKU A;  5EPB A;  5F3A A;  2NXB A;  5DYU A;  4WHW A;  4A9H A;  5ETD A;  5E9I A;  4A9N A;  5F25 A;  4UYH A;  5E7D A;  4J3I A;  5I83 A;  5A83 A;  2OUO A;  5EWC A;  3K2J A;  5EPR A;  2YW5 A;  4CLB A;  2D82 A;  3FKM X;  3P1D A;  2I7K A;  2RNW A;  4O76 A;  4C67 A;  5FFY A;  3Q2E A;  5C89 A;  3IU5 A;  4UYE A;  4QSQ A;  5A81 A;  4UIU A;  5IID A;  4YBT A;  3UVD A;  5FE6 A;  5EI4 A;  4IR3 A;  4PY6 A;  4YYH A;  5AD2 A;  3O35 A;  1WUG A;  4LZR A;  5CUC A;  5FE7 A;  4HXR A;  4NYX A;  5DFB A;  5FG6 A;  4CUT A;  4MEQ A;  2DKW A;  4ZW1 A;  4QC1 A;  5CPE A; 
#chains in the Genus database with same CATH topology
 5FG4 A;  4QYL A;  2YEM A;  4O72 A;  4QST A;  4HBX A;  5ENE A;  3HMH A;  4DON A;  5I1Q A;  5E3D A;  4QUT A;  5FE2 A;  5DYX A;  5TB6 A;  5LUU A;  4N4G A;  5D3S A;  4TTE A;  4WIV A;  5CQ6 A;  4NYV A;  4YY6 A;  4QB3 A;  4TT6 A;  4YAX A;  3U5O A;  3QZT A;  4YYK A;  4UIV A;  2EJN A;  5EV9 A;  4QSS A;  3U5P A;  5FDZ A;  4IOQ A;  5CQ8 A;  2MJV B;  5II2 A;  5FB1 A;  3ERR A;  3TLP A;  4MR4 A;  5EWD A;  2R10 A;  5A85 A;  4J1P A;  2F6J A;  3JVJ A;  5LVR A;  4ZQL A;  4KCX A;  3UV5 A;  5DW2 A;  2YEL A;  3GG3 A;  4AKN A;  3U5N A;  4YYG A;  3D1B A;  4QSP A;  5CQT A;  5II1 A;  5DKC A;  4QR3 A;  5L8T A;  2RNY A;  5FB0 A;  4HXO A;  4O75 A;  4YC9 A;  4ZC9 A;  5AD3 A;  4LZS A;  4MEP A;  4YK0 A;  4YYI A;  4TT4 A;  4NR5 A;  2L5E A;  5FE8 A;  4O7E A;  4QC3 A;  4HBV A;  2FSA A;  5C8G A;  5CRM A;  5HLS A;  2L84 A;  5BT5 A;  2GRC A;  5H1V A;  5KO4 A;  3U5K A;  5I89 A;  5A5R A;  5FBX A;  5LKT A;  4KV1 A;  5E73 A;  5ENF A;  5F5Z A;  5FE4 A;  5F2P A;  5I7X A;  5CQ4 A;  5HRW A;  4QSX A;  1ZS5 A;  5A5P A;  5DLX A;  5CUD A;  5G4R A;  4UYD A;  5KTX A;  5FE0 A;  5HCL A;  3P1E A;  1JSP B;  4NS5 A;  4O77 A;  5G4S A;  4UIW A;  5E9M A;  5CQ3 A;  3AAD A;  3UVX A;  4Z1Q A;  3MB3 A;  4MEN A;  5I88 A;  4XY9 A;  4OUF A;  2DAT A;  3G0L A;  5C85 A;  1WUM A;  5HFR A;  4HXM A;  5I86 A;  5CS8 A;  4TQN A;  3MQM A;  5D3P A;  5CFW A;  4TZ8 A;  4CUP A;  5F63 A;  2E7O A;  5L96 A;  3DAI A;  4QR4 A;  2E7N A;  3S92 A;  4LZ2 A;  5A5S A;  2YEK A;  4QZS A;  5E9Y A;  3UV4 A;  3LXJ A;  4QY4 A;  4NXJ A;  4HBW A;  4TS8 A;  2RNX A;  4UIX A;  4NYW A;  2D9E A;  5LJ0 A;  4QEW A;  5DW1 A;  5FE1 A;  5I7Y A;  4NQM A;  4HXS A;  3U5J A;  4UIY A;  4BHW A;  2DVQ A;  4Y03 A;  