5C87A

Crystal structure of the human brpf1 bromodomain in complex with seed2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c87A00
5BT3A 2DVVA 2DVQA 4QNSA 5F1LA 4CL9A 5L8UA 5EWCA 3D7CA 5DKCA 5I83A 5LKXA 4OUFA 3LQHA 4N4HA 5C8GA 5HENA 4TT2A 4GPJA 2E7NA 4Z1SA 4MR3A 4A9KA 5BT4A 4CFKA 5E9KA 5EA1A 4UIUA 4QZSA 4O78A 4XUBA 2I7KA 4MR6A 4QEVA 1F68A 4NUEA 4CUUA 4Z6IA 5L8TA 5AMFA 5EPRA 5LKUA 5EPSA 4OGIA 5KTUA 4IR4A 4NXJA 3MQMA 5CS8A 5FBXA 4A9HA 4YH3A 3UVYA 5TB6A 2DWWA 4HBVA 5I86A 1WUMA 5E3GA 4UIYA 5FG6A 4IR6A 4QYLA 5KTXA 5ENJA 4WIVA 5ENCA 5FE6A 5FH6A 4O77A 2OO1A 5CQ3A 4UIZA 5DFCA 2RS9B 5EWWA 5HQ7A 5L97A 2D82A 2YQDA 5FE2A 5HRWA 5LJ0A 5FE7A 4MR5A 5IBNA 5ENFA 5FE5A 5L98A 5II2A 4YK0A 4BW3A 4QBMA 4YBMA 5EM3A 5A82A 5E9IA 5AD3A 5DW1A 5L96A 5FE3A 3O33A 4ALGA 5CQTA 5E9YA 4QEUA 4NUCA 5CUGA 2RI7A 3JVLA 3Q2FA 5FH7A 5COIA 4TYLA 1WUGA 4TTEA 4CUTA 2FSAA 5EPBA 5FFWA 4XYAA 5D3JA 4HBWA 5FE8A 3DWYA 2DATA 5ETBA 2DVRA 4TZ2A 2OSSA 5IGNA 5C87A 5HRXA 2R0VA 5DY7A 4MEOA 5D3NA 5LJ1A 4HXRA 4ZQLA 4XUAA 4PCIA 4UYFA 3P1FA 2RNXA 3HMHA 4QSSA 4C67A 4YY4A 3SVGA 4J0SA 2YEMA 4TZ8A 4QUUA 5E0RA 2L85A 4O75A 5D0CA 3U5KA 5L99A 5FFVA 3SVHA 4KCXA 4HXKA 4LR6A 2E7OA 5H1UA 5CUDA 4PKLA 5E9LA 4UYEA 4KV1A 5EU1A 5CQ6A 4LZRA 5H85A 2KTBB 4X2IA 4UITA 5DBMA 1N72A 5EISA 5CQ4A 2R0YA 5CQAA 3DAIA 3S92A 3U5OA 5DYCA 4CUPA 4XY8A 2NXBA 5HFQA 5DYXA 2OUOA 5I40A 3ZYUA 3SVFA 4YYMA 5DYAA 4A9OA 4NR4A 4N3WA 5CQ7A 1ZS5A 4A9MA 3NXBA 4ALHA 5A83A 3LQJA 5EGUA 5HELA 4IR5A 3P1CA 3AADA 5HFRA 5HRVA 2E3KA 5D7XA 2DKWA 5HEMA 5IIDA 4UIWA 5CUCA 5A5NA 5HM0A 5DX4A 4HXNA 4O7AA 3UVWA 4NYXA 5H1TA 5E9VA 1EQFA 5CGPA 3S91A 4NR6A 5II1A 5EVAA 5D26A 5I7XA 3LJWA 4Z1QA 3QZSA 3P5OA 2F6NA 3O37A 4NR7A 4C66A 3RCWA 3O35A 5AD2A 5C7NA 4QR4A 5A81A 4NRAA 2RFJA 2RNWA 4LDFA 4NYVA 1E6IA 5EWVA 3FKMX 5A5OA 5FE1A 5ENHA 5DYUA 4UIXA 5A5PA 2DVSA 4YYKA 4HXLA 5D3PA 5LUUA 2D9EA 4N4IA 4LC2A 4BW4A 4A9JA 4YYGA 4CUSA 5CRZA 5D3SA 4O7CA 5FE4A 5A7CA 5EI4A 3JVKA 3MULA 1JSPB 4NR9A 5EICA 4QUTA 4QYDA 5E74A 4YYDA 5D3TA 5LJ2A 3U5PA 5ENGA 4TT4A 5I88A 4O76A 4NR5A 4ZW1A 2MJVB 2R10A 4NR8A 1JM4B 4YYIA 4Y03A 4YAXA 5CPEA 4A9IA 5FG5A 3P1EA 4NRCA 5DKDA 3MUKA 4WHWA 5E9MA 5FE0A 4N4GA 4YC9A 3UV4A 5D3HA 5A85A 4PCEA 5CQ5A 2G4AA 2R0SA 5DLXA 3UV5A 4YYNA 5I89A 5D3LA 5EP7A 5CUBA 5F36A 4YYHA 3TLPA 4RVRA 4CURA 4QB3A 4UYGA 5HQ5A 4UYFB 5CU8A 5K29A 4NUDA 4Z6HA 4QY4A 4HBXA 4QR3A 5KO4A 5C89A 5ENBA 4PS5A 5D25A 5HQ6A 3MB3A 4TQNA 4J1PA 3HMEA 2RNYA 4MR4A 3ONIA 4UYHA 4N4FA 5LVQA 3G0JA 4HXPA 4QSVA 4QSWA 4BW1A 5A5RA 5EK9A 5I1QA 4TT6A 4AKNA 5DW2A 4UIVA 5CFWA 5EQ1A 5I29A 4QC1A 4O7EA 4Z93A 3UVXA 4YBSA 4O74A 3MXFA 4IOQA 5LKTA 5A5SA 3UVDA 2WP2A 4KV4A 4A9EA 2L5EA 5FFYA 1X0JA 5J0DA 3GG3A 5FH8A 5ACYA 5FB0A 5LVRA 5DFDA 4LYIA 5KTWA 2YELA 5FG4A 4UYDA 3JVMA 5F60A 3K2JA 5D3RA 5F61A 4BJXA 4WHUA 4QEWA 2GRCA 5DKHA 4O7FA 5IGLA 4O70A 4IR3A 5G4RA 5KU3A 4NQMA 5G4SA 2YW5A 4NS5A 5C4QA 4LZ2A 3QZTA 4DONA 2H60A 4YY6A 5A5QA 2LSPB 4QR5A 5ENEA 4O71A 5FB1A 3UV2A 4LYWA 4QSQA 4O72A 4CUQA 5DLZA 