3G0JA

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
ISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
rcsb
source organism Homo sapiens
total genus 40
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3g0jA00
3UW9A 5DYUA 5FB0A 5L8TA 3DAIA 4QSSA 4LDFA 2F6NA 5KTUA 4Q0OA 4QEWA 4TYLA 5II2A 5D24A 4CUSA 4CUTA 5CQAA 5K29A 2RI7A 4QR4A 5I86A 5F25A 5BT5A 4J0SA 2LSPB 3O33A 4XYAA 5AMEA 4N4GA 2R10A 5HFQA 3K2JA 5FE8A 2RFJA 4UYEA 5HM0A 5LKUA 4QB3A 4J3IA 4O7AA 2OSSA 4QR3A 5LJ1A 4CL9A 4UYGA 4YATA 4ALHA 4CLBA 5ENIA 5CUBA 5FE2A 3P1FA 4YYKA 3HMHA 4HBYA 2DWWA 4YH3A 5CS8A 5ENEA 2KTBB 4XUAA 2MJVB 4CFLA 4TTEA 5L96A 5C85A 2YEMA 5FBXA 4A9FA 4QYLA 4LC2A 5E3GA 5F63A 4MR4A 2YW5A 2RNWA 3AQAA 5FE4A 4PY6A 4YYJA 3FKMX 5DKHA 5CTLA 5EV9A 3UVWA 5BT4A 5LKTA 3QZSA 1X0JA 4IR6A 2DVVA 5F1LA 5LKZA 5HRXA 5FH8A 5C89A 5ENFA 4FLPA 4A9KA 3JVJA 4O7CA 5EWCA 3UV5A 4NUDA 4MEQA 3MB4A 5HCLA 5CUGA 5FE9A 4QYDA 3JVLA 2I7KA 4F3IA 4A9LA 5D0CA 5FG4A 4UITA 2DKWA 4N3WA 4YBSA 5F2PA 3MB3A 4Z93A 4WHWA 5A5PA 5LKXA 4LRGA 4UIUA 4O78A 5CQ5A 3UV4A 2R0VA 4YABA 5E9VA 2DVSA 4LYSA 5I40A 2RNYA 3O34A 4YYDA 5A5OA 5EWDA 3ONIA 4MEPA 1WUMA 5C8GA 3U5JA 2E7NA 3GG3A 4NR9A 5ENHA 4OUFA 5BT3A 5FFYA 4J1PA 5FG5A 5I80A 5IGLA 5H85A 3JVMA 4ALGA 4YH4A 4X2IA 5I7XA 4IOQA 5FE0A 5E9IA 3IU6A 5EP7A 4XUBA 5CQ8A 3UV2A 4QSTA 4YBTA 3LJWA 3AADA 4NUCA 5E3DA 4KV4A 3S91A 4NR5A 4QEVA 5DFCA 5HQ6A 4QSVA 4QZSA 3U5PA 3UVXA 4NRCA 1EQFA 4BHWA 3P5OA 2WP2A 4O71A 3UVDA 5C4QA 4HBWA 5G4RA 5EICA 5EWHA 4IOOA 2YDWA 4HBVA 2R0SA 5EK9A 2N9GA 4O70A 4PCIA 5EPSA 4BJXA 2WP1A 4LZSA 5ENJA 3HMFA 5A82A 5LVQA 4HXPA 4O77A 5E7DA 4A9NA 5CQ7A 3MULA 4RVRA 4PKLA 5E73A 4PTBA 5H1VA 5HLSA 2DATA 5KTXA 5C87A 5AD2A 5H1UA 4CUUA 5CRZA 5F60A 1F68A 5L99A 5LVRA 4PS5A 4BW3A 3P1DA 4NYWA 5FE5A 4NS5A 2D9EA 2L85A 1JSPB 5CUAA 4TU6A 5CU8A 5HQ5A 5E0RA 5E9KA 5DY7A 4QSRA 3IU5A 5L8UA 5CQ4A 5D3NA 5JWMA 3LQJA 4TS8A 5D3PA 4YY4A 1E6IA 4YC9A 5E9YA 5EM3A 5A85A 3D7CA 5J0DA 4OGJA 4A9JA 5ENBA 4UIXA 5ACYA 5A83A 5F1HA 5EQ1A 5A5RA 4QEUA 4IR4A 4YYIA 5D3TA 4IORA 4NRBA 5DYXA 5CGPA 5DW1A 4LYWA 4HXMA 4UYFA 5LJ2A 4QUUA 4UYFB 5FG6A 5CY9A 5D26A 2I8NA 5HEMA 5D3HA 4HBXA 5L98A 4O7FA 4Z1SA 5CPEA 4NQMA 5H1TA 4OGIA 4TT4A 2RNXA 2YQDA 5CQTA 4ZQLA 5E9MA 4UYDA 5D3RA 5D3SA 3JVKA 4YY6A 4NUEA 3UVYA 3QZVA 4ZW1A 5FH7A 3LXJA 5A5SA 5FFVA 3U5LA 4MENA 4MR3A 4TT2A 4WIVA 3G0JA 5I7YA 5A7CA 5KU3A 5A81A 4NXJA 4CUQA 5AD3A 3QZTA 4A9HA 4O76A 3I3JA 4LR6A 4WHUA 5KHMA 4QUTA 5ENCA 5FE1A 5DKDA 4TQNA 5DFBA 5D3JA 4GPJA 5HFRA 4TT6A 4UIVA 3P1CA 2DVQA 5DBMA 2DVRA 5JI8A 5EPRA 4KCXA 5FH6A 5A5NA 3MUKA 4PCEA 4NR7A 5HQ7A 4J0RA 3U5NA 4NR4A 4YBMA 4O72A 3O35A 5HRWA 5ETDA 3HMEA 4UYHA 4IR5A 2E3KA 1WUGA 4DONA 5F36A 5C7NA 4A9EA 4Y03A 4XY9A 4XY8A 4A9IA 2YEKA 3Q2FA 5EWWA 3TLPA 2L84A 4AKNA 5HRVA 2FSAA 5DKCA 5L97A 5F61A 5FE3A 3U5OA 4Z6IA 4QC1A 4CFKA 4YADA 5IGNA 5EI4A 4NR6A 3ZYUA 5IGKA 5G4SA 4N4HA 4QSPA 3U5KA 5EISA 5DYAA 4A9MA 4QNSA 3SVHA 4N4FA 2G4AA 5ETBA 1ZS5A 5E74A 4YK0A 4HXRA 3MXFA 3NXBA 5CZGA 2YELA 5TCMA 5HENA 5AMFA 5EGUA 5EU1A 4C67A 2F6JA 4Q0NA 4QSUA 5DX4A 5FB1A 5TB6A 3Q2EA 2D82A 5A5QA 5CUCA 3O36A 4O7BA 5I89A 1JM4B 3LQIA 4MEOA 5DW2A 5FFWA 2L5EA 4A9OA 4QBMA 4N4IA 4CUPA 5IGMA 5I88A 5KTWA 4YYHA 4IR3A 3DWYA 2NXBA 5I83A 4NQNA 4QSQA 4Z6HA 4NYXA 5FDZA 2YYNA 4QSXA 3P1EA 5IBNA 5HELA 3RCWA 2OUOA 5KO4A 5LUUA 2OO1A 4BW1A 5HJCA 2RS9B 4YAXA 2H60A 5D7XA 5DLXA 5CRMA 4UIWA 5II1A 5I29A 4HXOA 3G0LA 4YYGA 4HXSA 4TU4A 3S92A 4LZRA 5CQ6A 3U5MA 5DYCA 4NYVA 5DFDA 3O37A 1N72A 2E7OA 4E96A 5CUEA 2R0YA 4MR6A 5CQ3A 5F5ZA 5EPBA 4O7EA 4NRAA 5EA1A 5EWVA 4MR5A 5EVAA 5COIA 4QSWA 4NR8A 4BW2A 4HXKA 5LJ0A 4C66A 4TZ8A 4ZC9A 5DLZA 5F62A 4O75A 4UIYA 3LQHA 5IIDA 4O74A 5D3LA 4TZ2A 4YYNA 5E9LA 3SVFA 5D25A 4CURA 2GRCA 3MQMA 4QR5A 4LYIA 4QY4A 5ENGA 4YYMA 4HXNA 4HXLA 5CUDA 5FE7A 5I1QA 4LZ2A 5CFWA 5CP5A 4KV1A 5IG6A 4BW4A 2RO1A 4Z1QA 5FE6A 3SVGA 4UIZA 5F3AA 4QC3A
