5C87A

Crystal structure of the human brpf1 bromodomain in complex with seed2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c87A00
4TTEA 3Q2FA 5EWCA 4N4HA 5EGUA 4HBXA 4XYAA 4J0RA 5DY7A 5ENBA 4BW2A 3K2JA 5C87A 4NUEA 4N4GA 3HMEA 4O7BA 4QEUA 4UIYA 5CZGA 5ENCA 5E3GA 5F36A 3QZSA 2RNYA 3DWYA 3ZYUA 2RS9B 4F3IA 2DWWA 5I29A 3O35A 3O36A 5AD2A 4ZW1A 4UIUA 4NUCA 5E9KA 4QYDA 2FSAA 4CUTA 5CQAA 4O7AA 1EQFA 4O78A 4QR5A 4NXJA 4TT2A 5CUDA 5L8UA 4PKLA 4QB3A 5DKDA 3G0JA 5D3JA 4FLPA 4IR6A 3FKMX 4YC9A 5FB1A 4CUPA 5D3PA 5C7NA 5F1HA 4AKNA 5H1VA 3UW9A 4HBWA 5LVRA 5EISA 5D3SA 5FFVA 5LJ2A 4XY8A 4QEVA 2E3KA 4QEWA 5D3TA 5CRMA 5DFBA 5CQ4A 4QSSA 5CUAA 4LYIA 2RO1A 4O71A 4PCEA 4XUAA 4CLBA 5FDZA 5EPRA 3G0LA 3UVWA 4A9LA 4HXLA 3P1CA 2YQDA 4O75A 5IGLA 5ENFA 1E6IA 4MENA 4TQNA 5FBXA 5HQ5A 5FE4A 5JI8A 5I7XA 2DVSA 5D25A 5HFQA 5E9YA 5K29A 3SVFA 4LR6A 4QSRA 5CUCA 4CFKA 3I3JA 4NQMA 3U5MA 2D9EA 2H60A 5F62A 5HRXA 5FE9A 4ZQLA 4A9FA 5FE2A 2YEKA 5F1LA 5DW1A 2L5EA 2RNWA 4LRGA 5ENIA 5D3HA 5LKUA 5FH6A 3U5LA 5CPEA 4C67A 4NYXA 5F63A 2E7NA 4QC3A 4QUUA 3U5OA 3P1EA 4QSPA 5I88A 4LZRA 4YYMA 4UYFA 5FE3A 4BJXA 2DKWA 5FE1A 4UYGA 4YYDA 5H85A 5HENA 4Z6HA 5HM0A 3O37A 3HMHA 5A81A 4TU4A 4J0SA 2YYNA 3ONIA 1X0JA 4Q0OA 4HXKA 5C89A 4YYNA 5KTWA 2OO1A 5EM3A 5F3AA 2I8NA 5A5PA 5A85A 3MB4A 4MEOA 4YYGA 3SVGA 4Z1SA 4O7CA 5E3DA 5F61A 5J0DA 4X2IA 5DKHA 5II2A 3LXJA 2NXBA 4QR4A 5FFYA 5IG6A 4A9MA 4N3WA 5FG6A 5L97A 2YEMA 4O77A 3P1DA 5C4QA 5H1TA 4ZC9A 5CGPA 5ETBA 4OUFA 4TZ2A 4CURA 5EWWA 4TYLA 3U5JA 4NR5A 4TS8A 3U5PA 4Q0NA 3UV2A 4NR9A 4YBSA 4A9KA 2MJVB 5L96A 4QZSA 4Z93A 4WHUA 5CTLA 4NR6A 5FE7A 2D82A 4XUBA 4UYDA 5ENHA 5ETDA 4UIXA 5A7CA 5JWMA 5I86A 2L85A 4LZSA 4QSUA 4QNSA 5G4RA 3O34A 3HMFA 4YYKA 4OGJA 5AMFA 5DBMA 4HBYA 5A5OA 4RVRA 4UYHA 5CQ3A 4IR3A 5D7XA 5HEMA 3DAIA 2LSPB 5CU8A 4NRBA 5TCMA 5EA1A 5D3LA 3QZTA 4PS5A 3MULA 2L84A 5I40A 3S92A 4MR6A 4A9JA 4QY4A 4QBMA 4TZ8A 5CY9A 1F68A 2DVQA 5FE5A 3AADA 5A5QA 4UYEA 3IU5A 4YBTA 5FG4A 5DYCA 3MB3A 4HXSA 5E9VA 5FH8A 4UIZA 3NXBA 4UITA 5IGMA 5EPBA 2RFJA 4KV4A 4YK0A 5E9MA 4QSQA 2R10A 2GRCA 4UIWA 4Z6IA 4HXPA 5COIA 4UYFB 2I7KA 4QSXA 4YAXA 5DYXA 5EWHA 4IOQA 1JM4B 5CP5A 5A5SA 5KO4A 5E74A 5F25A 4MEPA 5II1A 4CUQA 3JVJA 5DLZA 3IU6A 2RNXA 4WIVA 5EWDA 5HELA 4QSWA 3S91A 4NS5A 4NR4A 5KU3A 3UV5A 4O72A 5A83A 3P1FA 4O7FA 4A9EA 2OUOA 4PY6A 5D0CA 4J1PA 2WP2A 5BT4A 5FE0A 5IIDA 5ENEA 5HJCA 4O76A 5E7DA 4IR5A 1JSPB 4NRCA 5DFCA 4YYJA 5LKXA 4NYVA 5FB0A 2YW5A 2R0YA 3UV4A 3UVXA 4ALHA 5E73A 5HRVA 5I1QA 5CFWA 5A5RA 5A82A 4LC2A 1N72A 2DVRA 2R0VA 4IR4A 5L98A 4QR3A 2DATA 4ALGA 5LKZA 4Z1QA 2DVVA 5A5NA 5CQ5A 3D7CA 5CQ8A 4LYSA 5LKTA 4TU6A 5FE8A 4CL9A 4MR4A 5DYAA 3TLPA 4PCIA 2YELA 5ENGA 5CQTA 2N9GA 1ZS5A 5FH7A 5EWVA 5F2PA 5AMEA 4YYIA 5DLXA 5EPSA 5E9LA 4BHWA 5LVQA 4NQNA 5D26A 4CUSA 5EI4A 5LJ0A 3MXFA 4TT6A 4TT4A 1WUGA 4YH4A 5D3RA 4HXMA 4N4FA 4LYWA 3UVYA 4A9IA 4NR8A 4E96A 3Q2EA 4O70A 3LQIA 5DX4A 3RCWA 3MUKA 3JVKA 4J3IA 4KV1A 4LDFA 2R0SA 4IOOA 4YY4A 4YABA 5EU1A 4Y03A 5HCLA 4HBVA 1WUMA 2KTBB 3LQJA 5FE6A 4QUTA 5HLSA 5DW2A 4HXOA 4OGIA 4KCXA 3O33A 2F6JA 5CRZA 4WHWA 5G4SA 5EV9A 5F5ZA 5EK9A 5LUUA 4A9OA 5I80A 4CUUA 5CS8A 5ACYA 4O7EA 5C85A 3UVDA 4MR5A 5I89A 5E0RA 3P5OA 5BT3A 4IORA 5AD3A 4BW3A 3JVMA 5TB6A 4NYWA 4YADA 5DFDA 4HXNA 4QC1A 4QSTA 4A9HA 5CUBA 3U5NA 5D3NA 5DYUA 4MR3A 4C66A 5HFRA 4N4IA 4NR7A 5HQ7A 5L99A 5E9IA 5CQ7A 5EICA 4YATA 5C8GA 2YDWA 5H1UA 4QYLA 4QSVA 5CUEA 5LJ1A 5IGNA 4UIVA 3SVHA 2WP1A 3LJWA 5BT5A 2G4AA 5IBNA 4YY6A 4YH3A 5D24A 5I7YA 3JVLA 4PTBA 4BW1A 3GG3A 4LZ2A 3AQAA 2F6NA 2E7OA 5EP7A 4A9NA 3QZVA 4XY9A 5KTUA 4NRAA 5FG5A 5EQ1A 5EVAA 5HQ6A 4O74A 5DKCA 4BW4A 2RI7A 3U5KA 4YYHA 3MQMA 4CFLA 5HRWA 3LQHA 4MEQA 5FFWA 5CQ6A 4GPJA 4NUDA 4HXRA 5CUGA 5ENJA 5F60A 5KHMA 4DONA 5I83A 5KTXA 5IGKA 5L8TA 2OSSA 4YBMA