5CQ8A 5D24A 3UW9A 3O34A 2F6JA 5EWHA 3U5MA 3MB4A 3P1DA 4BHWA 4YATA 5CP5A 4CLBA 5ENIA 5CUAA 4MEPA 5CUEA 4HXOA 4XY9A 4QSPA 5JI8A 5E7DA 4QSRA 5HCLA 3IU5A 5FDZA 4LZSA 2YYNA 4QSXA 4HXSA 4PY6A 5ETDA 4QC3A 4YBTA 5E3DA 4A9NA 5F3AA 3O36A 5I80A 4HXMA 4QSTA 4BW2A 2WP1A 4OGJA 4A9LA 4F3IA 4YABA 5C85A 5CTLA 5LKZA 3Q2EA 2RO1A 3I3JA 4Q0OA 4IOOA 5EV9A 4HBYA 4NQNA 5F2PA 4CFLA 5JWMA 2YDWA 5H1VA 4QSUA 5AMEA 5F63A 5IGKA 4TU4A 5FE9A 3HMFA 2I8NA 3AQAA 5TCMA 4YH4A 4LRGA 4IORA 5HJCA 5CY9A 5DFBA 4LYSA 5IGMA 5I7YA 3G0LA 5F62A 5KHMA 4MENA 5EWDA 4TS8A 5E73A 5F25A 3U5JA 2N9GA 4J0RA 3LQIA 4ZC9A 4PTBA 2YEKA 4NRBA 5F5ZA 4O7BA 3U5NA 5IG6A 3IU6A 4MEQA 4NYWA 4FLPA 4J3IA 4YYJA 4YADA 5BT5A 5F1HA 2L84A 3U5LA 4A9FA 3LXJA 3QZVA 4Q0NA 5CZGA 5CRMA 5HLSA 3JVJA 4E96A 4TU6A
chains in the Genus database with same CATH superfamily
5BT3A 2DVVA 2DVQA 4QNSA 5F1LA 4CL9A 5L8UA 5EWCA 3D7CA 5DKCA 5I83A 5LKXA 4OUFA 3LQHA 4N4HA 5C8GA 5HENA 4TT2A 4GPJA 2E7NA 4Z1SA 4MR3A 4A9KA 5BT4A 4CFKA 5E9KA 5EA1A 4UIUA 4QZSA 4O78A 4XUBA 2I7KA 4MR6A 4QEVA 1F68A 4NUEA 4CUUA 4Z6IA 5L8TA 5AMFA 5EPRA 5LKUA 5EPSA 4OGIA 5KTUA 4IR4A 4NXJA 3MQMA 5CS8A 5FBXA 4A9HA 4YH3A 3UVYA 5TB6A 2DWWA 4HBVA 5I86A 1WUMA 5E3GA 4UIYA 5FG6A 4IR6A 4QYLA 5KTXA 5ENJA 4WIVA 5ENCA 5FE6A 5FH6A 4O77A 2OO1A 5CQ3A 4UIZA 5DFCA 2RS9B 5EWWA 5HQ7A 5L97A 2D82A 2YQDA 5FE2A 5HRWA 5LJ0A 5FE7A 4MR5A 5IBNA 5ENFA 5FE5A 5L98A 5II2A 4YK0A 4BW3A 4QBMA 4YBMA 5EM3A 5A82A 5E9IA 5AD3A 5DW1A 5L96A 1ZKRA 3O33A 5FE3A 4ALGA 5CQTA 5E9YA 4QEUA 4NUCA 5CUGA 2RI7A 3JVLA 3Q2FA 5FH7A 5COIA 4TYLA 1WUGA 4TTEA 4CUTA 2FSAA 5EPBA 5FFWA 4XYAA 3ERRA 5D3JA 4HBWA 5FE8A 3DWYA 2DATA 5ETBA 2DVRA 4TZ2A 2OSSA 5IGNA 5C87A 5HRXA 2R0VA 5DY7A 4MEOA 3D1BA 5D3NA 5LJ1A 4HXRA 4ZQLA 4XUAA 4PCIA 4UYFA 3P1FA 2RNXA 3HMHA 4QSSA 4C67A 4YY4A 3SVGA 4J0SA 2YEMA 4TZ8A 4QUUA 5E0RA 2L85A 4O75A 5D0CA 3U5KA 5L99A 5FFVA 3SVHA 4KCXA 4HXKA 4LR6A 2E7OA 5H1UA 5CUDA 4PKLA 5E9LA 4UYEA 4KV1A 5EU1A 5CQ6A 4LZRA 5H85A 2KTBB 4X2IA 4UITA 5DBMA 1N72A 5EISA 5CQ4A 2R0YA 5CQAA 3DAIA 3S92A 3U5OA 5DYCA 4CUPA 4XY8A 2NXBA 5HFQA 5DYXA 2OUOA 5I40A 3ZYUA 3SVFA 4YYMA 5DYAA 4A9OA 4NR4A 4N3WA 5CQ7A 1ZS5A 4A9MA 4AKHA 3NXBA 4ALHA 5A83A 3LQJA 5EGUA 5HELA 4IR5A 3P1CA 3AADA 5HFRA 5HRVA 2E3KA 5D7XA 2DKWA 5HEMA 5IIDA 4UIWA 5CUCA 5A5NA 5HM0A 5DX4A 4HXNA 4O7AA 3UVWA 4NYXA 5H1TA 5E9VA 1EQFA 5CGPA 3S91A 4NR6A 5II1A 5EVAA 5D26A 5I7XA 3LJWA 4Z1QA 3QZSA 3P5OA 2EJNA 2F6NA 3O37A 3VKGA 4NR7A 4C66A 3RCWA 3O35A 5AD2A 5C7NA 4QR4A 5A81A 4NRAA 2RFJA 2RNWA 4LDFA 4NYVA 1E6IA 5EWVA 3FKMX 5A5OA 5FE1A 5ENHA 3D1DA 4UIXA 5DYUA 5A5PA 2DVSA 4YYKA 4HXLA 5D3PA 5LUUA 2D9EA 4N4IA 4LC2A 4BW4A 4A9JA 4YYGA 4CUSA 5CRZA 5D3SA 4O7CA 5FE4A 5A7CA 5EI4A 3JVKA 3MULA 1JSPB 4NR9A 5EICA 4QUTA 4QYDA 5E74A 4YYDA 5D3TA 5LJ2A 3U5PA 5ENGA 4TT4A 5I88A 4O76A 4NR5A 4ZW1A 2MJVB 2R10A 4NR8A 1JM4B 4YYIA 4Y03A 4YAXA 5CPEA 4A9IA 5FG5A 3P1EA 4NRCA 5DKDA 3MUKA 4WHWA 5E9MA 5FE0A 4AKIA 4N4GA 4YC9A 3UV4A 5D3HA 5A85A 4PCEA 5CQ5A 2G4AA 2R0SA 5DLXA 3UV5A 4YYNA 5I89A 