chains in the Genus database with same CATH superfamily
3UW9A 5DYUA 5FB0A 5L8TA 3DAIA 4QSSA 4LDFA 2F6NA 5KTUA 1ZKRA 4AKGA 4Q0OA 4QEWA 4TYLA 5II2A 5D24A 4CUSA 4CUTA 5CQAA 5K29A 2RI7A 4QR4A 5I86A 5F25A 5BT5A 4J0SA 2LSPB 3O33A 4XYAA 5AMEA 4N4GA 2R10A 5HFQA 3K2JA 5FE8A 2RFJA 4UYEA 5HM0A 5LKUA 3VKGA 4QB3A 4J3IA 4O7AA 2OSSA 4QR3A 5LJ1A 4CL9A 4UYGA 4YATA 4ALHA 4CLBA 5ENIA 5CUBA 5FE2A 3P1FA 4YYKA 3HMHA 4HBYA 2DWWA 4YH3A 5CS8A 5ENEA 2KTBB 4XUAA 2MJVB 4CFLA 4TTEA 5L96A 5C85A 2YEMA 5FBXA 4A9FA 4QYLA 4LC2A 5E3GA 5F63A 4MR4A 2YW5A 2RNWA 3AQAA 5FE4A 4PY6A 4YYJA 3FKMX 5DKHA 5CTLA 5EV9A 3UVWA 5BT4A 5LKTA 3QZSA 1X0JA 4IR6A 2DVVA 5F1LA 5LKZA 5HRXA 5FH8A 5C89A 3VKHA 5ENFA 4FLPA 4A9KA 3JVJA 4O7CA 5EWCA 3UV5A 4NUDA 4MEQA 3MB4A 5HCLA 5CUGA 5FE9A 4QYDA 3JVLA 2I7KA 4F3IA 4A9LA 5D0CA 5FG4A 4UITA 2DKWA 4N3WA 4YBSA 5F2PA 3MB3A 4Z93A 4WHWA 5A5PA 5LKXA 4LRGA 4UIUA 4O78A 5CQ5A 3UV4A 2R0VA 4YABA 5E9VA 2DVSA 4LYSA 5I40A 2RNYA 3O34A 4YYDA 5A5OA 5EWDA 3ONIA 4MEPA 1WUMA 5C8GA 3U5JA 2E7NA 3GG3A 4NR9A 5ENHA 4OUFA 5BT3A 5FFYA 4J1PA 5FG5A 5I80A 5IGLA 5H85A 3JVMA 4ALGA 4YH4A 4X2IA 5I7XA 4IOQA 5FE0A 5E9IA 3IU6A 5EP7A 4XUBA 5CQ8A 3UV2A 4QSTA 4YBTA 3LJWA 3AADA 4NUCA 5E3DA 4KV4A 3S91A 4NR5A 4QEVA 5DFCA 5HQ6A 4QSVA 4QZSA 3U5PA 3UVXA 4NRCA 1EQFA 4BHWA 3P5OA 2WP2A 4O71A 3UVDA 5C4QA 4HBWA 5G4RA 5EICA 5EWHA 4IOOA 2YDWA 4HBVA 2R0SA 5EK9A 2N9GA 4O70A 4PCIA 3D1BA 5EPSA 4BJXA 2WP1A 4LZSA 5ENJA 3HMFA 5A82A 5LVQA 4HXPA 4O77A 5E7DA 4A9NA 5CQ7A 3MULA 4RVRA 4PKLA 5E73A 4PTBA 5H1VA 5HLSA 2DATA 5KTXA 5C87A 5AD2A 5H1UA 4CUUA 5CRZA 5F60A 1F68A 5L99A 5LVRA 4PS5A 4BW3A 3P1DA 4NYWA 5FE5A 4NS5A 2D9EA 2L85A 1JSPB 5CUAA 4TU6A 5CU8A 5HQ5A 5E0RA 5E9KA 5DY7A 4QSRA 3IU5A 5L8UA 5CQ4A 5D3NA 5JWMA 3LQJA 4TS8A 4AKHA 5D3PA 4YY4A 1E6IA 4YC9A 5E9YA 5EM3A 5A85A 3D7CA 5J0DA 4OGJA 4A9JA 5ENBA 4UIXA 5ACYA 5A83A 5F1HA 5EQ1A 5A5RA 4QEUA 4IR4A 4YYIA 5D3TA 4IORA 4NRBA 5DYXA 5CGPA 5DW1A 4LYWA 4HXMA 4UYFA 5LJ2A 4QUUA 4UYFB 5FG6A 5CY9A 3ERRA 5D26A 2I8NA 5HEMA 5D3HA 4HBXA 5L98A 4O7FA 4Z1SA 5CPEA 4NQMA 5H1TA 4OGIA 4TT4A 2RNXA 2YQDA 5CQTA 4ZQLA 5E9MA 4UYDA 5D3RA 5D3SA 3JVKA 4YY6A 4NUEA 3UVYA 3QZVA 4ZW1A 5FH7A 3LXJA 5A5SA 5FFVA 3U5LA 4MENA 4MR3A 4TT2A 4WIVA 3G0JA 5I7YA 5A7CA 5KU3A 5A81A 4NXJA 4CUQA 5AD3A 3QZTA 4A9HA 4AI6A 4O76A 3I3JA 4LR6A 4WHUA 5KHMA 4QUTA 5ENCA 5FE1A 5DKDA 4TQNA 5DFBA 5D3JA 4GPJA 5HFRA 4TT6A 4UIVA 3P1CA 2DVQA 5DBMA 2DVRA 5JI8A 5EPRA 4KCXA 5FH6A 5A5NA 3MUKA 4PCEA 4AKIA 4NR7A 5HQ7A 4J0RA 3U5NA 4NR4A 4YBMA 4O72A 3O35A 2EJNA 5HRWA 5ETDA 3HMEA 4UYHA 4IR5A 2E3KA 1WUGA 4DONA 5F36A 5C7NA 4A9EA 4Y03A 4XY9A 4XY8A 4A9IA 2YEKA 3Q2FA 5EWWA 3TLPA 2L84A 4AKNA 5HRVA 2FSAA 5DKCA 5L97A 5F61A 5FE3A 3U5OA 4Z6IA 4QC1A 4CFKA 4YADA 5IGNA 5EI4A 4NR6A 3ZYUA 5IGKA 5G4SA 4N4HA 4QSPA 3U5KA 5EISA 5DYAA 4A9MA 4QNSA 3SVHA 4N4FA 2G4AA 5ETBA 1ZS5A 5E74A 4YK0A 4HXRA 3MXFA 3NXBA 5CZGA 2YELA 5TCMA 5HENA 5AMFA 5EGUA 5EU1A 4C67A 2F6JA 4Q0NA 4QSUA 5DX4A 5FB1A 5TB6A 3Q2EA 2D82A 5A5QA 5CUCA 3O36A 4O7BA 5I89A 1JM4B 3LQIA 4MEOA 5DW2A 5FFWA 2L5EA 4A9OA 4QBMA 4N4IA 4CUPA 5IGMA 5I88A 5KTWA 4YYHA 4IR3A 3DWYA 2NXBA 5I83A 4NQNA 4QSQA 4Z6HA 