chains in the Genus database with same CATH superfamily
4TTEA 3Q2FA 5EWCA 4N4HA 5EGUA 4HBXA 4XYAA 4J0RA 5DY7A 5ENBA 4BW2A 3K2JA 5C87A 4NUEA 4N4GA 3HMEA 4O7BA 4QEUA 4UIYA 5CZGA 5ENCA 5E3GA 5F36A 3QZSA 2RNYA 3DWYA 3ZYUA 2RS9B 4F3IA 2DWWA 5I29A 3O35A 3O36A 5AD2A 4ZW1A 4UIUA 4NUCA 5E9KA 4QYDA 2FSAA 4CUTA 5CQAA 4O7AA 1EQFA 4O78A 4QR5A 4NXJA 4TT2A 5CUDA 5L8UA 4PKLA 4QB3A 5DKDA 3G0JA 5D3JA 4FLPA 4IR6A 3FKMX 4YC9A 5FB1A 4CUPA 5D3PA 5C7NA 5F1HA 4AKNA 5H1VA 3UW9A 4HBWA 5LVRA 5EISA 5D3SA 5FFVA 5LJ2A 4XY8A 4QEVA 2E3KA 4QEWA 5D3TA 5CRMA 5DFBA 5CQ4A 4QSSA 5CUAA 4LYIA 2RO1A 4O71A 4PCEA 4XUAA 4CLBA 5FDZA 5EPRA 3G0LA 3UVWA 4A9LA 4HXLA 3P1CA 2YQDA 4O75A 5IGLA 5ENFA 1E6IA 4MENA 4TQNA 5FBXA 5HQ5A 5FE4A 5JI8A 5I7XA 2DVSA 5D25A 5HFQA 5E9YA 5K29A 3SVFA 4LR6A 4QSRA 5CUCA 4CFKA 3I3JA 4NQMA 3U5MA 2D9EA 2H60A 5F62A 5HRXA 5FE9A 4ZQLA 4A9FA 5FE2A 2YEKA 5F1LA 5DW1A 2L5EA 2RNWA 4LRGA 5ENIA 5D3HA 5LKUA 5FH6A 3U5LA 5CPEA 4C67A 4NYXA 5F63A 2E7NA 4QC3A 4QUUA 3U5OA 3P1EA 4QSPA 5I88A 4LZRA 4YYMA 4UYFA 5FE3A 4BJXA 2DKWA 5FE1A 4UYGA 4YYDA 5H85A 5HENA 4Z6HA 5HM0A 3O37A 3HMHA 5A81A 4TU4A 4J0SA 2YYNA 3ONIA 1X0JA 4Q0OA 4HXKA 5C89A 4YYNA 5KTWA 2OO1A 5EM3A 5F3AA 2I8NA 5A5PA 5A85A 3MB4A 4MEOA 4YYGA 3SVGA 4Z1SA 4O7CA 5E3DA 5F61A 5J0DA 4X2IA 5DKHA 5II2A 3LXJA 2NXBA 4QR4A 5FFYA 5IG6A 4A9MA 4N3WA 5FG6A 5L97A 2YEMA 4O77A 3P1DA 5C4QA 5H1TA 4ZC9A 5CGPA 5ETBA 4OUFA 4TZ2A 4CURA 5EWWA 4TYLA 3U5JA 4NR5A 4TS8A 3U5PA 4Q0NA 3UV2A 4NR9A 4YBSA 3VKGA 4A9KA 2MJVB 5L96A 4QZSA 4Z93A 4WHUA 5CTLA 4NR6A 5FE7A 2D82A 4XUBA 4UYDA 5ENHA 5ETDA 4AI6A 4UIXA 5A7CA 5JWMA 5I86A 2L85A 4LZSA 4QSUA 4QNSA 5G4RA 3O34A 3HMFA 4YYKA 4OGJA 5AMFA 5DBMA 4HBYA 5A5OA 4RVRA 4UYHA 5CQ3A 4IR3A 1PUOA 5D7XA 5HEMA 3DAIA 2LSPB 5CU8A 4NRBA 5TCMA 5EA1A 5D3LA 3QZTA 4PS5A 3MULA 2L84A 5I40A 3S92A 4MR6A 4A9JA 4QY4A 4QBMA 4TZ8A 5CY9A 1F68A 4AKHA 2DVQA 5FE5A 3AADA 5A5QA 4UYEA 3IU5A 4YBTA 5FG4A 5DYCA 3D1DA 3MB3A 4HXSA 5E9VA 5FH8A 4UIZA 3NXBA 4UITA 5IGMA 1ZKRA 5EPBA 2RFJA 4KV4A 4YK0A 5E9MA 4QSQA 2R10A 2GRCA 4UIWA 4Z6IA 4HXPA 5COIA 4UYFB 2I7KA 4QSXA 4YAXA 5DYXA 5EWHA 4IOQA 1JM4B 5CP5A 5A5SA 5KO4A 5E74A 5F25A 4AKIA 4MEPA 5II1A 4CUQA 3JVJA 5DLZA 3IU6A 2RNXA 4WIVA 5EWDA 5HELA 4QSWA 2EJNA 3S91A 4NS5A 4NR4A 5KU3A 3UV5A 4O72A 5A83A 3P1FA 4O7FA 4A9EA 2OUOA 4PY6A 5D0CA 4J1PA 2WP2A 5BT4A 5FE0A 5IIDA 5ENEA 5HJCA 4O76A 5E7DA 4IR5A 1JSPB 4NRCA 5DFCA 4YYJA 5LKXA 4NYVA 5FB0A 2YW5A 2R0YA 3UV4A 3UVXA 4ALHA 5E73A 5HRVA 5I1QA 5CFWA 5A5RA 5A82A 4LC2A 1N72A 2DVRA 2R0VA 4IR4A 5L98A 4QR3A 2DATA 4ALGA 5LKZA 4Z1QA 2DVVA 5A5NA 5CQ5A 3D7CA 5CQ8A 4LYSA 5LKTA 4TU6A 5FE8A 4CL9A 4MR4A 3ERRA 5DYAA 4PCIA 3TLPA 2YELA 5ENGA 5CQTA 2N9GA 1ZS5A 5FH7A 5EWVA 5F2PA 5AMEA 4YYIA 5DLXA 5EPSA 5E9LA 4BHWA 5LVQA 4NQNA 5D26A 4CUSA 5EI4A 3VKHA 5LJ0A 3MXFA 4TT6A 4TT4A 1WUGA 4YH4A 4AKGA 5D3RA 4HXMA 4N4FA 4LYWA 3UVYA 4A9IA 4NR8A 4E96A 3Q2EA 4O70A 3LQIA 5DX4A 3RCWA 3MUKA 3JVKA 4J3IA 4KV1A 4LDFA 2R0SA 4IOOA 4YY4A 4YABA 5EU1A 4Y03A 5HCLA 4HBVA 1WUMA 2KTBB 3LQJA 5FE6A 4QUTA 5HLSA 5DW2A 4HXOA 4OGIA 4KCXA 3O33A 2F6JA 5CRZA 4WHWA 5G4SA 5EV9A 5F5ZA 5EK9A 5LUUA 4A9OA 5I80A 4CUUA 5CS8A 5ACYA 4O7EA 5C85A 3UVDA 4MR5A 5I89A 5E0RA 3P5OA 5BT3A 4IORA 5AD3A 