5D3LA 5EP7A 5CUBA 5F36A 4YYHA 3TLPA 4RVRA 4CURA 4QB3A 4UYGA 5HQ5A 4UYFB 5CU8A 5K29A 4AKGA 4NUDA 4Z6HA 4QY4A 4HBXA 4QR3A 5KO4A 5C89A 5ENBA 4PS5A 5D25A 5HQ6A 3MB3A 3VKHA 4TQNA 4J1PA 3HMEA 2RNYA 4MR4A 3ONIA 4UYHA 4N4FA 5LVQA 3G0JA 4HXPA 4QSVA 4QSWA 4BW1A 5A5RA 5EK9A 5I1QA 4TT6A 4AKNA 5DW2A 4UIVA 5CFWA 5EQ1A 5I29A 4QC1A 4O7EA 4Z93A 3UVXA 4YBSA 4O74A 3MXFA 4IOQA 5LKTA 5A5SA 3UVDA 2WP2A 4KV4A 4A9EA 2L5EA 5FFYA 1X0JA 5J0DA 3GG3A 5FH8A 5ACYA 5FB0A 5LVRA 5DFDA 4LYIA 5KTWA 2YELA 5FG4A 4UYDA 3JVMA 5F60A 5D3RA 3K2JA 5F61A 4BJXA 4WHUA 4QEWA 2GRCA 5DKHA 4O7FA 5IGLA 4O70A 4IR3A 5G4RA 5KU3A 1PUOA 4NQMA 5G4SA 2YW5A 4NS5A 5C4QA 4LZ2A 3QZTA 4DONA 2H60A 4YY6A 5A5QA 2LSPB 4QR5A 5ENEA 4O71A 5FB1A 3UV2A 4LYWA 4QSQA 4O72A 4CUQA 5DLZA 5CQ8A 5D24A 3UW9A 3O34A 2F6JA 5EWHA 3U5MA 3MB4A 3P1DA 4BHWA 4YATA 5CP5A 4CLBA 5ENIA 5CUAA 4MEPA 5CUEA 4HXOA 4XY9A 4QSPA 5JI8A 5E7DA 4QSRA 5HCLA 3IU5A 5FDZA 4LZSA 2YYNA 4QSXA 4HXSA 4PY6A 5ETDA 4QC3A 4YBTA 5E3DA 4A9NA 5F3AA 3O36A 5I80A 4HXMA 4QSTA 4BW2A 2WP1A 4OGJA 4A9LA 4F3IA 4YABA 5C85A 5CTLA 5LKZA 3Q2EA 2RO1A 3I3JA 4Q0OA 4IOOA 5EV9A 4HBYA 4NQNA 5F2PA 4CFLA 5JWMA 2YDWA 5H1VA 4QSUA 5AMEA 5F63A 5IGKA 4TU4A 5FE9A 3HMFA 2I8NA 3AQAA 5TCMA 4YH4A 4LRGA 4IORA 5HJCA 5CY9A 5DFBA 4LYSA 5IGMA 5I7YA 3G0LA 5F62A 5KHMA 4MENA 5EWDA 4TS8A 5E73A 5F25A 3U5JA 2N9GA 4J0RA 3LQIA 4ZC9A 4PTBA 2YEKA 4NRBA 5F5ZA 4O7BA 3U5NA 5IG6A 3IU6A 4MEQA 4NYWA 4FLPA 4J3IA 4YYJA 4YADA 4AI6A 5BT5A 5F1HA 2L84A 3U5LA 4A9FA 3LXJA 3QZVA 4Q0NA 5CZGA 5CRMA 5HLSA 3JVJA 4E96A 4TU6A
chains in the Genus database with same CATH topology
5BT3A 2DVVA 2DVQA 4QNSA 5F1LA 4CL9A 5L8UA 5EWCA 3D7CA 5DKCA 5I83A 5LKXA 4OUFA 3LQHA 4N4HA 5C8GA 5HENA 4TT2A 4GPJA 2E7NA 4Z1SA 4MR3A 4A9KA 5BT4A 4CFKA 5E9KA 5EA1A 4UIUA 4QZSA 4O78A 4XUBA 2I7KA 4MR6A 4QEVA 1F68A 4NUEA 4CUUA 4Z6IA 5L8TA 5AMFA 5EPRA 5LKUA 5EPSA 4OGIA 5KTUA 4IR4A 4NXJA 3MQMA 5CS8A 5FBXA 4A9HA 4YH3A 3UVYA 5TB6A 2DWWA 4HBVA 5I86A 1WUMA 5E3GA 4UIYA 5FG6A 4IR6A 4QYLA 5KTXA 5ENJA 4WIVA 5ENCA 5FE6A 5FH6A 4O77A 2OO1A 5CQ3A 4UIZA 5DFCA 2RS9B 5EWWA 5HQ7A 5L97A 2D82A 2YQDA 5FE2A 5HRWA 5LJ0A 5FE7A 4MR5A 5IBNA 5ENFA 5FE5A 5L98A 5II2A 4YK0A 4BW3A 4QBMA 4YBMA 5EM3A 5A82A 5E9IA 5AD3A 5DW1A 5L96A 5FE3A 3O33A 4ALGA 5CQTA 5E9YA 4QEUA 4NUCA 5CUGA 2RI7A 3JVLA 3Q2FA 5FH7A 5COIA 4TYLA 1WUGA 4TTEA 4CUTA 2FSAA 5EPBA 5FFWA 4XYAA 5D3JA 4HBWA 5FE8A 3DWYA 2DATA 5ETBA 2DVRA 4TZ2A 2OSSA 5IGNA 5C87A 5HRXA 2R0VA 5DY7A 4MEOA 5D3NA 5LJ1A 4HXRA 4ZQLA 4XUAA 4PCIA 4UYFA 3P1FA 2RNXA 3HMHA 4QSSA 4C67A 4YY4A 3SVGA 4J0SA 2YEMA 4TZ8A 4QUUA 5E0RA 2L85A 4O75A 5D0CA 3U5KA 5L99A 5FFVA 3SVHA 4KCXA 4HXKA 4LR6A 2E7OA 5H1UA 5CUDA 4PKLA 5E9LA 4UYEA 4KV1A 5EU1A 5CQ6A 4LZRA 5H85A 2KTBB 4X2IA 4UITA 5DBMA 1N72A 5EISA 5CQ4A 2R0YA 5CQAA 3DAIA 3S92A 3U5OA 5DYCA 4CUPA 4XY8A 2NXBA 5HFQA 5DYXA 2OUOA 5I40A 3ZYUA 3SVFA 4YYMA 5DYAA 4A9OA 4NR4A 4N3WA 5CQ7A 1ZS5A 4A9MA 3NXBA 4ALHA 5A83A 3LQJA 5EGUA 5HELA 4IR5A 3P1CA 3AADA 5HFRA 5HRVA 2E3KA 5D7XA 2DKWA 5HEMA 5IIDA 