4NYXA 5FDZA 2YYNA 4QSXA 3P1EA 5IBNA 5HELA 3RCWA 2OUOA 5KO4A 5LUUA 2OO1A 4BW1A 5HJCA 2RS9B 1PUOA 4YAXA 2H60A 5D7XA 5DLXA 5CRMA 4UIWA 5II1A 5I29A 4HXOA 3G0LA 4YYGA 4HXSA 3D1DA 4TU4A 3S92A 4LZRA 5CQ6A 3U5MA 5DYCA 4NYVA 5DFDA 3O37A 1N72A 2E7OA 4E96A 5CUEA 2R0YA 4MR6A 5CQ3A 5F5ZA 5EPBA 4O7EA 4NRAA 5EA1A 5EWVA 4MR5A 5EVAA 5COIA 4QSWA 4NR8A 4BW2A 4HXKA 5LJ0A 4C66A 4TZ8A 4ZC9A 5DLZA 5F62A 4O75A 4UIYA 3LQHA 5IIDA 4O74A 5D3LA 4TZ2A 4YYNA 5E9LA 3SVFA 5D25A 4CURA 2GRCA 3MQMA 4QR5A 4LYIA 4QY4A 5ENGA 4YYMA 4HXNA 4HXLA 5CUDA 5FE7A 5I1QA 4LZ2A 5CFWA 5CP5A 4KV1A 5IG6A 4BW4A 2RO1A 4Z1QA 5FE6A 3SVGA 4UIZA 5F3AA 4QC3A
chains in the Genus database with same CATH topology
3UW9A 5DYUA 5FB0A 5L8TA 3DAIA 4QSSA 4LDFA 2F6NA 5KTUA 4Q0OA 4QEWA 4TYLA 5II2A 5D24A 4CUSA 4CUTA 5CQAA 5K29A 2RI7A 4QR4A 5I86A 5F25A 5BT5A 4J0SA 2LSPB 3O33A 4XYAA 5AMEA 4N4GA 2R10A 5HFQA 3K2JA 5FE8A 2RFJA 4UYEA 5HM0A 5LKUA 4QB3A 4J3IA 4O7AA 2OSSA 4QR3A 5LJ1A 4CL9A 4UYGA 4YATA 4ALHA 4CLBA 5ENIA 5CUBA 5FE2A 3P1FA 4YYKA 3HMHA 4HBYA 2DWWA 4YH3A 5CS8A 5ENEA 2KTBB 4XUAA 2MJVB 4CFLA 4TTEA 5L96A 5C85A 2YEMA 5FBXA 4A9FA 4QYLA 4LC2A 5E3GA 5F63A 4MR4A 2YW5A 2RNWA 3AQAA 5FE4A 4PY6A 4YYJA 3FKMX 5DKHA 5CTLA 5EV9A 3UVWA 5BT4A 5LKTA 3QZSA 1X0JA 4IR6A 2DVVA 5F1LA 5LKZA 5HRXA 5FH8A 5C89A 5ENFA 4FLPA 4A9KA 3JVJA 4O7CA 5EWCA 3UV5A 4NUDA 4MEQA 3MB4A 5HCLA 5CUGA 5FE9A 4QYDA 3JVLA 2I7KA 4F3IA 4A9LA 5D0CA 5FG4A 4UITA 2DKWA 4N3WA 4YBSA 5F2PA 3MB3A 4Z93A 4WHWA 5A5PA 5LKXA 4LRGA 4UIUA 4O78A 5CQ5A 3UV4A 2R0VA 4YABA 5E9VA 2DVSA 4LYSA 5I40A 2RNYA 3O34A 4YYDA 5A5OA 5EWDA 3ONIA 4MEPA 1WUMA 5C8GA 3U5JA 2E7NA 3GG3A 4NR9A 5ENHA 4OUFA 5BT3A 5FFYA 4J1PA 5FG5A 5I80A 5IGLA 5H85A 3JVMA 4ALGA 4YH4A 4X2IA 5I7XA 4IOQA 5FE0A 5E9IA 3IU6A 5EP7A 4XUBA 5CQ8A 3UV2A 4QSTA 4YBTA 3LJWA 3AADA 4NUCA 5E3DA 4KV4A 3S91A 4NR5A 4QEVA 5DFCA 5HQ6A 4QSVA 4QZSA 3U5PA 3UVXA 4NRCA 1EQFA 4BHWA 3P5OA 2WP2A 4O71A 3UVDA 5C4QA 4HBWA 5G4RA 5EICA 5EWHA 4IOOA 2YDWA 4HBVA 2R0SA 5EK9A 2N9GA 4O70A 4PCIA 5EPSA 4BJXA 2WP1A 4LZSA 5ENJA 3HMFA 5A82A 5LVQA 4HXPA 4O77A 5E7DA 4A9NA 5CQ7A 3MULA 4RVRA 4PKLA 5E73A 4PTBA 5H1VA 5HLSA 2DATA 5KTXA 5C87A 5AD2A 5H1UA 4CUUA 5CRZA 5F60A 1F68A 5L99A 5LVRA 4PS5A 4BW3A 3P1DA 4NYWA 5FE5A 4NS5A 2D9EA 2L85A 1JSPB 5CUAA 4TU6A 5CU8A 5HQ5A 5E0RA 5E9KA 5DY7A 4QSRA 3IU5A 5L8UA 5CQ4A 5D3NA 5JWMA 3LQJA 4TS8A 5D3PA 4YY4A 1E6IA 4YC9A 5E9YA 5EM3A 5A85A 3D7CA 5J0DA 4OGJA 4A9JA 5ENBA 4UIXA 5ACYA 5A83A 5F1HA 5EQ1A 5A5RA 4QEUA 4IR4A 4YYIA 5D3TA 4IORA 4NRBA 5DYXA 5CGPA 5DW1A 4LYWA 4HXMA 4UYFA 5LJ2A 4QUUA 4UYFB 5FG6A 5CY9A 5D26A 2I8NA 5HEMA 5D3HA 4HBXA 5L98A 4O7FA 4Z1SA 5CPEA 4NQMA 5H1TA 4OGIA 4TT4A 2RNXA 2YQDA 5CQTA 4ZQLA 5E9MA 4UYDA 5D3RA 5D3SA 3JVKA 4YY6A 4NUEA 3UVYA 3QZVA 4ZW1A 5FH7A 3LXJA 5A5SA 5FFVA 3U5LA 4MENA 4MR3A 4TT2A 4WIVA 3G0JA 5I7YA 5A7CA 5KU3A 5A81A 4NXJA 4CUQA 5AD3A 3QZTA 4A9HA 4O76A 3I3JA 4LR6A 4WHUA 5KHMA 4QUTA 5ENCA 5FE1A 5DKDA 4TQNA 5DFBA 5D3JA 4GPJA 5HFRA 4TT6A 4UIVA 3P1CA 2DVQA 5DBMA 2DVRA 5JI8A 5EPRA 4KCXA 5FH6A 5A5NA 3MUKA 4PCEA 4NR7A 5HQ7A 4J0RA 3U5NA 4NR4A 4YBMA 4O72A 3O35A 5HRWA 5ETDA 3HMEA 4UYHA 4IR5A 2E3KA 1WUGA 4DONA 5F36A 5C7NA 4A9EA 4Y03A 4XY9A 4XY8A 4A9IA 2YEKA 3Q2FA 5EWWA 3TLPA 2L84A 4AKNA 5HRVA 2FSAA 5DKCA 5L97A 5F61A 5FE3A 3U5OA 4Z6IA 4QC1A 4CFKA 4YADA 5IGNA 5EI4A 4NR6A 3ZYUA 5IGKA 5G4SA 4N4HA 4QSPA 3U5KA 5EISA 5DYAA 4A9MA 4QNSA 3SVHA 4N4FA 2G4AA 5ETBA 1ZS5A 5E74A 4YK0A 4HXRA 3MXFA 3NXBA 5CZGA 2YELA 5TCMA 5HENA 5AMFA 5EGUA 5EU1A 4C67A 2F6JA 4Q0NA 