4BW3A 3JVMA 5TB6A 3D1BA 4NYWA 4YADA 5DFDA 4HXNA 4QC1A 4QSTA 4A9HA 5CUBA 3U5NA 5D3NA 5DYUA 4MR3A 4C66A 5HFRA 4N4IA 4NR7A 5HQ7A 5L99A 5E9IA 5CQ7A 5EICA 4YATA 5C8GA 2YDWA 5H1UA 4QYLA 4QSVA 5CUEA 5LJ1A 5IGNA 4UIVA 3SVHA 2WP1A 3LJWA 5BT5A 2G4AA 5IBNA 4YY6A 4YH3A 5D24A 5I7YA 3JVLA 4PTBA 4BW1A 3GG3A 4LZ2A 3AQAA 2F6NA 2E7OA 5EP7A 4A9NA 3QZVA 4XY9A 5KTUA 4NRAA 5FG5A 5EQ1A 5EVAA 5HQ6A 4O74A 5DKCA 4BW4A 2RI7A 3U5KA 4YYHA 3MQMA 4CFLA 5HRWA 3LQHA 4MEQA 5FFWA 5CQ6A 4GPJA 4NUDA 4HXRA 5CUGA 5ENJA 5F60A 5KHMA 4DONA 5I83A 5KTXA 5IGKA 5L8TA 2OSSA 4YBMA
chains in the Genus database with same CATH topology
4TTEA 3Q2FA 5EWCA 4N4HA 5EGUA 4HBXA 4XYAA 4J0RA 5DY7A 5ENBA 4BW2A 3K2JA 5C87A 4NUEA 4N4GA 3HMEA 4O7BA 4QEUA 4UIYA 5CZGA 5ENCA 5E3GA 5F36A 3QZSA 2RNYA 3DWYA 3ZYUA 2RS9B 4F3IA 2DWWA 5I29A 3O35A 3O36A 5AD2A 4ZW1A 4UIUA 4NUCA 5E9KA 4QYDA 2FSAA 4CUTA 5CQAA 4O7AA 1EQFA 4O78A 4QR5A 4NXJA 4TT2A 5CUDA 5L8UA 4PKLA 4QB3A 5DKDA 3G0JA 5D3JA 4FLPA 4IR6A 3FKMX 4YC9A 5FB1A 4CUPA 5D3PA 5C7NA 5F1HA 4AKNA 5H1VA 3UW9A 4HBWA 5LVRA 5EISA 5D3SA 5FFVA 5LJ2A 4XY8A 4QEVA 2E3KA 4QEWA 5D3TA 5CRMA 5DFBA 5CQ4A 4QSSA 5CUAA 4LYIA 2RO1A 4O71A 4PCEA 4XUAA 4CLBA 5FDZA 5EPRA 3G0LA 3UVWA 4A9LA 4HXLA 3P1CA 2YQDA 4O75A 5IGLA 5ENFA 1E6IA 4MENA 4TQNA 5FBXA 5HQ5A 5FE4A 5JI8A 5I7XA 2DVSA 5D25A 5HFQA 5E9YA 5K29A 3SVFA 4LR6A 4QSRA 5CUCA 4CFKA 3I3JA 4NQMA 3U5MA 2D9EA 2H60A 5F62A 5HRXA 5FE9A 4ZQLA 4A9FA 5FE2A 2YEKA 5F1LA 5DW1A 2L5EA 2RNWA 4LRGA 5ENIA 5D3HA 5LKUA 5FH6A 3U5LA 5CPEA 4C67A 4NYXA 5F63A 2E7NA 4QC3A 4QUUA 3U5OA 3P1EA 4QSPA 5I88A 4LZRA 4YYMA 4UYFA 5FE3A 4BJXA 2DKWA 5FE1A 4UYGA 4YYDA 5H85A 5HENA 4Z6HA 5HM0A 3O37A 3HMHA 5A81A 4TU4A 4J0SA 2YYNA 3ONIA 1X0JA 4Q0OA 4HXKA 5C89A 4YYNA 5KTWA 2OO1A 5EM3A 5F3AA 2I8NA 5A5PA 5A85A 3MB4A 4MEOA 4YYGA 3SVGA 4Z1SA 4O7CA 5E3DA 5F61A 5J0DA 4X2IA 5DKHA 5II2A 3LXJA 2NXBA 4QR4A 5FFYA 5IG6A 4A9MA 4N3WA 5FG6A 5L97A 2YEMA 4O77A 3P1DA 5C4QA 5H1TA 4ZC9A 5CGPA 5ETBA 4OUFA 4TZ2A 4CURA 5EWWA 4TYLA 3U5JA 4NR5A 4TS8A 3U5PA 4Q0NA 3UV2A 4NR9A 4YBSA 4A9KA 2MJVB 5L96A 4QZSA 4Z93A 4WHUA 5CTLA 4NR6A 5FE7A 2D82A 4XUBA 4UYDA 5ENHA 5ETDA 4UIXA 5A7CA 5JWMA 5I86A 2L85A 4LZSA 4QSUA 4QNSA 5G4RA 3O34A 3HMFA 4YYKA 4OGJA 5AMFA 5DBMA 4HBYA 5A5OA 4RVRA 4UYHA 5CQ3A 4IR3A 5D7XA 5HEMA 3DAIA 2LSPB 5CU8A 4NRBA 5TCMA 5EA1A 5D3LA 3QZTA 4PS5A 3MULA 2L84A 5I40A 3S92A 4MR6A 4A9JA 4QY4A 4QBMA 4TZ8A 5CY9A 1F68A 2DVQA 5FE5A 3AADA 5A5QA 4UYEA 3IU5A 4YBTA 5FG4A 5DYCA 3MB3A 4HXSA 5E9VA 5FH8A 4UIZA 3NXBA 4UITA 5IGMA 5EPBA 2RFJA 4KV4A 4YK0A 5E9MA 4QSQA 2R10A 2GRCA 4UIWA 4Z6IA 4HXPA 5COIA 4UYFB 2I7KA 4QSXA 4YAXA 5DYXA 5EWHA 4IOQA 1JM4B 5CP5A 5A5SA 5KO4A 5E74A 5F25A 4MEPA 5II1A 4CUQA 3JVJA 5DLZA 3IU6A 2RNXA 4WIVA 5EWDA 5HELA 4QSWA 3S91A 4NS5A 4NR4A 5KU3A 3UV5A 4O72A 5A83A 3P1FA 4O7FA 4A9EA 2OUOA 4PY6A 5D0CA 4J1PA 2WP2A 5BT4A 5FE0A 5IIDA 5ENEA 5HJCA 4O76A 5E7DA 4IR5A 1JSPB 4NRCA 5DFCA 4YYJA 5LKXA 4NYVA 5FB0A 2YW5A 2R0YA 3UV4A 3UVXA 4ALHA 5E73A 5HRVA 5I1QA 5CFWA 5A5RA 5A82A 4LC2A 1N72A 2DVRA 2R0VA 4IR4A 5L98A 4QR3A 2DATA 4ALGA 5LKZA 4Z1QA 2DVVA 5A5NA 5CQ5A 3D7CA 5CQ8A 4LYSA 5LKTA 4TU6A 5FE8A 4CL9A 4MR4A 5DYAA 3TLPA 4PCIA 2YELA 5ENGA 5CQTA 2N9GA 1ZS5A 5FH7A 5EWVA 5F2PA 5AMEA 4YYIA 5DLXA 5EPSA 5E9LA 4BHWA 5LVQA 4NQNA 5D26A 4CUSA 5EI4A 5LJ0A 3MXFA 4TT6A 4TT4A 1WUGA 4YH4A 5D3RA 4HXMA 4N4FA 4LYWA 3UVYA 4A9IA 4NR8A 4E96A 3Q2EA 4O70A 3LQIA 5DX4A 3RCWA 3MUKA 3JVKA 4J3IA 4KV1A 4LDFA 2R0SA 4IOOA 4YY4A 4YABA 5EU1A 4Y03A 5HCLA 4HBVA 1WUMA 2KTBB 