4UIWA 5CUCA 5A5NA 5HM0A 5DX4A 4HXNA 4O7AA 3UVWA 4NYXA 5H1TA 5E9VA 1EQFA 5CGPA 3S91A 4NR6A 5II1A 5EVAA 5D26A 5I7XA 3LJWA 4Z1QA 3QZSA 3P5OA 2F6NA 3O37A 4NR7A 4C66A 3RCWA 3O35A 5AD2A 5C7NA 4QR4A 5A81A 4NRAA 2RFJA 2RNWA 4LDFA 4NYVA 1E6IA 5EWVA 3FKMX 5A5OA 5FE1A 5ENHA 5DYUA 4UIXA 5A5PA 2DVSA 4YYKA 4HXLA 5D3PA 5LUUA 2D9EA 4N4IA 4LC2A 4BW4A 4A9JA 4YYGA 4CUSA 5CRZA 5D3SA 4O7CA 5FE4A 5A7CA 5EI4A 3JVKA 3MULA 1JSPB 4NR9A 5EICA 4QUTA 4QYDA 5E74A 4YYDA 5D3TA 5LJ2A 3U5PA 5ENGA 4TT4A 5I88A 4O76A 4NR5A 4ZW1A 2MJVB 2R10A 4NR8A 1JM4B 4YYIA 4Y03A 4YAXA 5CPEA 4A9IA 5FG5A 3P1EA 4NRCA 5DKDA 3MUKA 4WHWA 5E9MA 5FE0A 4N4GA 4YC9A 3UV4A 5D3HA 5A85A 4PCEA 5CQ5A 2G4AA 2R0SA 5DLXA 3UV5A 4YYNA 5I89A 5D3LA 5EP7A 5CUBA 5F36A 4YYHA 3TLPA 4RVRA 4CURA 4QB3A 4UYGA 5HQ5A 4UYFB 5CU8A 5K29A 4NUDA 4Z6HA 4QY4A 4HBXA 4QR3A 5KO4A 5C89A 5ENBA 4PS5A 5D25A 5HQ6A 3MB3A 4TQNA 4J1PA 3HMEA 2RNYA 4MR4A 3ONIA 4UYHA 4N4FA 5LVQA 3G0JA 4HXPA 4QSVA 4QSWA 4BW1A 5A5RA 5EK9A 5I1QA 4TT6A 4AKNA 5DW2A 4UIVA 5CFWA 5EQ1A 5I29A 4QC1A 4O7EA 4Z93A 3UVXA 4YBSA 4O74A 3MXFA 4IOQA 5LKTA 5A5SA 3UVDA 2WP2A 4KV4A 4A9EA 2L5EA 5FFYA 1X0JA 5J0DA 3GG3A 5FH8A 5ACYA 5FB0A 5LVRA 5DFDA 4LYIA 5KTWA 2YELA 5FG4A 4UYDA 3JVMA 5F60A 3K2JA 5D3RA 5F61A 4BJXA 4WHUA 4QEWA 2GRCA 5DKHA 4O7FA 5IGLA 4O70A 4IR3A 5G4RA 5KU3A 4NQMA 5G4SA 2YW5A 4NS5A 5C4QA 4LZ2A 3QZTA 4DONA 2H60A 4YY6A 5A5QA 2LSPB 4QR5A 5ENEA 4O71A 5FB1A 3UV2A 4LYWA 4QSQA 4O72A 4CUQA 5DLZA 5CQ8A 5D24A 3UW9A 3O34A 2F6JA 5EWHA 3U5MA 3MB4A 3P1DA 4BHWA 4YATA 5CP5A 4CLBA 5ENIA 5CUAA 4MEPA 5CUEA 4HXOA 4XY9A 4QSPA 5JI8A 5E7DA 4QSRA 5HCLA 3IU5A 5FDZA 4LZSA 2YYNA 4QSXA 4HXSA 4PY6A 5ETDA 4QC3A 4YBTA 5E3DA 4A9NA 5F3AA 3O36A 5I80A 4HXMA 4QSTA 4BW2A 2WP1A 4OGJA 4A9LA 4F3IA 4YABA 5C85A 5CTLA 5LKZA 3Q2EA 2RO1A 3I3JA 4Q0OA 4IOOA 5EV9A 4HBYA 4NQNA 5F2PA 4CFLA 5JWMA 2YDWA 5H1VA 4QSUA 5AMEA 5F63A 5IGKA 4TU4A 5FE9A 3HMFA 2I8NA 3AQAA 5TCMA 4YH4A 4LRGA 4IORA 5HJCA 5CY9A 5DFBA 4LYSA 5IGMA 5I7YA 3G0LA 5F62A 5KHMA 4MENA 5EWDA 4TS8A 5E73A 5F25A 3U5JA 2N9GA 4J0RA 3LQIA 4ZC9A 4PTBA 2YEKA 4NRBA 5F5ZA 4O7BA 3U5NA 5IG6A 3IU6A 4MEQA 4NYWA 4FLPA 4J3IA 4YYJA 4YADA 5BT5A 5F1HA 2L84A 3U5LA 4A9FA 3LXJA 3QZVA 4Q0NA 5CZGA 5CRMA 5HLSA 3JVJA 4E96A 4TU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT3 A;  2DVV A;  2DVQ A;  4QNS A;  5F1L A;  4CL9 A;  5L8U A;  5EWC A;  3D7C A;  5DKC A;  5I83 A;  5LKX A;  4OUF A;  3LQH A;  4N4H A;  5C8G A;  5HEN A;  4TT2 A;  4GPJ A;  2E7N A;  4Z1S A;  4MR3 A;  4A9K A;  5BT4 A;  4CFK A;  5E9K A;  5EA1 A;  4UIU A;  4QZS A;  4O78 A;  4XUB A;  2I7K A;  4MR6 A;  4QEV A;  1F68 A;  4NUE A;  4CUU A;  4Z6I A;  5L8T A;  5AMF A;  5EPR A;  5LKU A;  5EPS A;  4OGI A;  5KTU A;  4IR4 A;  4NXJ A;  3MQM A;  5CS8 A;  5FBX A;  4A9H A;  4YH3 A;  3UVY A;  5TB6 A;  2DWW A;  4HBV A;  5I86 A;  1WUM A;  5E3G A;  4UIY A;  5FG6 A;  4IR6 A;  4QYL A;  5KTX A;  5ENJ A;  4WIV A;  5ENC A;  5FE6 A;  5FH6 A;  4O77 A;  2OO1 A;  5CQ3 A;  4UIZ A;  5DFC A;  2RS9 B;  5EWW A;  5HQ7 