4QSUA 5DX4A 5FB1A 5TB6A 3Q2EA 2D82A 5A5QA 5CUCA 3O36A 4O7BA 5I89A 1JM4B 3LQIA 4MEOA 5DW2A 5FFWA 2L5EA 4A9OA 4QBMA 4N4IA 4CUPA 5IGMA 5I88A 5KTWA 4YYHA 4IR3A 3DWYA 2NXBA 5I83A 4NQNA 4QSQA 4Z6HA 4NYXA 5FDZA 2YYNA 4QSXA 3P1EA 5IBNA 5HELA 3RCWA 2OUOA 5KO4A 5LUUA 2OO1A 4BW1A 5HJCA 2RS9B 4YAXA 2H60A 5D7XA 5DLXA 5CRMA 4UIWA 5II1A 5I29A 4HXOA 3G0LA 4YYGA 4HXSA 4TU4A 3S92A 4LZRA 5CQ6A 3U5MA 5DYCA 4NYVA 5DFDA 3O37A 1N72A 2E7OA 4E96A 5CUEA 2R0YA 4MR6A 5CQ3A 5F5ZA 5EPBA 4O7EA 4NRAA 5EA1A 5EWVA 4MR5A 5EVAA 5COIA 4QSWA 4NR8A 4BW2A 4HXKA 5LJ0A 4C66A 4TZ8A 4ZC9A 5DLZA 5F62A 4O75A 4UIYA 3LQHA 5IIDA 4O74A 5D3LA 4TZ2A 4YYNA 5E9LA 3SVFA 5D25A 4CURA 2GRCA 3MQMA 4QR5A 4LYIA 4QY4A 5ENGA 4YYMA 4HXNA 4HXLA 5CUDA 5FE7A 5I1QA 4LZ2A 5CFWA 5CP5A 4KV1A 5IG6A 4BW4A 2RO1A 4Z1QA 5FE6A 3SVGA 4UIZA 5F3AA 4QC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW9 A;  5DYU A;  5FB0 A;  5L8T A;  3DAI A;  4QSS A;  4LDF A;  2F6N A;  5KTU A;  4Q0O A;  4QEW A;  4TYL A;  5II2 A;  5D24 A;  4CUS A;  4CUT A;  5CQA A;  5K29 A;  2RI7 A;  4QR4 A;  5I86 A;  5F25 A;  5BT5 A;  4J0S A;  2LSP B;  3O33 A;  4XYA A;  5AME A;  4N4G A;  2R10 A;  5HFQ A;  3K2J A;  5FE8 A;  2RFJ A;  4UYE A;  5HM0 A;  5LKU A;  4QB3 A;  4J3I A;  4O7A A;  2OSS A;  4QR3 A;  5LJ1 A;  4CL9 A;  4UYG A;  4YAT A;  4ALH A;  4CLB A;  5ENI A;  5CUB A;  5FE2 A;  3P1F A;  4YYK A;  3HMH A;  4HBY A;  2DWW A;  4YH3 A;  5CS8 A;  5ENE A;  2KTB B;  4XUA A;  2MJV B;  4CFL A;  4TTE A;  5L96 A;  5C85 A;  2YEM A;  5FBX A;  4A9F A;  4QYL A;  4LC2 A;  5E3G A;  5F63 A;  4MR4 A;  2YW5 A;  2RNW A;  3AQA A;  5FE4 A;  4PY6 A;  4YYJ A;  3FKM X;  5DKH A;  5CTL A;  5EV9 A;  3UVW A;  5BT4 A;  5LKT A;  3QZS A;  1X0J A;  4IR6 A;  2DVV A;  5F1L A;  5LKZ A;  5HRX A;  5FH8 A;  5C89 A;  5ENF A;  4FLP A;  4A9K A;  3JVJ A;  4O7C A;  5EWC A;  3UV5 A;  4NUD A;  4MEQ A;  3MB4 A;  5HCL A;  5CUG A;  5FE9 A;  4QYD A;  3JVL A;  2I7K A;  4F3I A;  4A9L A;  5D0C A;  5FG4 A;  4UIT A;  2DKW A;  4N3W A;  4YBS A;  5F2P A;  3MB3 A;  4Z93 A;  4WHW A;  5A5P A;  5LKX A;  4LRG A;  4UIU A;  4O78 A;  5CQ5 A;  3UV4 A;  2R0V A;  4YAB A;  5E9V A;  2DVS A;  4LYS A;  5I40 A;  2RNY A;  3O34 A;  4YYD A;  5A5O A;  5EWD A;  3ONI A;  4MEP A;  1WUM A;  5C8G A;  3U5J A;  2E7N A;  3GG3 A;  4NR9 A;  5ENH A;  4OUF A;  5BT3 A;  5FFY A;  4J1P A;  5FG5 A;  5I80 A;  5IGL A;  5H85 A;  3JVM A;  4ALG A;  4YH4 A;  4X2I A;  5I7X A;  4IOQ A;  5FE0 A;  5E9I A;  3IU6 A;  5EP7 A;  4XUB A;  5CQ8 A;  3UV2 A;  4QST A;  4YBT A;  3LJW A;  3AAD A;  4NUC A;  5E3D A;  4KV4 A;  3S91 A;  4NR5 A;  4QEV A;  5DFC A;  5HQ6 A;  4QSV A;  4QZS A;  3U5P A;  3UVX A;  4NRC A;  1EQF A;  4BHW A;  3P5O A;  2WP2 A;  4O71 A;  3UVD A;  5C4Q A;  4HBW A;  5G4R A;  5EIC A;  5EWH A;  4IOO A;  2YDW A;  4HBV A;  2R0S A;  5EK9 A;  2N9G A;  4O70 A;  4PCI A;  5EPS A;  4BJX A;  2WP1 A;  4LZS A;  5ENJ A;  3HMF A;  5A82 A;  5LVQ A;  4HXP A;  4O77 A;  5E7D A;  4A9N A;  5CQ7 A;  3MUL A;  4RVR A;  4PKL A;  5E73 A;  4PTB A;  5H1V A;  5HLS A;  2DAT A;  5KTX A;  5C87 A;  5AD2 A;  5H1U A;  4CUU A;  5CRZ A;  5F60 A;  1F68 A;  5L99 A;  5LVR A;  4PS5 A;  4BW3 A;  3P1D A;  4NYW A;  5FE5 A;  4NS5 A;  2D9E A;  2L85 A;  1JSP B;  5CUA A;  4TU6 A;  5CU8 A;  5HQ5 A;  5E0R A;  5E9K A;  5DY7 A;  4QSR A;  3IU5 A;  5L8U A;  5CQ4 A;  5D3N A;  5JWM A;  3LQJ A;  4TS8 A;  5D3P A;  4YY4 A;  1E6I A;  4YC9 A;  5E9Y A;  5EM3 A;  5A85 A;  3D7C A;  5J0D A;  4OGJ A;  4A9J A;  5ENB A;  4UIX A;  5ACY A;  