3LQJA 5FE6A 4QUTA 5HLSA 5DW2A 4HXOA 4OGIA 4KCXA 3O33A 2F6JA 5CRZA 4WHWA 5G4SA 5EV9A 5F5ZA 5EK9A 5LUUA 4A9OA 5I80A 4CUUA 5CS8A 5ACYA 4O7EA 5C85A 3UVDA 4MR5A 5I89A 5E0RA 3P5OA 5BT3A 4IORA 5AD3A 4BW3A 3JVMA 5TB6A 4NYWA 4YADA 5DFDA 4HXNA 4QC1A 4QSTA 4A9HA 5CUBA 3U5NA 5D3NA 5DYUA 4MR3A 4C66A 5HFRA 4N4IA 4NR7A 5HQ7A 5L99A 5E9IA 5CQ7A 5EICA 4YATA 5C8GA 2YDWA 5H1UA 4QYLA 4QSVA 5CUEA 5LJ1A 5IGNA 4UIVA 3SVHA 2WP1A 3LJWA 5BT5A 2G4AA 5IBNA 4YY6A 4YH3A 5D24A 5I7YA 3JVLA 4PTBA 4BW1A 3GG3A 4LZ2A 3AQAA 2F6NA 2E7OA 5EP7A 4A9NA 3QZVA 4XY9A 5KTUA 4NRAA 5FG5A 5EQ1A 5EVAA 5HQ6A 4O74A 5DKCA 4BW4A 2RI7A 3U5KA 4YYHA 3MQMA 4CFLA 5HRWA 3LQHA 4MEQA 5FFWA 5CQ6A 4GPJA 4NUDA 4HXRA 5CUGA 5ENJA 5F60A 5KHMA 4DONA 5I83A 5KTXA 5IGKA 5L8TA 2OSSA 4YBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TTE A;  3Q2F A;  5EWC A;  4N4H A;  5EGU A;  4HBX A;  4XYA A;  4J0R A;  5DY7 A;  5ENB A;  4BW2 A;  3K2J A;  5C87 A;  4NUE A;  4N4G A;  3HME A;  4O7B A;  4QEU A;  4UIY A;  5CZG A;  5ENC A;  5E3G A;  5F36 A;  3QZS A;  2RNY A;  3DWY A;  3ZYU A;  2RS9 B;  4F3I A;  2DWW A;  5I29 A;  3O35 A;  3O36 A;  5AD2 A;  4ZW1 A;  4UIU A;  4NUC A;  5E9K A;  4QYD A;  2FSA A;  4CUT A;  5CQA A;  4O7A A;  1EQF A;  4O78 A;  4QR5 A;  4NXJ A;  4TT2 A;  5CUD A;  5L8U A;  4PKL A;  4QB3 A;  5DKD A;  3G0J A;  5D3J A;  4FLP A;  4IR6 A;  3FKM X;  4YC9 A;  5FB1 A;  4CUP A;  5D3P A;  5C7N A;  5F1H A;  4AKN A;  5H1V A;  3UW9 A;  4HBW A;  5LVR A;  5EIS A;  5D3S A;  5FFV A;  5LJ2 A;  4XY8 A;  4QEV A;  2E3K A;  4QEW A;  5D3T A;  5CRM A;  5DFB A;  5CQ4 A;  4QSS A;  5CUA A;  4LYI A;  2RO1 A;  4O71 A;  4PCE A;  4XUA A;  4CLB A;  5FDZ A;  5EPR A;  3G0L A;  3UVW A;  4A9L A;  4HXL A;  3P1C A;  2YQD A;  4O75 A;  5IGL A;  5ENF A;  1E6I A;  4MEN A;  4TQN A;  5FBX A;  5HQ5 A;  5FE4 A;  5JI8 A;  5I7X A;  2DVS A;  5D25 A;  5HFQ A;  5E9Y A;  5K29 A;  3SVF A;  4LR6 A;  4QSR A;  5CUC A;  4CFK A;  3I3J A;  4NQM A;  3U5M A;  2D9E A;  2H60 A;  5F62 A;  5HRX A;  5FE9 A;  4ZQL A;  4A9F A;  5FE2 A;  2YEK A;  5F1L A;  5DW1 A;  2L5E A;  2RNW A;  4LRG A;  5ENI A;  5D3H A;  5LKU A;  5FH6 A;  3U5L A;  5CPE A;  4C67 A;  4NYX A;  5F63 A;  2E7N A;  4QC3 A;  4QUU A;  3U5O A;  3P1E A;  4QSP A;  5I88 A;  4LZR A;  4YYM A;  4UYF A;  5FE3 A;  4BJX A;  2DKW A;  5FE1 A;  4UYG A;  4YYD A;  5H85 A;  5HEN A;  4Z6H A;  5HM0 A;  3O37 A;  3HMH A;  5A81 A;  4TU4 A;  4J0S A;  2YYN A;  3ONI A;  1X0J A;  4Q0O A;  4HXK A;  5C89 A;  4YYN A;  5KTW A;  2OO1 A;  5EM3 A;  5F3A A;  2I8N A;  5A5P A;  5A85 A;  3MB4 A;  4MEO A;  4YYG A;  3SVG A;  4Z1S A;  4O7C A;  5E3D A;  5F61 A;  5J0D A;  4X2I A;  5DKH A;  5II2 A;  3LXJ A;  2NXB A;  4QR4 A;  5FFY A;  5IG6 A;  4A9M A;  4N3W A;  5FG6 A;  5L97 A;  2YEM A;  4O77 A;  3P1D A;  5C4Q A;  5H1T A;  4ZC9 A;  5CGP A;  5ETB A;  4OUF A;  4TZ2 A;  4CUR A;  5EWW A;  4TYL A;  3U5J A;  4NR5 A;  4TS8 A;  3U5P A;  4Q0N A;  3UV2 A;  4NR9 A;  4YBS A;  4A9K A;  2MJV B;  5L96 A;  4QZS A;  4Z93 A;  4WHU A;  5CTL A;  4NR6 A;  5FE7 A;  2D82 A;  4XUB A;  4UYD A;  5ENH A;  5ETD A;  4UIX A;  5A7C A;  5JWM A;  5I86 A;  2L85 A;  4LZS A;  4QSU A;  4QNS A;  5G4R A;  3O34 A;  3HMF A;  4YYK A;  4OGJ A;  5AMF A;  5DBM A;  4HBY A;  5A5O A;  4RVR A;  4UYH A;  5CQ3 A;  4IR3 A;  5D7X A;  5HEM A;  3DAI A;  2LSP B;  5CU8 A;  4NRB A;  5TCM A;  5EA1 A;  5D3L A;  3QZT A;  4PS5 A;  3MUL A;  2L84 A;  5I40 A;  3S92 A;  4MR6 A;  4A9J A;  4QY4 A;  4QBM A;  4TZ8 A;  5CY9 A;  1F68 A;  