A;  5L97 A;  2D82 A;  2YQD A;  5FE2 A;  5HRW A;  5LJ0 A;  5FE7 A;  4MR5 A;  5IBN A;  5ENF A;  5FE5 A;  5L98 A;  5II2 A;  4YK0 A;  4BW3 A;  4QBM A;  4YBM A;  5EM3 A;  5A82 A;  5E9I A;  5AD3 A;  5DW1 A;  5L96 A;  5FE3 A;  3O33 A;  4ALG A;  5CQT A;  5E9Y A;  4QEU A;  4NUC A;  5CUG A;  2RI7 A;  3JVL A;  3Q2F A;  5FH7 A;  5COI A;  4TYL A;  1WUG A;  4TTE A;  4CUT A;  2FSA A;  5EPB A;  5FFW A;  4XYA A;  5D3J A;  4HBW A;  5FE8 A;  3DWY A;  2DAT A;  5ETB A;  2DVR A;  4TZ2 A;  2OSS A;  5IGN A;  5C87 A;  5HRX A;  2R0V A;  5DY7 A;  4MEO A;  5D3N A;  5LJ1 A;  4HXR A;  4ZQL A;  4XUA A;  4PCI A;  4UYF A;  3P1F A;  2RNX A;  3HMH A;  4QSS A;  4C67 A;  4YY4 A;  3SVG A;  4J0S A;  2YEM A;  4TZ8 A;  4QUU A;  5E0R A;  2L85 A;  4O75 A;  5D0C A;  3U5K A;  5L99 A;  5FFV A;  3SVH A;  4KCX A;  4HXK A;  4LR6 A;  2E7O A;  5H1U A;  5CUD A;  4PKL A;  5E9L A;  4UYE A;  4KV1 A;  5EU1 A;  5CQ6 A;  4LZR A;  5H85 A;  2KTB B;  4X2I A;  4UIT A;  5DBM A;  1N72 A;  5EIS A;  5CQ4 A;  2R0Y A;  5CQA A;  3DAI A;  3S92 A;  3U5O A;  5DYC A;  4CUP A;  4XY8 A;  2NXB A;  5HFQ A;  5DYX A;  2OUO A;  5I40 A;  3ZYU A;  3SVF A;  4YYM A;  5DYA A;  4A9O A;  4NR4 A;  4N3W A;  5CQ7 A;  1ZS5 A;  4A9M A;  3NXB A;  4ALH A;  5A83 A;  3LQJ A;  5EGU A;  5HEL A;  4IR5 A;  3P1C A;  3AAD A;  5HFR A;  5HRV A;  2E3K A;  5D7X A;  2DKW A;  5HEM A;  5IID A;  4UIW A;  5CUC A;  5A5N A;  5HM0 A;  5DX4 A;  4HXN A;  4O7A A;  3UVW A;  4NYX A;  5H1T A;  5E9V A;  1EQF A;  5CGP A;  3S91 A;  4NR6 A;  5II1 A;  5EVA A;  5D26 A;  5I7X A;  3LJW A;  4Z1Q A;  3QZS A;  3P5O A;  2F6N A;  3O37 A;  4NR7 A;  4C66 A;  3RCW A;  3O35 A;  5AD2 A;  5C7N A;  4QR4 A;  5A81 A;  4NRA A;  2RFJ A;  2RNW A;  4LDF A;  4NYV A;  1E6I A;  5EWV A;  3FKM X;  5A5O A;  5FE1 A;  5ENH A;  5DYU A;  4UIX A;  5A5P A;  2DVS A;  4YYK A;  4HXL A;  5D3P A;  5LUU A;  2D9E A;  4N4I A;  4LC2 A;  4BW4 A;  4A9J A;  4YYG A;  4CUS A;  5CRZ A;  5D3S A;  4O7C A;  5FE4 A;  5A7C A;  5EI4 A;  3JVK A;  3MUL A;  1JSP B;  4NR9 A;  5EIC A;  4QUT A;  4QYD A;  5E74 A;  4YYD A;  5D3T A;  5LJ2 A;  3U5P A;  5ENG A;  4TT4 A;  5I88 A;  4O76 A;  4NR5 A;  4ZW1 A;  2MJV B;  2R10 A;  4NR8 A;  1JM4 B;  4YYI A;  4Y03 A;  4YAX A;  5CPE A;  4A9I A;  5FG5 A;  3P1E A;  4NRC A;  5DKD A;  3MUK A;  4WHW A;  5E9M A;  5FE0 A;  4N4G A;  4YC9 A;  3UV4 A;  5D3H A;  5A85 A;  4PCE A;  5CQ5 A;  2G4A A;  2R0S A;  5DLX A;  3UV5 A;  4YYN A;  5I89 A;  5D3L A;  5EP7 A;  5CUB A;  5F36 A;  4YYH A;  3TLP A;  4RVR A;  4CUR A;  4QB3 A;  4UYG A;  5HQ5 A;  4UYF B;  5CU8 A;  5K29 A;  4NUD A;  4Z6H A;  4QY4 A;  4HBX A;  4QR3 A;  5KO4 A;  5C89 A;  5ENB A;  4PS5 A;  5D25 A;  5HQ6 A;  3MB3 A;  4TQN A;  4J1P A;  3HME A;  2RNY A;  4MR4 A;  3ONI A;  4UYH A;  4N4F A;  5LVQ A;  3G0J A;  4HXP A;  4QSV A;  4QSW A;  4BW1 A;  5A5R A;  5EK9 A;  5I1Q A;  4TT6 A;  4AKN A;  5DW2 A;  4UIV A;  5CFW A;  5EQ1 A;  5I29 A;  4QC1 A;  4O7E A;  4Z93 A;  3UVX A;  4YBS A;  4O74 A;  3MXF A;  4IOQ A;  