5A83 A;  5F1H A;  5EQ1 A;  5A5R A;  4QEU A;  4IR4 A;  4YYI A;  5D3T A;  4IOR A;  4NRB A;  5DYX A;  5CGP A;  5DW1 A;  4LYW A;  4HXM A;  4UYF A;  5LJ2 A;  4QUU A;  4UYF B;  5FG6 A;  5CY9 A;  5D26 A;  2I8N A;  5HEM A;  5D3H A;  4HBX A;  5L98 A;  4O7F A;  4Z1S A;  5CPE A;  4NQM A;  5H1T A;  4OGI A;  4TT4 A;  2RNX A;  2YQD A;  5CQT A;  4ZQL A;  5E9M A;  4UYD A;  5D3R A;  5D3S A;  3JVK A;  4YY6 A;  4NUE A;  3UVY A;  3QZV A;  4ZW1 A;  5FH7 A;  3LXJ A;  5A5S A;  5FFV A;  3U5L A;  4MEN A;  4MR3 A;  4TT2 A;  4WIV A;  3G0J A;  5I7Y A;  5A7C A;  5KU3 A;  5A81 A;  4NXJ A;  4CUQ A;  5AD3 A;  3QZT A;  4A9H A;  4O76 A;  3I3J A;  4LR6 A;  4WHU A;  5KHM A;  4QUT A;  5ENC A;  5FE1 A;  5DKD A;  4TQN A;  5DFB A;  5D3J A;  4GPJ A;  5HFR A;  4TT6 A;  4UIV A;  3P1C A;  2DVQ A;  5DBM A;  2DVR A;  5JI8 A;  5EPR A;  4KCX A;  5FH6 A;  5A5N A;  3MUK A;  4PCE A;  4NR7 A;  5HQ7 A;  4J0R A;  3U5N A;  4NR4 A;  4YBM A;  4O72 A;  3O35 A;  5HRW A;  5ETD A;  3HME A;  4UYH A;  4IR5 A;  2E3K A;  1WUG A;  4DON A;  5F36 A;  5C7N A;  4A9E A;  4Y03 A;  4XY9 A;  4XY8 A;  4A9I A;  2YEK A;  3Q2F A;  5EWW A;  3TLP A;  2L84 A;  4AKN A;  5HRV A;  2FSA A;  5DKC A;  5L97 A;  5F61 A;  5FE3 A;  3U5O A;  4Z6I A;  4QC1 A;  4CFK A;  4YAD A;  5IGN A;  5EI4 A;  4NR6 A;  3ZYU A;  5IGK A;  5G4S A;  4N4H A;  4QSP A;  3U5K A;  5EIS A;  5DYA A;  4A9M A;  4QNS A;  3SVH A;  4N4F A;  2G4A A;  5ETB A;  1ZS5 A;  5E74 A;  4YK0 A;  4HXR A;  3MXF A;  3NXB A;  5CZG A;  2YEL A;  5TCM A;  5HEN A;  5AMF A;  5EGU A;  5EU1 A;  4C67 A;  2F6J A;  4Q0N A;  4QSU A;  5DX4 A;  5FB1 A;  5TB6 A;  3Q2E A;  2D82 A;  5A5Q A;  5CUC A;  3O36 A;  4O7B A;  5I89 A;  1JM4 B;  3LQI A;  4MEO A;  5DW2 A;  5FFW A;  2L5E A;  4A9O A;  4QBM A;  4N4I A;  4CUP A;  5IGM A;  5I88 A;  5KTW A;  4YYH A;  4IR3 A;  3DWY A;  2NXB A;  5I83 A;  4NQN A;  4QSQ A;  4Z6H A;  4NYX A;  5FDZ A;  2YYN A;  4QSX A;  3P1E A;  5IBN A;  5HEL A;  3RCW A;  2OUO A;  5KO4 A;  5LUU A;  2OO1 A;  4BW1 A;  5HJC A;  2RS9 B;  4YAX A;  2H60 A;  5D7X A;  5DLX A;  5CRM A;  4UIW A;  5II1 A;  5I29 A;  4HXO A;  3G0L A;  4YYG A;  4HXS A;  4TU4 A;  3S92 A;  4LZR A;  5CQ6 A;  3U5M A;  5DYC A;  4NYV A;  5DFD A;  3O37 A;  1N72 A;  2E7O A;  4E96 A;  5CUE A;  2R0Y A;  4MR6 A;  5CQ3 A;  5F5Z A;  5EPB A;  4O7E A;  4NRA A;  5EA1 A;  5EWV A;  4MR5 A;  5EVA A;  5COI A;  4QSW A;  4NR8 A;  4BW2 A;  4HXK A;  5LJ0 A;  4C66 A;  4TZ8 A;  4ZC9 A;  5DLZ A;  5F62 A;  4O75 A;  4UIY A;  3LQH A;  5IID A;  4O74 A;  5D3L A;  4TZ2 A;  4YYN A;  5E9L A;  3SVF A;  5D25 A;  4CUR A;  2GRC A;  3MQM A;  4QR5 A;  4LYI A;  4QY4 A;  5ENG A;  4YYM A;  4HXN A;  4HXL A;  5CUD A;  5FE7 A;  5I1Q A;  4LZ2 A;  5CFW A;  5CP5 A;  4KV1 A;  5IG6 A;  4BW4 A;  2RO1 A;  4Z1Q A;  5FE6 A;  3SVG A;  4UIZ A;  5F3A A;  4QC3 A; 
#chains in the Genus database with same CATH topology
 3UW9 A;  5DYU A;  5FB0 A;  5L8T A;  3DAI A;  4QSS A;  4LDF A;  2F6N A;  5KTU A;  1ZKR A;  4AKG A;  4Q0O A;  4QEW A;  4TYL A;  5II2 A;  5D24 A;  4CUS A;  4CUT A;  5CQA A;  5K29 A;  2RI7 A;  4QR4 A;  5I86 A;  5F25 A;  5BT5 A;  4J0S A;  2LSP B;  3O33 A;  4XYA A;  5AME A;  4N4G A;  2R10 A;  5HFQ A;  3K2J A;  5FE8 A;  2RFJ A;  4UYE A;  5HM0 A;  5LKU A;  3VKG A;  4QB3 A;  4J3I A;  4O7A A;  2OSS A;  4QR3 A;  5LJ1 A;  4CL9 A;  4UYG A;  4YAT A;  4ALH A;  4CLB A;  5ENI A;  5CUB A;  5FE2 A;  3P1F A;  4YYK A;  3HMH A;  4HBY A;  2DWW A;  4YH3 A;  5CS8 A;  5ENE A;  2KTB B;  4XUA A;  2MJV B;  4CFL