2DVQ A;  5FE5 A;  3AAD A;  5A5Q A;  4UYE A;  3IU5 A;  4YBT A;  5FG4 A;  5DYC A;  3MB3 A;  4HXS A;  5E9V A;  5FH8 A;  4UIZ A;  3NXB A;  4UIT A;  5IGM A;  5EPB A;  2RFJ A;  4KV4 A;  4YK0 A;  5E9M A;  4QSQ A;  2R10 A;  2GRC A;  4UIW A;  4Z6I A;  4HXP A;  5COI A;  4UYF B;  2I7K A;  4QSX A;  4YAX A;  5DYX A;  5EWH A;  4IOQ A;  1JM4 B;  5CP5 A;  5A5S A;  5KO4 A;  5E74 A;  5F25 A;  4MEP A;  5II1 A;  4CUQ A;  3JVJ A;  5DLZ A;  3IU6 A;  2RNX A;  4WIV A;  5EWD A;  5HEL A;  4QSW A;  3S91 A;  4NS5 A;  4NR4 A;  5KU3 A;  3UV5 A;  4O72 A;  5A83 A;  3P1F A;  4O7F A;  4A9E A;  2OUO A;  4PY6 A;  5D0C A;  4J1P A;  2WP2 A;  5BT4 A;  5FE0 A;  5IID A;  5ENE A;  5HJC A;  4O76 A;  5E7D A;  4IR5 A;  1JSP B;  4NRC A;  5DFC A;  4YYJ A;  5LKX A;  4NYV A;  5FB0 A;  2YW5 A;  2R0Y A;  3UV4 A;  3UVX A;  4ALH A;  5E73 A;  5HRV A;  5I1Q A;  5CFW A;  5A5R A;  5A82 A;  4LC2 A;  1N72 A;  2DVR A;  2R0V A;  4IR4 A;  5L98 A;  4QR3 A;  2DAT A;  4ALG A;  5LKZ A;  4Z1Q A;  2DVV A;  5A5N A;  5CQ5 A;  3D7C A;  5CQ8 A;  4LYS A;  5LKT A;  4TU6 A;  5FE8 A;  4CL9 A;  4MR4 A;  5DYA A;  3TLP A;  4PCI A;  2YEL A;  5ENG A;  5CQT A;  2N9G A;  1ZS5 A;  5FH7 A;  5EWV A;  5F2P A;  5AME A;  4YYI A;  5DLX A;  5EPS A;  5E9L A;  4BHW A;  5LVQ A;  4NQN A;  5D26 A;  4CUS A;  5EI4 A;  5LJ0 A;  3MXF A;  4TT6 A;  4TT4 A;  1WUG A;  4YH4 A;  5D3R A;  4HXM A;  4N4F A;  4LYW A;  3UVY A;  4A9I A;  4NR8 A;  4E96 A;  3Q2E A;  4O70 A;  3LQI A;  5DX4 A;  3RCW A;  3MUK A;  3JVK A;  4J3I A;  4KV1 A;  4LDF A;  2R0S A;  4IOO A;  4YY4 A;  4YAB A;  5EU1 A;  4Y03 A;  5HCL A;  4HBV A;  1WUM A;  2KTB B;  3LQJ A;  5FE6 A;  4QUT A;  5HLS A;  5DW2 A;  4HXO A;  4OGI A;  4KCX A;  3O33 A;  2F6J A;  5CRZ A;  4WHW A;  5G4S A;  5EV9 A;  5F5Z A;  5EK9 A;  5LUU A;  4A9O A;  5I80 A;  4CUU A;  5CS8 A;  5ACY A;  4O7E A;  5C85 A;  3UVD A;  4MR5 A;  5I89 A;  5E0R A;  3P5O A;  5BT3 A;  4IOR A;  5AD3 A;  4BW3 A;  3JVM A;  5TB6 A;  4NYW A;  4YAD A;  5DFD A;  4HXN A;  4QC1 A;  4QST A;  4A9H A;  5CUB A;  3U5N A;  5D3N A;  5DYU A;  4MR3 A;  4C66 A;  5HFR A;  4N4I A;  4NR7 A;  5HQ7 A;  5L99 A;  5E9I A;  5CQ7 A;  5EIC A;  4YAT A;  5C8G A;  2YDW A;  5H1U A;  4QYL A;  4QSV A;  5CUE A;  5LJ1 A;  5IGN A;  4UIV A;  3SVH A;  2WP1 A;  3LJW A;  5BT5 A;  2G4A A;  5IBN A;  4YY6 A;  4YH3 A;  5D24 A;  5I7Y A;  3JVL A;  4PTB A;  4BW1 A;  3GG3 A;  4LZ2 A;  3AQA A;  2F6N A;  2E7O A;  5EP7 A;  4A9N A;  3QZV A;  4XY9 A;  5KTU A;  4NRA A;  5FG5 A;  5EQ1 A;  5EVA A;  5HQ6 A;  4O74 A;  5DKC A;  4BW4 A;  2RI7 A;  3U5K A;  4YYH A;  3MQM A;  4CFL A;  5HRW A;  3LQH A;  4MEQ A;  5FFW A;  5CQ6 A;  4GPJ A;  4NUD A;  4HXR A;  5CUG A;  5ENJ A;  5F60 A;  5KHM A;  4DON A;  5I83 A;  5KTX A;  5IGK A;  5L8T A;  2OSS A;  4YBM A; 
#chains in the Genus database with same CATH topology
 4TTE A;  3Q2F A;  5EWC A;  4N4H A;  5EGU A;  4HBX A;  4XYA A;  4J0R A;  5DY7 A;  5ENB A;  4BW2 A;  3K2J A;  5C87 A;  4NUE A;  4N4G A;  3HME A;  4O7B A;  4QEU A;  4UIY A;  5CZG A;  5ENC A;  5E3G A;  5F36 A;  3QZS A;  2RNY A;  3DWY A;  3ZYU A;  2RS9 B;  4F3I A;  2DWW A;  5I29 A;  3O35 A;  3O36 A;  5AD2 A;  4ZW1 A;  4UIU A;  4NUC A;  5E9K A;  4QYD A;  2FSA A;  4CUT A;  5CQA A;  4O7A A;  1EQF A;  4O78 A;  4QR5 A;  4NXJ A;  4TT2 A;  5CUD A;  5L8U A;  4PKL A;  4QB3 A;  5DKD A;  3G0J A;  5D3J A;  4FLP A;  4IR6 A;  3FKM X;  4YC9 A;  5FB1 A;  4CUP A;  5D3P A;  5C7N A;  5F1H A;  4AKN A;  5H1V A;  3UW9 A;  4HBW A;  5LVR A;  