5IGN A;  5IG6 A;  4QSR A;  5EWV A;  4CFL A;  5COI A;  5HQ6 A;  4AKG A;  4Q0N A;  5EQ1 A;  5D25 A;  4UYF B;  4GPJ A;  5EU1 A;  5E9V A;  5CUG A;  5C7N A;  5FH6 A;  5L98 A;  4LYS A;  5F61 A;  3U5L A;  5JWM A;  5FFW A;  2OO1 A;  3SVH A;  4UIZ A;  4Z1S A;  5FE5 A;  3VKH A;  5CTL A;  3O36 A;  4BJX A;  5FH8 A;  4BW3 A;  5CQ7 A;  4OGJ A;  5A7C A;  4CUQ A;  5LJ1 A;  4A9K A;  4NUD A;  2RS9 B;  4ALH A;  5FE9 A;  5H85 A;  5KU3 A;  5EIS A;  4O7C A;  4A9O A;  4QEU A;  5E9K A;  4LR6 A;  4NRB A;  4UIT A;  5DBM A;  4Z6H A;  5D3T A;  4PS5 A;  5D26 A;  5L8U A;  5EM3 A;  3DWY A;  5EPS A;  5EK9 A;  4CFK A;  4LYW A;  4TYL A;  4N4H A;  5E74 A;  4XYA A;  5HEN A;  4NR9 A;  2YYN A;  5LVQ A;  4Q0O A;  3JVL A;  5EA1 A;  4NQN A;  5K29 A;  3P5O A;  4TU6 A;  4PKL A;  5EVA A;  5IGK A;  5D3L A;  5L97 A;  3D7C A;  4HBY A;  4UYF A;  5DX4 A;  4O71 A;  4LYI A;  5F1H A;  5ENH A;  5F62 A;  5ENC A;  4TZ2 A;  5FH7 A;  4IOR A;  4O7F A;  3P1C A;  4IR5 A;  4O78 A;  4E96 A;  5CY9 A;  5A5Q A;  4PTB A;  4YYM A;  1ZKR A;  3IU6 A;  4X2I A;  5BT4 A;  3MXF A;  4F3I A;  1PUO A;  3U5M A;  4A9I A;  3G0J A;  4LDF A;  5ENB A;  3P1F A;  4NRA A;  5IBN A;  3RCW A;  3UVW A;  5DFD A;  5DKD A;  3MUL A;  3O33 A;  4XUB A;  1E6I A;  5FG5 A;  4YBS A;  4Z93 A;  5HRV A;  4ALG A;  4YAT A;  5CZG A;  4TU4 A;  5CQ5 A;  4HXN A;  4A9E A;  2N9G A;  2R0Y A;  3LJW A;  5KTW A;  2RO1 A;  4QUU A;  4N3W A;  5BT3 A;  5E0R A;  5KHM A;  4QSW A;  4HXP A;  4NUE A;  5A82 A;  5HFQ A;  5EIC A;  5ENG A;  5FE3 A;  5E9L A;  5I80 A;  2DVS A;  4IOO A;  3JVK A;  4QBM A;  4CUU A;  2RI7 A;  4N4I A;  4CUS A;  4NR6 A;  3S91 A;  4IR4 A;  5LKX A;  4LRG A;  5CUB A;  4QR5 A;  3ONI A;  4O70 A;  3I3J A;  4J0R A;  5AME A;  2YQD A;  2YDW A;  5F60 A;  5D3J A;  5HQ5 A;  5DY7 A;  2DVR A;  5I29 A;  5LKZ A;  2DWW A;  2G4A A;  5ENJ A;  4QNS A;  4AKH A;  3QZV A;  2LSP B;  4BW2 A;  4LC2 A;  4A9M A;  4J0S A;  3LQI A;  4XUA A;  4IR6 A;  5FFV A;  4O7B A;  4CUR A;  5DYA A;  4O74 A;  5ENI A;  4NUC A;  4WHU A;  5A5N A;  5E3G A;  5D3R A;  4YYJ A;  5CGP A;  4N4F A;  3MUK A;  4FLP A;  4YYD A;  3SVG A;  5HM0 A;  4HXL A;  5HEL A;  4YAD A;  3O34 A;  2KTB B;  4MR6 A;  5D0C A;  5ETB A;  4A9J A;  3SVF A;  5EP7 A;  3LQH A;  2I8N A;  5EWW A;  5HJC A;  5C4Q A;  5CUE A;  5D24 A;  4UYG A;  4NRC A;  2H60 A;  4RVR A;  5D3N A;  5D3H