5LKT A;  5A5S A;  3UVD A;  2WP2 A;  4KV4 A;  4A9E A;  2L5E A;  5FFY A;  1X0J A;  5J0D A;  3GG3 A;  5FH8 A;  5ACY A;  5FB0 A;  5LVR A;  5DFD A;  4LYI A;  5KTW A;  2YEL A;  5FG4 A;  4UYD A;  3JVM A;  5F60 A;  3K2J A;  5D3R A;  5F61 A;  4BJX A;  4WHU A;  4QEW A;  2GRC A;  5DKH A;  4O7F A;  5IGL A;  4O70 A;  4IR3 A;  5G4R A;  5KU3 A;  4NQM A;  5G4S A;  2YW5 A;  4NS5 A;  5C4Q A;  4LZ2 A;  3QZT A;  4DON A;  2H60 A;  4YY6 A;  5A5Q A;  2LSP B;  4QR5 A;  5ENE A;  4O71 A;  5FB1 A;  3UV2 A;  4LYW A;  4QSQ A;  4O72 A;  4CUQ A;  5DLZ A;  5CQ8 A;  5D24 A;  3UW9 A;  3O34 A;  2F6J A;  5EWH A;  3U5M A;  3MB4 A;  3P1D A;  4BHW A;  4YAT A;  5CP5 A;  4CLB A;  5ENI A;  5CUA A;  4MEP A;  5CUE A;  4HXO A;  4XY9 A;  4QSP A;  5JI8 A;  5E7D A;  4QSR A;  5HCL A;  3IU5 A;  5FDZ A;  4LZS A;  2YYN A;  4QSX A;  4HXS A;  4PY6 A;  5ETD A;  4QC3 A;  4YBT A;  5E3D A;  4A9N A;  5F3A A;  3O36 A;  5I80 A;  4HXM A;  4QST A;  4BW2 A;  2WP1 A;  4OGJ A;  4A9L A;  4F3I A;  4YAB A;  5C85 A;  5CTL A;  5LKZ A;  3Q2E A;  2RO1 A;  3I3J A;  4Q0O A;  4IOO A;  5EV9 A;  4HBY A;  4NQN A;  5F2P A;  4CFL A;  5JWM A;  2YDW A;  5H1V A;  4QSU A;  5AME A;  5F63 A;  5IGK A;  4TU4 A;  5FE9 A;  3HMF A;  2I8N A;  3AQA A;  5TCM A;  4YH4 A;  4LRG A;  4IOR A;  5HJC A;  5CY9 A;  5DFB A;  4LYS A;  5IGM A;  5I7Y A;  3G0L A;  5F62 A;  5KHM A;  4MEN A;  5EWD A;  4TS8 A;  5E73 A;  5F25 A;  3U5J A;  2N9G A;  4J0R A;  3LQI A;  4ZC9 A;  4PTB A;  2YEK A;  4NRB A;  5F5Z A;  4O7B A;  3U5N A;  5IG6 A;  3IU6 A;  4MEQ A;  4NYW A;  4FLP A;  4J3I A;  4YYJ A;  4YAD A;  5BT5 A;  5F1H A;  2L84 A;  3U5L A;  4A9F A;  3LXJ A;  3QZV A;  4Q0N A;  5CZG A;  5CRM A;  5HLS A;  3JVJ A;  4E96 A;  4TU6 A; 
#chains in the Genus database with same CATH topology
 5BT3 A;  2DVV A;  2DVQ A;  4QNS A;  5F1L A;  4CL9 A;  5L8U A;  5EWC A;  3D7C A;  5DKC A;  5I83 A;  5LKX A;  4OUF A;  3LQH A;  4N4H A;  5C8G A;  5HEN A;  4TT2 A;  4GPJ A;  2E7N A;  4Z1S A;  4MR3 A;  4A9K A;  5BT4 A;  4CFK A;  5E9K A;  5EA1 A;  4UIU A;  4QZS A;  4O78 A;  4XUB A;  2I7K A;  4MR6 A;  4QEV A;  1F68 A;  4NUE A;  4CUU A;  4Z6I A;  5L8T A;  5AMF A;  5EPR A;  5LKU A;  5EPS A;  4OGI A;  5KTU A;  4IR4 A;  4NXJ A;  3MQM A;  5CS8 A;  5FBX A;  4A9H A;  4YH3 A;  3UVY A;  5TB6 A;  2DWW A;  4HBV A;  5I86 A;  1WUM A;  5E3G A;  4UIY A;  5FG6 A;  4IR6 A;  4QYL A;  5KTX A;  5ENJ A;  4WIV A;  5ENC A;  5FE6 A;  5FH6 A;  4O77 A;  2OO1 A;  5CQ3 A;  4UIZ A;  5DFC A;  2RS9 B;  5EWW A;  5HQ7 A;  5L97 A;  2D82 A;  2YQD A;  5FE2 A;  5HRW A;  5LJ0 A;  5FE7 A;  4MR5 A;  5IBN A;  5ENF A;  5FE5 A;  5L98 A;  5II2 A;  4YK0 A;  4BW3 A;  4QBM A;  4YBM A;  5EM3 A;  5A82 A;  5E9I A;  5AD3 A;  5DW1 A;  5L96 A;  1ZKR A;  3O33 A;  5FE3 A;  4ALG A;  5CQT A;  5E9Y A;  4QEU A;  4NUC A;  5CUG A;  2RI7 A;  3JVL A;  3Q2F A;  5FH7 A;  5COI A;  4TYL A;  1WUG A;  4TTE A;  4CUT A;  2FSA A;  5EPB A;  5FFW A;  4XYA A;  3ERR A;  5D3J A;  4HBW A;  5FE8 A;  3DWY A;  2DAT A;  5ETB A;  