5EIS A;  5D3S A;  5FFV A;  5LJ2 A;  4XY8 A;  4QEV A;  2E3K A;  4QEW A;  5D3T A;  5CRM A;  5DFB A;  5CQ4 A;  4QSS A;  5CUA A;  4LYI A;  2RO1 A;  4O71 A;  4PCE A;  4XUA A;  4CLB A;  5FDZ A;  5EPR A;  3G0L A;  3UVW A;  4A9L A;  4HXL A;  3P1C A;  2YQD A;  4O75 A;  5IGL A;  5ENF A;  1E6I A;  4MEN A;  4TQN A;  5FBX A;  5HQ5 A;  5FE4 A;  5JI8 A;  5I7X A;  2DVS A;  5D25 A;  5HFQ A;  5E9Y A;  5K29 A;  3SVF A;  4LR6 A;  4QSR A;  5CUC A;  4CFK A;  3I3J A;  4NQM A;  3U5M A;  2D9E A;  2H60 A;  5F62 A;  5HRX A;  5FE9 A;  4ZQL A;  4A9F A;  5FE2 A;  2YEK A;  5F1L A;  5DW1 A;  2L5E A;  2RNW A;  4LRG A;  5ENI A;  5D3H A;  5LKU A;  5FH6 A;  3U5L A;  5CPE A;  4C67 A;  4NYX A;  5F63 A;  2E7N A;  4QC3 A;  4QUU A;  3U5O A;  3P1E A;  4QSP A;  5I88 A;  4LZR A;  4YYM A;  4UYF A;  5FE3 A;  4BJX A;  2DKW A;  5FE1 A;  4UYG A;  4YYD A;  5H85 A;  5HEN A;  4Z6H A;  5HM0 A;  3O37 A;  3HMH A;  5A81 A;  4TU4 A;  4J0S A;  2YYN A;  3ONI A;  1X0J A;  4Q0O A;  4HXK A;  5C89 A;  4YYN A;  5KTW A;  2OO1 A;  5EM3 A;  5F3A A;  2I8N A;  5A5P A;  5A85 A;  3MB4 A;  4MEO A;  4YYG A;  3SVG A;  4Z1S A;  4O7C A;  5E3D A;  5F61 A;  5J0D A;  4X2I A;  5DKH A;  5II2 A;  3LXJ A;  2NXB A;  4QR4 A;  5FFY A;  5IG6 A;  4A9M A;  4N3W A;  5FG6 A;  5L97 A;  2YEM A;  4O77 A;  3P1D A;  5C4Q A;  5H1T A;  4ZC9 A;  5CGP A;  5ETB A;  4OUF A;  4TZ2 A;  4CUR A;  5EWW A;  4TYL A;  3U5J A;  4NR5 A;  4TS8 A;  3U5P A;  4Q0N A;  3UV2 A;  4NR9 A;  4YBS A;  3VKG A;  4A9K A;  2MJV B;  5L96 A;  4QZS A;  4Z93 A;  4WHU A;  5CTL A;  4NR6 A;  5FE7 A;  2D82 A;  4XUB A;  4UYD A;  5ENH A;  5ETD A;  4AI6 A;  4UIX A;  5A7C A;  5JWM A;  5I86 A;  2L85 A;  4LZS A;  4QSU A;  4QNS A;  5G4R A;  3O34 A;  3HMF A;  4YYK A;  4OGJ A;  5AMF A;  5DBM A;  4HBY A;  5A5O A;  4RVR A;  4UYH A;  5CQ3 A;  4IR3 A;  1PUO A;  5D7X A;  5HEM A;  3DAI A;  2LSP B;  5CU8 A;  4NRB A;  5TCM A;  5EA1 A;  5D3L A;  3QZT A;  4PS5 A;  3MUL A;  2L84 A;  5I40 A;  3S92 A;  4MR6 A;  4A9J A;  4QY4 A;  4QBM A;  4TZ8 A;  5CY9 A;  1F68 A;  4AKH A;  2DVQ A;  5FE5 A;  3AAD A;  5A5Q A;  4UYE A;  3IU5 A;  4YBT A;  5FG4 A;  5DYC A;  3D1D A;  3MB3 A;  4HXS A;  5E9V A;  5FH8 A;  4UIZ A;  3NXB A;  4UIT A;  5IGM A;  1ZKR A;  5EPB A;  2RFJ A;  4KV4 A;  4YK0 A;  5E9M A;  4QSQ A;  2R10 A;  2GRC A;  4UIW A;  4Z6I A;  4HXP A;  5COI A;  4UYF B;  2I7K A;  4QSX A;  4YAX A;  5DYX A;  5EWH A;  4IOQ A;  1JM4 B;  5CP5 A;  5A5S A;  5KO4 A;  5E74 A;  5F25 A;  4AKI A;  4MEP A;  5II1 A;  4CUQ A;  3JVJ A;  5DLZ A;  3IU6 A;  2RNX A;  4WIV A;  5EWD A;  5HEL A;  4QSW A;  2EJN A;  3S91 A;  4NS5 A;  4NR4 A;  5KU3 A;  3UV5 A;  4O72 A;  5A83 A;  3P1F A;  4O7F A;  4A9E A;  2OUO A;  4PY6 A;  5D0C A;  4J1P A;  2WP2 A;  5BT4 A;  5FE0 A;  5IID A;  5ENE A;  5HJC A;  4O76 A;  5E7D A;  4IR5 A;  1JSP B;  4NRC A;  5DFC A;  4YYJ A;  5LKX A;  4NYV A;  5FB0 A;  2YW5 A;  2R0Y A;  3UV4 A;  3UVX A;  4ALH A;  5E73 A;  5HRV A;  5I1Q A;  5CFW A;  5A5R A;  5A82 A;  4LC2 A;  1N72 A;  2DVR A;  2R0V A;  4IR4 A;  5L98 A;  4QR3 A;  2DAT A;  4ALG A;  5LKZ A;  4Z1Q A;  2DVV A;  5A5N A;  5CQ5 A;  3D7C A;  5CQ8 A;  4LYS A;  5LKT A;  4TU6 A;  5FE8 A;  4CL9 A;  4MR4 A;  3ERR A;  5DYA A;  4PCI A;  3TLP A;  2YEL A;  5ENG A;  5CQT A;  2N9G A;  1ZS5 A;  5FH7 A;  5EWV A;  5F2P A;  5AME A;  4YYI A;  5DLX A;  5EPS A;  5E9L A;  4BHW A;  5LVQ A;  4NQN A;  5D26 A;  4CUS A;  5EI4 A;  3VKH A;  5LJ0 A;  3MXF A;  4TT6 A;  4TT4 A;  1WUG A;  4YH4 A;  4AKG A;  