A;  1F68 A;  4YH4 A;  5CUA A;  2DVV A;  3MB4 A;  4CL9 A;  4AI6 A;  2OSS A;  4NR8 A;  4MR3 A;  5I40 A;  4C66 A;  5HRX A;  2RFJ A;  5CU8 A;  5C87 A;  5IGL A;  2F6N A;  5D7X A;  4TT2 A;  4XY8 A;  3NXB A;  2R0V A;  2E3K A;  5JI8 A;  4OGI A;  4YBM A;  5CRZ A;  4YAB A;  3O37 A;  1N72 A;  4QEV A;  5ACY A;  5CP5 A;  5DYC A;  3HME A;  4YY4 A;  3D1D A;  4KV4 A;  4NR4 A;  5EGU A;  4HXK A;  5DLZ A;  5LJ2 A;  3ZYU A;  5F36 A;  4A9F A;  5L99 A;  5TCM A;  5IGM A;  5AMF A;  3QZS A;  1JM4 B;  4YH3 A;  5EWH A;  4QYD A;  3VKG A;  1EQF A;  5H1T A;  5HQ7 A;  1X0J A;  5HEM A;  3AQA A;  5CQA A;  4NR7 A;  5J0D A;  4A9L A;  3UW9 A;  4PCI A;  2WP2 A;  4MR5 A;  4BW4 A;  2L85 A;  5A5O A;  3HMF A;  5H1U A;  4O7A A;  2WP1 A;  4MEO A;  3JVM A;  4QSU A;  4Z6I A;  4YYN A;  2R0S A;  3Q2F A;  4BW1 A;  4PCE A;  3LQJ A;  5KTU A;  5F1L A;  5DKH A;  3UV2 A;  5DFC A;  4QSV A;  3UVY A;  5LKU A;  5EPB A;  5F3A A;  2NXB A;  5DYU A;  4WHW A;  4A9H A;  5ETD A;  5E9I A;  4A9N A;  5F25 A;  4UYH A;  5E7D A;  4J3I A;  5I83 A;  5A83 A;  2OUO A;  5EWC A;  3K2J A;  5EPR A;  2YW5 A;  4CLB A;  2D82 A;  3FKM X;  3P1D A;  2I7K A;  2RNW A;  4O76 A;  4C67 A;  4AKI A;  5FFY A;  3Q2E A;  5C89 A;  3IU5 A;  4UYE A;  4QSQ A;  5A81 A;  4UIU A;  5IID A;  4YBT A;  3UVD A;  5FE6 A;  5EI4 A;  4IR3 A;  4PY6 A;  4YYH A;  5AD2 A;  3O35 A;  1WUG A;  4LZR A;  5CUC A;  5FE7 A;  4HXR A;  4NYX A;  5DFB A;  5FG6 A;  4CUT A;  4MEQ A;  2DKW A;  4ZW1 A;  4QC1 A;  5CPE A; 
#chains in the Genus database with same CATH homology
 5FG4 A;  4QYL A;  2YEM A;  4O72 A;  4QST A;  4HBX A;  5ENE A;  3HMH A;  4DON A;  5I1Q A;  5E3D A;  4QUT A;  5FE2 A;  5DYX A;  5TB6 A;  5LUU A;  4N4G A;  5D3S A;  4TTE A;  4WIV A;  5CQ6 A;  4NYV A;  4YY6 A;  4QB3 A;  4TT6 A;  4YAX A;  3U5O A;  3QZT A;  4YYK A;  4UIV A;  5EV9 A;  4QSS A;  3U5P A;  5FDZ A;  4IOQ A;  5CQ8 A;  2MJV B;  5II2 A;  5FB1 A;  3TLP A;  4MR4 A;  5EWD A;  2R10 A;  5A85 A;  4J1P A;  2F6J A;  3JVJ A;  5LVR A;  4ZQL A;  4KCX A;  3UV5 A;  5DW2 A;  2YEL A;  3GG3 A;  4AKN A;  3U5N A;  4YYG A;  4QSP A;  5CQT A;  5II1 A;  5DKC A;  4QR3 A;  5L8T A;  2RNY A;  5FB0 A;  4HXO A;  4O75 A;  4YC9 A;  4ZC9 A;  5AD3 A;  4LZS A;  4MEP A;  4YK0 A;  4YYI A;  4TT4 A;  4NR5 A;  2L5E A;  5FE8 A;  4O7E A;  4QC3 A;  4HBV A;  2FSA A;  5C8G A;  5CRM A;  