2DVR A;  4TZ2 A;  2OSS A;  5IGN A;  5C87 A;  5HRX A;  2R0V A;  5DY7 A;  4MEO A;  3D1B A;  5D3N A;  5LJ1 A;  4HXR A;  4ZQL A;  4XUA A;  4PCI A;  4UYF A;  3P1F A;  2RNX A;  3HMH A;  4QSS A;  4C67 A;  4YY4 A;  3SVG A;  4J0S A;  2YEM A;  4TZ8 A;  4QUU A;  5E0R A;  2L85 A;  4O75 A;  5D0C A;  3U5K A;  5L99 A;  5FFV A;  3SVH A;  4KCX A;  4HXK A;  4LR6 A;  2E7O A;  5H1U A;  5CUD A;  4PKL A;  5E9L A;  4UYE A;  4KV1 A;  5EU1 A;  5CQ6 A;  4LZR A;  5H85 A;  2KTB B;  4X2I A;  4UIT A;  5DBM A;  1N72 A;  5EIS A;  5CQ4 A;  2R0Y A;  5CQA A;  3DAI A;  3S92 A;  3U5O A;  5DYC A;  4CUP A;  4XY8 A;  2NXB A;  5HFQ A;  5DYX A;  2OUO A;  5I40 A;  3ZYU A;  3SVF A;  4YYM A;  5DYA A;  4A9O A;  4NR4 A;  4N3W A;  5CQ7 A;  1ZS5 A;  4A9M A;  4AKH A;  3NXB A;  4ALH A;  5A83 A;  3LQJ A;  5EGU A;  5HEL A;  4IR5 A;  3P1C A;  3AAD A;  5HFR A;  5HRV A;  2E3K A;  5D7X A;  2DKW A;  5HEM A;  5IID A;  4UIW A;  5CUC A;  5A5N A;  5HM0 A;  5DX4 A;  4HXN A;  4O7A A;  3UVW A;  4NYX A;  5H1T A;  5E9V A;  1EQF A;  5CGP A;  3S91 A;  4NR6 A;  5II1 A;  5EVA A;  5D26 A;  5I7X A;  3LJW A;  4Z1Q A;  3QZS A;  3P5O A;  2EJN A;  2F6N A;  3O37 A;  3VKG A;  4NR7 A;  4C66 A;  3RCW A;  3O35 A;  5AD2 A;  5C7N A;  4QR4 A;  5A81 A;  4NRA A;  2RFJ A;  2RNW A;  4LDF A;  4NYV A;  1E6I A;  5EWV A;  3FKM X;  5A5O A;  5FE1 A;  5ENH A;  3D1D A;  4UIX A;  5DYU A;  5A5P A;  2DVS A;  4YYK A;  4HXL A;  5D3P A;  5LUU A;  2D9E A;  4N4I A;  4LC2 A;  4BW4 A;  4A9J A;  4YYG A;  4CUS A;  5CRZ A;  5D3S A;  4O7C A;  5FE4 A;  5A7C A;  5EI4 A;  3JVK A;  3MUL A;  1JSP B;  4NR9 A;  5EIC A;  4QUT A;  4QYD A;  5E74 A;  4YYD A;  5D3T A;  5LJ2 A;  3U5P A;  5ENG A;  4TT4 A;  5I88 A;  4O76 A;  4NR5 A;  4ZW1 A;  2MJV B;  2R10 A;  4NR8 A;  1JM4 B;  4YYI A;  4Y03 A;  4YAX A;  5CPE A;  4A9I A;  5FG5 A;  3P1E A;  4NRC A;  5DKD A;  3MUK A;  4WHW A;  5E9M A;  5FE0 A;  4AKI A;  4N4G A;  4YC9 A;  3UV4 A;  5D3H A;  5A85 A;  4PCE A;  5CQ5 A;  2G4A A;  2R0S A;  5DLX A;  3UV5 A;  4YYN A;  5I89 A;  5D3L A;  5EP7 A;  5CUB A;  5F36 A;  4YYH A;  3TLP A;  4RVR A;  4CUR A;  4QB3 A;  4UYG A;  5HQ5 A;  4UYF B;  5CU8 A;  5K29 A;  4AKG A;  4NUD A;  4Z6H A;  4QY4 A;  4HBX A;  4QR3 A;  5KO4 A;  5C89 A;  5ENB A;  4PS5 A;  5D25 A;  5HQ6 A;  3MB3 A;  3VKH A;  4TQN A;  4J1P A;  3HME A;  2RNY A;  4MR4 A;  3ONI A;  4UYH A;  4N4F A;  5LVQ A;  3G0J A;  4HXP A;  4QSV A;  4QSW A;  4BW1 A;  5A5R A;  5EK9 A;  5I1Q A;  4TT6 A;  4AKN A;  5DW2 A;  4UIV A;  5CFW A;  5EQ1 A;  5I29 A;  4QC1 A;  4O7E A;  4Z93 A;  3UVX A;  4YBS A;  4O74 A;  3MXF A;  4IOQ A;  5LKT A;  5A5S A;  3UVD A;  2WP2 A;  4KV4 A;  4A9E A;  2L5E A;  5FFY A;  1X0J A;  5J0D A;  3GG3 A;  5FH8 A;  5ACY A;  5FB0 A;  5LVR A;  5DFD A;  4LYI A;  5KTW A;  2YEL A;  5FG4 A;  4UYD A;  3JVM A;  5F60 A;  5D3R A;  3K2J A;  5F61 A;  4BJX A;  4WHU A;  4QEW A;  2GRC A;  5DKH A;  4O7F A;  5IGL A;  4O70 A;  4IR3 A;  5G4R A;  5KU3 A;  1PUO A;  4NQM A;  5G4S A;  2YW5 A;  4NS5 A;  5C4Q