5D3R A;  4HXM A;  4N4F A;  4LYW A;  3UVY A;  4A9I A;  4NR8 A;  4E96 A;  3Q2E A;  4O70 A;  3LQI A;  5DX4 A;  3RCW A;  3MUK A;  3JVK A;  4J3I A;  4KV1 A;  4LDF A;  2R0S A;  4IOO A;  4YY4 A;  4YAB A;  5EU1 A;  4Y03 A;  5HCL A;  4HBV A;  1WUM A;  2KTB B;  3LQJ A;  5FE6 A;  4QUT A;  5HLS A;  5DW2 A;  4HXO A;  4OGI A;  4KCX A;  3O33 A;  2F6J A;  5CRZ A;  4WHW A;  5G4S A;  5EV9 A;  5F5Z A;  5EK9 A;  5LUU A;  4A9O A;  5I80 A;  4CUU A;  5CS8 A;  5ACY A;  4O7E A;  5C85 A;  3UVD A;  4MR5 A;  5I89 A;  5E0R A;  3P5O A;  5BT3 A;  4IOR A;  5AD3 A;  4BW3 A;  3JVM A;  5TB6 A;  3D1B A;  4NYW A;  4YAD A;  5DFD A;  4HXN A;  4QC1 A;  4QST A;  4A9H A;  5CUB A;  3U5N A;  5D3N A;  5DYU A;  4MR3 A;  4C66 A;  5HFR A;  4N4I A;  4NR7 A;  5HQ7 A;  5L99 A;  5E9I A;  5CQ7 A;  5EIC A;  4YAT A;  5C8G A;  2YDW A;  5H1U A;  4QYL A;  4QSV A;  5CUE A;  5LJ1 A;  5IGN A;  4UIV A;  3SVH A;  2WP1 A;  3LJW A;  5BT5 A;  2G4A A;  5IBN A;  4YY6 A;  4YH3 A;  5D24 A;  5I7Y A;  3JVL A;  4PTB A;  4BW1 A;  3GG3 A;  4LZ2 A;  3AQA A;  2F6N A;  2E7O A;  5EP7 A;  4A9N A;  3QZV A;  4XY9 A;  5KTU A;  4NRA A;  5FG5 A;  5EQ1 A;  5EVA A;  5HQ6 A;  4O74 A;  5DKC A;  4BW4 A;  2RI7 A;  3U5K A;  4YYH A;  3MQM A;  4CFL A;  5HRW A;  3LQH A;  4MEQ A;  5FFW A;  5CQ6 A;  4GPJ A;  4NUD A;  4HXR A;  5CUG A;  5ENJ A;  5F60 A;  5KHM A;  4DON A;  5I83 A;  5KTX A;  5IGK A;  5L8T A;  2OSS A;  4YBM A; 
#chains in the Genus database with same CATH homology
 4TTE A;  3Q2F A;  5EWC A;  4N4H A;  5EGU A;  4HBX A;  4XYA A;  4J0R A;  5DY7 A;  5ENB A;  4BW2 A;  3K2J A;  5C87 A;  4NUE A;  4N4G A;  3HME A;  4O7B A;  4QEU A;  4UIY A;  5CZG A;  5ENC A;  5E3G A;  5F36 A;  3QZS A;  2RNY A;  3DWY A;  3ZYU A;  2RS9 B;  4F3I A;  2DWW A;  5I29 A;  3O35 A;  3O36 A;  5AD2 A;  4ZW1 A;  4UIU A;  4NUC A;  5E9K A;  4QYD A;  2FSA A;  4CUT A;  5CQA A;  4O7A A;  1EQF A;  4O78 A;  4QR5 A;  4NXJ A;  4TT2 A;  5CUD A;  5L8U A;  4PKL A;  4QB3 A;  5DKD A;  3G0J A;  5D3J A;  4FLP A;  4IR6 A;  3FKM X;  4YC9 A;  5FB1 A;  4CUP A;  5D3P A;  5C7N A;  5F1H A;  4AKN A;  5H1V A;  3UW9 A;  4HBW A;  5LVR A;  5EIS A;  5D3S A;  5FFV A;  5LJ2 A;  4XY8 A;  4QEV A;  2E3K A;  4QEW A;  5D3T A;  5CRM A;  5DFB A;  5CQ4 A;  4QSS A;  5CUA A;  4LYI A;  2RO1 A;  4O71 A;  4PCE A;  4XUA A;  4CLB A;  5FDZ A;  5EPR A;  3G0L A;  3UVW A;  4A9L A;  4HXL A;  3P1C A;  2YQD A;  4O75 A;  5IGL A;  5ENF A;  1E6I A;  4MEN A;  4TQN A;  5FBX A;  5HQ5 A;  5FE4 A;  5JI8 A;  5I7X A;  2DVS A;  5D25 A;  5HFQ A;  5E9Y A;  5K29 A;  3SVF A;  4LR6 A;  4QSR A;  5CUC A;  4CFK A;  3I3J A;  4NQM A;  3U5M A;  2D9E A;  2H60 A;  5F62 A;  5HRX A;  5FE9 A;  4ZQL A;  4A9F A;  5FE2 A;  2YEK A;  5F1L A;  5DW1 A;  2L5E A;  2RNW A;  4LRG A;  5ENI A;  5D3H A;  5LKU A;  5FH6 A;  3U5L A;  5CPE A;  4C67 A;  4NYX A;  5F63 A;  2E7N A;  4QC3 A;  4QUU A;  3U5O A;  3P1E A;  4QSP A;  5I88 A;  4LZR A;  4YYM A;  4UYF A;  5FE3 A;  4BJX A;  2DKW A;  5FE1 A;  4UYG A;  4YYD A;  5H85 A;  5HEN A;  4Z6H A;  5HM0 A;  3O37 A;  3HMH A;  5A81 A;  4TU4 A;  4J0S A;  2YYN A;  3ONI A;  1X0J A;  4Q0O A;  4HXK A;  5C89 A;  4YYN A;  5KTW A;  2OO1 A;  5EM3 A;  5F3A A;  2I8N A;  5A5P A;  5A85 A;  3MB4 A;  4MEO A;  4YYG A;  3SVG A;  4Z1S A;  4O7C A;  5E3D A;  5F61 A;  5J0D A;  4X2I A;  5DKH A;  5II2 A;  3LXJ A;  2NXB A;  4QR4 A;  5FFY A;  5IG6 A;  4A9M A;  4N3W A;  5FG6 A;  5L97 A;  2YEM A;  4O77 A;  3P1D A;  5C4Q A;  5H1T A;  4ZC9 A;  5CGP A;  5ETB A;  4OUF