A;  4TTE A;  5L96 A;  5C85 A;  2YEM A;  5FBX A;  4A9F A;  4QYL A;  4LC2 A;  5E3G A;  5F63 A;  4MR4 A;  2YW5 A;  2RNW A;  3AQA A;  5FE4 A;  4PY6 A;  4YYJ A;  3FKM X;  5DKH A;  5CTL A;  5EV9 A;  3UVW A;  5BT4 A;  5LKT A;  3QZS A;  1X0J A;  4IR6 A;  2DVV A;  5F1L A;  5LKZ A;  5HRX A;  5FH8 A;  5C89 A;  3VKH A;  5ENF A;  4FLP A;  4A9K A;  3JVJ A;  4O7C A;  5EWC A;  3UV5 A;  4NUD A;  4MEQ A;  3MB4 A;  5HCL A;  5CUG A;  5FE9 A;  4QYD A;  3JVL A;  2I7K A;  4F3I A;  4A9L A;  5D0C A;  5FG4 A;  4UIT A;  2DKW A;  4N3W A;  4YBS A;  5F2P A;  3MB3 A;  4Z93 A;  4WHW A;  5A5P A;  5LKX A;  4LRG A;  4UIU A;  4O78 A;  5CQ5 A;  3UV4 A;  2R0V A;  4YAB A;  5E9V A;  2DVS A;  4LYS A;  5I40 A;  2RNY A;  3O34 A;  4YYD A;  5A5O A;  5EWD A;  3ONI A;  4MEP A;  1WUM A;  5C8G A;  3U5J A;  2E7N A;  3GG3 A;  4NR9 A;  5ENH A;  4OUF A;  5BT3 A;  5FFY A;  4J1P A;  5FG5 A;  5I80 A;  5IGL A;  5H85 A;  3JVM A;  4ALG A;  4YH4 A;  4X2I A;  5I7X A;  4IOQ A;  5FE0 A;  5E9I A;  3IU6 A;  5EP7 A;  4XUB A;  5CQ8 A;  3UV2 A;  4QST A;  4YBT A;  3LJW A;  3AAD A;  4NUC A;  5E3D A;  4KV4 A;  3S91 A;  4NR5 A;  4QEV A;  5DFC A;  5HQ6 A;  4QSV A;  4QZS A;  3U5P A;  3UVX A;  4NRC A;  1EQF A;  4BHW A;  3P5O A;  2WP2 A;  4O71 A;  3UVD A;  5C4Q A;  4HBW A;  5G4R A;  5EIC A;  5EWH A;  4IOO A;  2YDW A;  4HBV A;  2R0S A;  5EK9 A;  2N9G A;  4O70 A;  4PCI A;  3D1B A;  5EPS A;  4BJX A;  2WP1 A;  4LZS A;  5ENJ A;  3HMF A;  5A82 A;  5LVQ A;  4HXP A;  4O77 A;  5E7D A;  4A9N A;  5CQ7 A;  3MUL A;  4RVR A;  4PKL A;  5E73 A;  4PTB A;  5H1V A;  5HLS A;  2DAT A;  5KTX A;  5C87 A;  5AD2 A;  5H1U A;  4CUU A;  5CRZ A;  5F60 A;  1F68 A;  5L99 A;  5LVR A;  4PS5 A;  4BW3 A;  3P1D A;  4NYW A;  5FE5 A;  4NS5 A;  2D9E A;  2L85 A;  1JSP B;  5CUA A;  4TU6 A;  5CU8 A;  5HQ5 A;  5E0R A;  5E9K A;  5DY7 A;  4QSR A;  3IU5 A;  5L8U A;  5CQ4 A;  5D3N A;  5JWM A;  3LQJ A;  4TS8 A;  4AKH A;  5D3P A;  4YY4 A;  1E6I A;  4YC9 A;  5E9Y A;  5EM3 A;  5A85 A;  3D7C A;  5J0D A;  4OGJ A;  4A9J A;  5ENB A;  4UIX A;  5ACY A;  5A83 A;  5F1H A;  5EQ1 A;  5A5R A;  4QEU A;  4IR4 A;  4YYI A;  5D3T A;  4IOR A;  4NRB A;  5DYX A;  5CGP A;  5DW1 A;  4LYW A;  4HXM A;  4UYF A;  5LJ2 A;  4QUU A;  4UYF B;  5FG6 A;  5CY9 A;  3ERR A;  5D26 A;  2I8N A;  5HEM A;  5D3H A;  4HBX A;  5L98 A;  4O7F A;  4Z1S A;  5CPE A;  4NQM A;  5H1T A;  4OGI A;  4TT4 A;  2RNX A;  2YQD A;  5CQT A;  4ZQL A;  5E9M A;  4UYD A;  5D3R A;  5D3S A;  3JVK A;  4YY6 A;  4NUE A;  3UVY A;  3QZV A;  4ZW1 A;  5FH7 A;  3LXJ A;  5A5S A;  5FFV A;  3U5L A;  4MEN A;  4MR3 A;  4TT2 A;  4WIV A;  3G0J A;  5I7Y A;  5A7C A;  5KU3 A;  5A81 A;  4NXJ A;  4CUQ A;  5AD3 A;  3QZT A;  4A9H A;  4AI6 A;  4O76 A;  3I3J A;  4LR6 A;  4WHU A;  5KHM A;  4QUT A;  5ENC A;  5FE1 A;  5DKD A;  4TQN A;  5DFB A;  5D3J A;  4GPJ A;  5HFR A;  4TT6 A;  4UIV A;  3P1C A;  2DVQ A;  5DBM A;  2DVR A;  5JI8 A;  5EPR A;  4KCX A;  5FH6 A;  5A5N A;  3MUK A;  4PCE A;  4AKI A;  4NR7 A;  5HQ7 A;  4J0R A;  3U5N A;  4NR4 A;  4YBM A;  4O72 A;  3O35 A;  2EJN A;  5HRW A;  5ETD A;  3HME A;  4UYH A;  4IR5 A;  2E3K A;  1WUG A;  4DON A;  5F36 A;  5C7N A;  4A9E A;  4Y03 A;  4XY9 A;  4XY8 A;  4A9I A;  2YEK A;  3Q2F A;  5EWW A;  3TLP A;  2L84 A;  4AKN A;  5HRV A;  2FSA A;  5DKC A;  5L97 A;  5F61 A;  5FE3 A;  3U5O A;  4Z6I A;  4QC1 A;  4CFK A;  4YAD A;  5IGN A;  5EI4 A;  4NR6 A;  3ZYU A;  5IGK A;  5G4S A;  4N4H A;  4QSP A;  3U5K A;  5EIS A;  5DYA A;  4A9M A;  4QNS A;  3SVH A;  