5HLS A;  2L84 A;  5BT5 A;  2GRC A;  5H1V A;  5KO4 A;  3U5K A;  5I89 A;  5A5R A;  5FBX A;  5LKT A;  4KV1 A;  5E73 A;  5ENF A;  5F5Z A;  5FE4 A;  5F2P A;  5I7X A;  5CQ4 A;  5HRW A;  4QSX A;  1ZS5 A;  5A5P A;  5DLX A;  5CUD A;  5G4R A;  4UYD A;  5KTX A;  5FE0 A;  5HCL A;  3P1E A;  1JSP B;  4NS5 A;  4O77 A;  5G4S A;  4UIW A;  5E9M A;  5CQ3 A;  3AAD A;  3UVX A;  4Z1Q A;  3MB3 A;  4MEN A;  5I88 A;  4XY9 A;  4OUF A;  2DAT A;  3G0L A;  5C85 A;  1WUM A;  5HFR A;  4HXM A;  5I86 A;  5CS8 A;  4TQN A;  3MQM A;  5D3P A;  5CFW A;  4TZ8 A;  4CUP A;  5F63 A;  2E7O A;  5L96 A;  3DAI A;  4QR4 A;  2E7N A;  3S92 A;  4LZ2 A;  5A5S A;  2YEK A;  4QZS A;  5E9Y A;  3UV4 A;  3LXJ A;  4QY4 A;  4NXJ A;  4HBW A;  4TS8 A;  2RNX A;  4UIX A;  4NYW A;  2D9E A;  5LJ0 A;  4QEW A;  5DW1 A;  5FE1 A;  5I7Y A;  4NQM A;  4HXS A;  3U5J A;  4UIY A;  4BHW A;  2DVQ A;  4Y03 A;  5IGN A;  5IG6 A;  4QSR A;  5EWV A;  4CFL A;  5COI A;  5HQ6 A;  4Q0N A;  5EQ1 A;  5D25 A;  4UYF B;  4GPJ A;  5EU1 A;  5E9V A;  5CUG A;  5C7N A;  5FH6 A;  5L98 A;  4LYS A;  5F61 A;  3U5L A;  5JWM A;  5FFW A;  2OO1 A;  3SVH A;  4UIZ A;  4Z1S A;  5FE5 A;  5CTL A;  3O36 A;  4BJX A;  5FH8 A;  4BW3 A;  5CQ7 A;  4OGJ A;  5A7C A;  4CUQ A;  5LJ1 A;  4A9K A;  4NUD A;  2RS9 B;  4ALH A;  5FE9 A;  5H85 A;  5KU3 A;  5EIS A;  4O7C A;  4A9O A;  4QEU A;  5E9K A;  4LR6 A;  4NRB A;  4UIT A;  5DBM A;  4Z6H A;  5D3T A;  4PS5 A;  5D26 A;  5L8U A;  5EM3 A;  3DWY A;  5EPS A;  5EK9 A;  4CFK A;  4LYW A;  4TYL A;  4N4H A;  5E74 A;  4XYA A;  5HEN A;  4NR9 A;  2YYN A;  5LVQ A;  4Q0O A;  3JVL A;  5EA1 A;  4NQN A;  5K29 A;  3P5O A;  4TU6 A;  4PKL A;  5EVA A;  5IGK A;  5D3L A;  5L97 A;  3D7C A;  4HBY A;  4UYF A;  5DX4 A;  4O71 A;  4LYI A;  5F1H A;  5ENH A;  5F62 A;  5ENC A;  4TZ2 A;  5FH7 A;  4IOR A;  4O7F A;  3P1C A;  4IR5 A;  4O78 A;  4E96 A;  5CY9 A;  5A5Q A;  4PTB A;  4YYM A;  3IU6 A;  4X2I A;  5BT4 A;  3MXF A;  4F3I A;  3U5M A;  4A9I A;  3G0J A;  4LDF A;  5ENB A;  3P1F A;  4NRA A;  5IBN A;  3RCW A;  3UVW A;  5DFD A;  5DKD A;  3MUL A;  3O33 A;  4XUB A;  1E6I A;  5FG5 A;  4YBS A;  4Z93 A;  5HRV A;  4ALG A;  4YAT A;  5CZG A;  4TU4 A;  5CQ5 A;  4HXN A;  4A9E A;  2N9G A;  2R0Y A;  3LJW A;  5KTW A;  2RO1 A;  4QUU A;  4N3W A;  5BT3 A;  5E0R A;  5KHM A;  4QSW A;  4HXP A;  4NUE A;  5A82 A;  5HFQ A;  5EIC