A;  4TZ2 A;  4CUR A;  5EWW A;  4TYL A;  3U5J A;  4NR5 A;  4TS8 A;  3U5P A;  4Q0N A;  3UV2 A;  4NR9 A;  4YBS A;  4A9K A;  2MJV B;  5L96 A;  4QZS A;  4Z93 A;  4WHU A;  5CTL A;  4NR6 A;  5FE7 A;  2D82 A;  4XUB A;  4UYD A;  5ENH A;  5ETD A;  4UIX A;  5A7C A;  5JWM A;  5I86 A;  2L85 A;  4LZS A;  4QSU A;  4QNS A;  5G4R A;  3O34 A;  3HMF A;  4YYK A;  4OGJ A;  5AMF A;  5DBM A;  4HBY A;  5A5O A;  4RVR A;  4UYH A;  5CQ3 A;  4IR3 A;  5D7X A;  5HEM A;  3DAI A;  2LSP B;  5CU8 A;  4NRB A;  5TCM A;  5EA1 A;  5D3L A;  3QZT A;  4PS5 A;  3MUL A;  2L84 A;  5I40 A;  3S92 A;  4MR6 A;  4A9J A;  4QY4 A;  4QBM A;  4TZ8 A;  5CY9 A;  1F68 A;  2DVQ A;  5FE5 A;  3AAD A;  5A5Q A;  4UYE A;  3IU5 A;  4YBT A;  5FG4 A;  5DYC A;  3MB3 A;  4HXS A;  5E9V A;  5FH8 A;  4UIZ A;  3NXB A;  4UIT A;  5IGM A;  5EPB A;  2RFJ A;  4KV4 A;  4YK0 A;  5E9M A;  4QSQ A;  2R10 A;  2GRC A;  4UIW A;  4Z6I A;  4HXP A;  5COI A;  4UYF B;  2I7K A;  4QSX A;  4YAX A;  5DYX A;  5EWH A;  4IOQ A;  1JM4 B;  5CP5 A;  5A5S A;  5KO4 A;  5E74 A;  5F25 A;  4MEP A;  5II1 A;  4CUQ A;  3JVJ A;  5DLZ A;  3IU6 A;  2RNX A;  4WIV A;  5EWD A;  5HEL A;  4QSW A;  3S91 A;  4NS5 A;  4NR4 A;  5KU3 A;  3UV5 A;  4O72 A;  5A83 A;  3P1F A;  4O7F A;  4A9E A;  2OUO A;  4PY6 A;  5D0C A;  4J1P A;  2WP2 A;  5BT4 A;  5FE0 A;  5IID A;  5ENE A;  5HJC A;  4O76 A;  5E7D A;  4IR5 A;  1JSP B;  4NRC A;  5DFC A;  4YYJ A;  5LKX A;  4NYV A;  5FB0 A;  2YW5 A;  2R0Y A;  3UV4 A;  3UVX A;  4ALH A;  5E73 A;  5HRV A;  5I1Q A;  5CFW A;  5A5R A;  5A82 A;  4LC2 A;  1N72 A;  2DVR A;  2R0V A;  4IR4 A;  5L98 A;  4QR3 A;  2DAT A;  4ALG A;  5LKZ A;  4Z1Q A;  2DVV A;  5A5N A;  5CQ5 A;  3D7C A;  5CQ8 A;  4LYS A;  5LKT A;  4TU6 A;  5FE8 A;  4CL9 A;  4MR4 A;  5DYA A;  3TLP A;  4PCI A;  2YEL A;  5ENG A;  5CQT A;  2N9G A;  1ZS5 A;  5FH7 A;  5EWV A;  5F2P A;  5AME A;  4YYI A;  5DLX A;  5EPS A;  5E9L A;  4BHW A;  5LVQ A;  4NQN A;  5D26 A;  4CUS A;  5EI4 A;  5LJ0 A;  3MXF A;  4TT6 A;  4TT4 A;  1WUG A;  4YH4 A;  5D3R A;  4HXM A;  4N4F A;  4LYW A;  3UVY A;  4A9I A;  4NR8 A;  4E96 A;  3Q2E A;  4O70 A;  3LQI A;  5DX4 A;  3RCW A;  3MUK A;  3JVK A;  4J3I A;  4KV1 A;  4LDF A;  2R0S A;  4IOO A;  4YY4 A;  4YAB A;  5EU1 A;  4Y03 A;  5HCL A;  4HBV A;  1WUM A;  2KTB B;  3LQJ A;  5FE6 A;  4QUT A;  5HLS A;  5DW2 A;  4HXO A;  4OGI A;  4KCX A;  3O33 A;  2F6J A;  5CRZ A;  4WHW A;  5G4S A;  5EV9 A;  5F5Z A;  5EK9 A;  5LUU A;  4A9O A;  5I80 A;  4CUU A;  5CS8 A;  5ACY A;  4O7E A;  5C85 A;  3UVD A;  4MR5 A;  5I89 A;  5E0R A;  3P5O A;  5BT3 A;  4IOR A;  5AD3 A;  4BW3 A;  3JVM A;  5TB6 A;  4NYW A;  4YAD A;  5DFD A;  4HXN A;  4QC1 A;  4QST A;  4A9H A;  5CUB A;  3U5N A;  5D3N A;  5DYU A;  4MR3 A;  4C66 A;  5HFR A;  4N4I A;  4NR7 A;  5HQ7 A;  5L99 A;  5E9I A;  5CQ7 A;  5EIC A;  4YAT A;  5C8G A;  2YDW A;  5H1U A;  4QYL A;  4QSV A;  5CUE A;  5LJ1 A;  5IGN A;  4UIV A;  3SVH A;  2WP1 A;  3LJW A;  5BT5 A;  2G4A A;  5IBN A;  4YY6 A;  4YH3 A;  5D24 A;  5I7Y A;  3JVL A;  4PTB A;  4BW1 A;  3GG3 A;  4LZ2 A;  3AQA A;  2F6N A;  2E7O A;  5EP7 A;  4A9N A;  3QZV A;  4XY9 A;  5KTU A;  4NRA A;  5FG5 A;  5EQ1 A;  5EVA A;  5HQ6 A;  4O74 A;  5DKC A;  4BW4 A;  2RI7 A;  3U5K A;  4YYH A;  3MQM A;  4CFL A;  5HRW A;  3LQH A;  4MEQ A;  5FFW A;  5CQ6 A;  4GPJ A;  4NUD A;  4HXR A;  5CUG A;  5ENJ A;  5F60 A;  5KHM A;  4DON A;  5I83 A;  5KTX A;  5IGK A;  5L8T A;  2OSS A;  4YBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...