4N4F A;  2G4A A;  5ETB A;  1ZS5 A;  5E74 A;  4YK0 A;  4HXR A;  3MXF A;  3NXB A;  5CZG A;  2YEL A;  5TCM A;  5HEN A;  5AMF A;  5EGU A;  5EU1 A;  4C67 A;  2F6J A;  4Q0N A;  4QSU A;  5DX4 A;  5FB1 A;  5TB6 A;  3Q2E A;  2D82 A;  5A5Q A;  5CUC A;  3O36 A;  4O7B A;  5I89 A;  1JM4 B;  3LQI A;  4MEO A;  5DW2 A;  5FFW A;  2L5E A;  4A9O A;  4QBM A;  4N4I A;  4CUP A;  5IGM A;  5I88 A;  5KTW A;  4YYH A;  4IR3 A;  3DWY A;  2NXB A;  5I83 A;  4NQN A;  4QSQ A;  4Z6H A;  4NYX A;  5FDZ A;  2YYN A;  4QSX A;  3P1E A;  5IBN A;  5HEL A;  3RCW A;  2OUO A;  5KO4 A;  5LUU A;  2OO1 A;  4BW1 A;  5HJC A;  2RS9 B;  1PUO A;  4YAX A;  2H60 A;  5D7X A;  5DLX A;  5CRM A;  4UIW A;  5II1 A;  5I29 A;  4HXO A;  3G0L A;  4YYG A;  4HXS A;  3D1D A;  4TU4 A;  3S92 A;  4LZR A;  5CQ6 A;  3U5M A;  5DYC A;  4NYV A;  5DFD A;  3O37 A;  1N72 A;  2E7O A;  4E96 A;  5CUE A;  2R0Y A;  4MR6 A;  5CQ3 A;  5F5Z A;  5EPB A;  4O7E A;  4NRA A;  5EA1 A;  5EWV A;  4MR5 A;  5EVA A;  5COI A;  4QSW A;  4NR8 A;  4BW2 A;  4HXK A;  5LJ0 A;  4C66 A;  4TZ8 A;  4ZC9 A;  5DLZ A;  5F62 A;  4O75 A;  4UIY A;  3LQH A;  5IID A;  4O74 A;  5D3L A;  4TZ2 A;  4YYN A;  5E9L A;  3SVF A;  5D25 A;  4CUR A;  2GRC A;  3MQM A;  4QR5 A;  4LYI A;  4QY4 A;  5ENG A;  4YYM A;  4HXN A;  4HXL A;  5CUD A;  5FE7 A;  5I1Q A;  4LZ2 A;  5CFW A;  5CP5 A;  4KV1 A;  5IG6 A;  4BW4 A;  2RO1 A;  4Z1Q A;  5FE6 A;  3SVG A;  4UIZ A;  5F3A A;  4QC3 A; 
#chains in the Genus database with same CATH homology
 3UW9 A;  5DYU A;  5FB0 A;  5L8T A;  3DAI A;  4QSS A;  4LDF A;  2F6N A;  5KTU A;  4Q0O A;  4QEW A;  4TYL A;  5II2 A;  5D24 A;  4CUS A;  4CUT A;  5CQA A;  5K29 A;  2RI7 A;  4QR4 A;  5I86 A;  5F25 A;  5BT5 A;  4J0S A;  2LSP B;  3O33 A;  4XYA A;  5AME A;  4N4G A;  2R10 A;  5HFQ A;  3K2J A;  5FE8 A;  2RFJ A;  4UYE A;  5HM0 A;  5LKU A;  4QB3 A;  4J3I A;  4O7A A;  2OSS A;  4QR3 A;  5LJ1 A;  4CL9 A;  4UYG A;  4YAT A;  4ALH A;  4CLB A;  5ENI A;  5CUB A;  5FE2 A;  3P1F A;  4YYK A;  3HMH A;  4HBY A;  2DWW A;  4YH3 A;  5CS8 A;  5ENE A;  2KTB B;  4XUA A;  2MJV B;  4CFL A;  4TTE A;  5L96 A;  5C85 A;  2YEM A;  5FBX A;  4A9F A;  4QYL A;  4LC2 A;  5E3G A;  5F63 A;  4MR4 A;  2YW5 A;  2RNW A;  3AQA A;  5FE4 A;  4PY6 A;  4YYJ A;  3FKM X;  5DKH A;  5CTL A;  5EV9 A;  3UVW A;  5BT4 A;  5LKT A;  3QZS A;  1X0J A;  4IR6 A;  2DVV A;  5F1L A;  5LKZ A;  5HRX A;  5FH8 A;  5C89 A;  5ENF A;  4FLP A;  4A9K A;  3JVJ A;  4O7C A;  5EWC A;  3UV5 A;  4NUD A;  4MEQ A;  3MB4 A;  5HCL A;  5CUG A;  5FE9 A;  4QYD A;  3JVL A;  2I7K A;  4F3I A;  4A9L A;  5D0C A;  5FG4 A;  4UIT A;  2DKW A;  4N3W A;  4YBS A;  5F2P A;  3MB3 A;  4Z93 A;  4WHW A;  5A5P A;  5LKX A;  4LRG A;  4UIU A;  4O78 A;  5CQ5 A;  3UV4 A;  2R0V A;  4YAB A;  5E9V A;  2DVS A;  4LYS A;  5I40 A;  2RNY A;  3O34 A;  4YYD A;  5A5O A;  5EWD A;  3ONI A;  4MEP A;  1WUM A;  5C8G A;  3U5J A;  2E7N A;  3GG3 A;  4NR9 A;  5ENH A;  4OUF A;  5BT3 A;  5FFY A;  4J1P A;  5FG5 A;  5I80 A;  5IGL A;  5H85 A;  3JVM A;  4ALG A;  4YH4 A;  4X2I A;  5I7X A;  4IOQ A;  5FE0 A;  5E9I A;  3IU6 A;  5EP7 A;  4XUB A;  5CQ8 A;  3UV2 A;  4QST A;  4YBT A;  3LJW A;  3AAD A;  4NUC A;  5E3D A;  4KV4 A;  3S91 A;  4NR5 A;  4QEV A;  5DFC A;  5HQ6 A;  4QSV A;  4QZS A;  3U5P A;  3UVX A;  4NRC A;  1EQF A;  4BHW A;  3P5O A;  2WP2 A;  4O71 A;  3UVD A;  5C4Q A;  4HBW A;  5G4R A;  5EIC A;  5EWH A;  4IOO A;  2YDW A;  4HBV A;  2R0S A;  5EK9 A;  2N9G A;  4O70 A;  4PCI A;  5EPS A;  4BJX A;  2WP1 A;  