A;  5ENG A;  5FE3 A;  5E9L A;  5I80 A;  2DVS A;  4IOO A;  3JVK A;  4QBM A;  4CUU A;  2RI7 A;  4N4I A;  4CUS A;  4NR6 A;  3S91 A;  4IR4 A;  5LKX A;  4LRG A;  5CUB A;  4QR5 A;  3ONI A;  4O70 A;  3I3J A;  4J0R A;  5AME A;  2YQD A;  2YDW A;  5F60 A;  5D3J A;  5HQ5 A;  5DY7 A;  2DVR A;  5I29 A;  5LKZ A;  2DWW A;  2G4A A;  5ENJ A;  4QNS A;  3QZV A;  2LSP B;  4BW2 A;  4LC2 A;  4A9M A;  4J0S A;  3LQI A;  4XUA A;  4IR6 A;  5FFV A;  4O7B A;  4CUR A;  5DYA A;  4O74 A;  5ENI A;  4NUC A;  4WHU A;  5A5N A;  5E3G A;  5D3R A;  4YYJ A;  5CGP A;  4N4F A;  3MUK A;  4FLP A;  4YYD A;  3SVG A;  5HM0 A;  4HXL A;  5HEL A;  4YAD A;  3O34 A;  2KTB B;  4MR6 A;  5D0C A;  5ETB A;  4A9J A;  3SVF A;  5EP7 A;  3LQH A;  2I8N A;  5EWW A;  5HJC A;  5C4Q A;  5CUE A;  5D24 A;  4UYG A;  4NRC A;  2H60 A;  4RVR A;  5D3N A;  5D3H A;  1F68 A;  4YH4 A;  5CUA A;  2DVV A;  3MB4 A;  4CL9 A;  2OSS A;  4NR8 A;  4MR3 A;  5I40 A;  4C66 A;  5HRX A;  2RFJ A;  5CU8 A;  5C87 A;  5IGL A;  2F6N A;  5D7X A;  4TT2 A;  4XY8 A;  3NXB A;  2R0V A;  2E3K A;  5JI8 A;  4OGI A;  4YBM A;  5CRZ A;  4YAB A;  3O37 A;  1N72 A;  4QEV A;  5ACY A;  5CP5 A;  5DYC A;  3HME A;  4YY4 A;  4KV4 A;  4NR4 A;  5EGU A;  4HXK A;  5DLZ A;  5LJ2 A;  3ZYU A;  5F36 A;  4A9F A;  5L99 A;  5TCM A;  5IGM A;  5AMF A;  3QZS A;  1JM4 B;  4YH3 A;  5EWH A;  4QYD A;  1EQF A;  5H1T A;  5HQ7 A;  1X0J A;  5HEM A;  3AQA A;  5CQA A;  4NR7 A;  5J0D A;  4A9L A;  3UW9 A;  4PCI A;  2WP2 A;  4MR5 A;  4BW4 A;  2L85 A;  5A5O A;  3HMF A;  5H1U A;  4O7A A;  2WP1 A;  4MEO A;  3JVM A;  4QSU A;  4Z6I A;  4YYN A;  2R0S A;  3Q2F A;  4BW1 A;  4PCE A;  3LQJ A;  5KTU A;  5F1L A;  5DKH A;  3UV2 A;  5DFC A;  4QSV A;  3UVY A;  5LKU A;  5EPB A;  5F3A A;  2NXB A;  5DYU A;  4WHW A;  4A9H A;  5ETD A;  5E9I A;  4A9N A;  5F25 A;  4UYH A;  5E7D A;  4J3I A;  5I83 A;  5A83 A;  2OUO A;  5EWC A;  3K2J A;  5EPR A;  2YW5 A;  4CLB A;  2D82 A;  3FKM X;  3P1D A;  2I7K A;  2RNW A;  4O76 A;  4C67 A;  5FFY A;  3Q2E A;  5C89 A;  3IU5 A;  4UYE A;  4QSQ A;  5A81 A;  4UIU A;  5IID A;  4YBT A;  3UVD A;  5FE6 A;  5EI4 A;  4IR3 A;  4PY6 A;  4YYH A;  5AD2 A;  3O35 A;  1WUG A;  4LZR A;  5CUC A;  5FE7 A;  4HXR A;  4NYX A;  5DFB A;  5FG6 A;  4CUT A;  4MEQ A;  2DKW A;  4ZW1 A;  4QC1 A;  5CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...