4LZS A;  5ENJ A;  3HMF A;  5A82 A;  5LVQ A;  4HXP A;  4O77 A;  5E7D A;  4A9N A;  5CQ7 A;  3MUL A;  4RVR A;  4PKL A;  5E73 A;  4PTB A;  5H1V A;  5HLS A;  2DAT A;  5KTX A;  5C87 A;  5AD2 A;  5H1U A;  4CUU A;  5CRZ A;  5F60 A;  1F68 A;  5L99 A;  5LVR A;  4PS5 A;  4BW3 A;  3P1D A;  4NYW A;  5FE5 A;  4NS5 A;  2D9E A;  2L85 A;  1JSP B;  5CUA A;  4TU6 A;  5CU8 A;  5HQ5 A;  5E0R A;  5E9K A;  5DY7 A;  4QSR A;  3IU5 A;  5L8U A;  5CQ4 A;  5D3N A;  5JWM A;  3LQJ A;  4TS8 A;  5D3P A;  4YY4 A;  1E6I A;  4YC9 A;  5E9Y A;  5EM3 A;  5A85 A;  3D7C A;  5J0D A;  4OGJ A;  4A9J A;  5ENB A;  4UIX A;  5ACY A;  5A83 A;  5F1H A;  5EQ1 A;  5A5R A;  4QEU A;  4IR4 A;  4YYI A;  5D3T A;  4IOR A;  4NRB A;  5DYX A;  5CGP A;  5DW1 A;  4LYW A;  4HXM A;  4UYF A;  5LJ2 A;  4QUU A;  4UYF B;  5FG6 A;  5CY9 A;  5D26 A;  2I8N A;  5HEM A;  5D3H A;  4HBX A;  5L98 A;  4O7F A;  4Z1S A;  5CPE A;  4NQM A;  5H1T A;  4OGI A;  4TT4 A;  2RNX A;  2YQD A;  5CQT A;  4ZQL A;  5E9M A;  4UYD A;  5D3R A;  5D3S A;  3JVK A;  4YY6 A;  4NUE A;  3UVY A;  3QZV A;  4ZW1 A;  5FH7 A;  3LXJ A;  5A5S A;  5FFV A;  3U5L A;  4MEN A;  4MR3 A;  4TT2 A;  4WIV A;  3G0J A;  5I7Y A;  5A7C A;  5KU3 A;  5A81 A;  4NXJ A;  4CUQ A;  5AD3 A;  3QZT A;  4A9H A;  4O76 A;  3I3J A;  4LR6 A;  4WHU A;  5KHM A;  4QUT A;  5ENC A;  5FE1 A;  5DKD A;  4TQN A;  5DFB A;  5D3J A;  4GPJ A;  5HFR A;  4TT6 A;  4UIV A;  3P1C A;  2DVQ A;  5DBM A;  2DVR A;  5JI8 A;  5EPR A;  4KCX A;  5FH6 A;  5A5N A;  3MUK A;  4PCE A;  4NR7 A;  5HQ7 A;  4J0R A;  3U5N A;  4NR4 A;  4YBM A;  4O72 A;  3O35 A;  5HRW A;  5ETD A;  3HME A;  4UYH A;  4IR5 A;  2E3K A;  1WUG A;  4DON A;  5F36 A;  5C7N A;  4A9E A;  4Y03 A;  4XY9 A;  4XY8 A;  4A9I A;  2YEK A;  3Q2F A;  5EWW A;  3TLP A;  2L84 A;  4AKN A;  5HRV A;  2FSA A;  5DKC A;  5L97 A;  5F61 A;  5FE3 A;  3U5O A;  4Z6I A;  4QC1 A;  4CFK A;  4YAD A;  5IGN A;  5EI4 A;  4NR6 A;  3ZYU A;  5IGK A;  5G4S A;  4N4H A;  4QSP A;  3U5K A;  5EIS A;  5DYA A;  4A9M A;  4QNS A;  3SVH A;  4N4F A;  2G4A A;  5ETB A;  1ZS5 A;  5E74 A;  4YK0 A;  4HXR A;  3MXF A;  3NXB A;  5CZG A;  2YEL A;  5TCM A;  5HEN A;  5AMF A;  5EGU A;  5EU1 A;  4C67 A;  2F6J A;  4Q0N A;  4QSU A;  5DX4 A;  5FB1 A;  5TB6 A;  3Q2E A;  2D82 A;  5A5Q A;  5CUC A;  3O36 A;  4O7B A;  5I89 A;  1JM4 B;  3LQI A;  4MEO A;  5DW2 A;  5FFW A;  2L5E A;  4A9O A;  4QBM A;  4N4I A;  4CUP A;  5IGM A;  5I88 A;  5KTW A;  4YYH A;  4IR3 A;  3DWY A;  2NXB A;  5I83 A;  4NQN A;  4QSQ A;  4Z6H A;  4NYX A;  5FDZ A;  2YYN A;  4QSX A;  3P1E A;  5IBN A;  5HEL A;  3RCW A;  2OUO A;  5KO4 A;  5LUU A;  2OO1 A;  4BW1 A;  5HJC A;  2RS9 B;  4YAX A;  2H60 A;  5D7X A;  5DLX A;  5CRM A;  4UIW A;  5II1 A;  5I29 A;  4HXO A;  3G0L A;  4YYG A;  4HXS A;  4TU4 A;  3S92 A;  4LZR A;  5CQ6 A;  3U5M A;  5DYC A;  4NYV A;  5DFD A;  3O37 A;  1N72 A;  2E7O A;  4E96 A;  5CUE A;  2R0Y A;  4MR6 A;  5CQ3 A;  5F5Z A;  5EPB A;  4O7E A;  4NRA A;  5EA1 A;  5EWV A;  4MR5 A;  5EVA A;  5COI A;  4QSW A;  4NR8 A;  4BW2 A;  4HXK A;  5LJ0 A;  4C66 A;  4TZ8 A;  4ZC9 A;  5DLZ A;  5F62 A;  4O75 A;  4UIY A;  3LQH A;  5IID A;  4O74 A;  5D3L A;  4TZ2 A;  4YYN A;  5E9L A;  3SVF A;  5D25 A;  4CUR A;  2GRC A;  3MQM A;  4QR5 A;  4LYI A;  4QY4 A;  5ENG A;  4YYM A;  4HXN A;  4HXL A;  5CUD A;  5FE7 A;  5I1Q A;  4LZ2 A;  5CFW A;  5CP5 A;  4KV1 A;  5IG6 A;  4BW4 A;  2RO1 A;  4Z1Q A;  5FE6 A;  3SVG A;  4UIZ A;  5F3A A;  4QC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...