A;  4LZ2 A;  3QZT A;  4DON A;  2H60 A;  4YY6 A;  5A5Q A;  2LSP B;  4QR5 A;  5ENE A;  4O71 A;  5FB1 A;  3UV2 A;  4LYW A;  4QSQ A;  4O72 A;  4CUQ A;  5DLZ A;  5CQ8 A;  5D24 A;  3UW9 A;  3O34 A;  2F6J A;  5EWH A;  3U5M A;  3MB4 A;  3P1D A;  4BHW A;  4YAT A;  5CP5 A;  4CLB A;  5ENI A;  5CUA A;  4MEP A;  5CUE A;  4HXO A;  4XY9 A;  4QSP A;  5JI8 A;  5E7D A;  4QSR A;  5HCL A;  3IU5 A;  5FDZ A;  4LZS A;  2YYN A;  4QSX A;  4HXS A;  4PY6 A;  5ETD A;  4QC3 A;  4YBT A;  5E3D A;  4A9N A;  5F3A A;  3O36 A;  5I80 A;  4HXM A;  4QST A;  4BW2 A;  2WP1 A;  4OGJ A;  4A9L A;  4F3I A;  4YAB A;  5C85 A;  5CTL A;  5LKZ A;  3Q2E A;  2RO1 A;  3I3J A;  4Q0O A;  4IOO A;  5EV9 A;  4HBY A;  4NQN A;  5F2P A;  4CFL A;  5JWM A;  2YDW A;  5H1V A;  4QSU A;  5AME A;  5F63 A;  5IGK A;  4TU4 A;  5FE9 A;  3HMF A;  2I8N A;  3AQA A;  5TCM A;  4YH4 A;  4LRG A;  4IOR A;  5HJC A;  5CY9 A;  5DFB A;  4LYS A;  5IGM A;  5I7Y A;  3G0L A;  5F62 A;  5KHM A;  4MEN A;  5EWD A;  4TS8 A;  5E73 A;  5F25 A;  3U5J A;  2N9G A;  4J0R A;  3LQI A;  4ZC9 A;  4PTB A;  2YEK A;  4NRB A;  5F5Z A;  4O7B A;  3U5N A;  5IG6 A;  3IU6 A;  4MEQ A;  4NYW A;  4FLP A;  4J3I A;  4YYJ A;  4YAD A;  4AI6 A;  5BT5 A;  5F1H A;  2L84 A;  3U5L A;  4A9F A;  3LXJ A;  3QZV A;  4Q0N A;  5CZG A;  5CRM A;  5HLS A;  3JVJ A;  4E96 A;  4TU6 A; 
#chains in the Genus database with same CATH homology
 5BT3 A;  2DVV A;  2DVQ A;  4QNS A;  5F1L A;  4CL9 A;  5L8U A;  5EWC A;  3D7C A;  5DKC A;  5I83 A;  5LKX A;  4OUF A;  3LQH A;  4N4H A;  5C8G A;  5HEN A;  4TT2 A;  4GPJ A;  2E7N A;  4Z1S A;  4MR3 A;  4A9K A;  5BT4 A;  4CFK A;  5E9K A;  5EA1 A;  4UIU A;  4QZS A;  4O78 A;  4XUB A;  2I7K A;  4MR6 A;  4QEV A;  1F68 A;  4NUE A;  4CUU A;  4Z6I A;  5L8T A;  5AMF A;  5EPR A;  5LKU A;  5EPS A;  4OGI A;  5KTU A;  4IR4 A;  4NXJ A;  3MQM A;  5CS8 A;  5FBX A;  4A9H A;  4YH3 A;  3UVY A;  5TB6 A;  2DWW A;  4HBV A;  5I86 A;  1WUM A;  5E3G A;  4UIY A;  5FG6 A;  4IR6 A;  4QYL A;  5KTX A;  5ENJ A;  4WIV A;  5ENC A;  5FE6 A;  5FH6 A;  4O77 A;  2OO1 A;  5CQ3 A;  4UIZ A;  5DFC A;  2RS9 B;  5EWW A;  5HQ7 A;  5L97 A;  2D82 A;  2YQD A;  5FE2 A;  5HRW A;  5LJ0 A;  5FE7 A;  4MR5 A;  5IBN A;  5ENF A;  5FE5 A;  5L98 A;  5II2 A;  4YK0 A;  4BW3 A;  4QBM A;  4YBM A;  5EM3 A;  5A82 A;  5E9I A;  5AD3 A;  5DW1 A;  5L96 A;  5FE3 A;  3O33 A;  4ALG A;  5CQT A;  5E9Y A;  4QEU A;  4NUC A;  5CUG A;  2RI7 A;  3JVL A;  3Q2F A;  5FH7 A;  5COI A;  4TYL A;  1WUG A;  4TTE A;  4CUT A;  2FSA A;  5EPB A;  5FFW A;  4XYA A;  5D3J A;  4HBW A;  5FE8 A;  3DWY A;  2DAT A;  5ETB A;  2DVR A;  4TZ2 A;  2OSS A;  5IGN A;  5C87 A;  5HRX A;  2R0V A;  5DY7 A;  4MEO A;  5D3N A;  5LJ1 A;  4HXR A;  4ZQL A;  4XUA A;  4PCI A;  4UYF A;  3P1F A;  2RNX A;  3HMH A;  4QSS A;  4C67 A;  4YY4 A;  3SVG A;  4J0S A;  2YEM A;  4TZ8 A;  4QUU A;  5E0R A;  2L85 A;  4O75 A;  5D0C A;  3U5K A;  5L99 A;  5FFV A;  3SVH A;  4KCX A;  4HXK A;  4LR6 A;  2E7O A;  5H1U A;  5CUD A;  4PKL A;  5E9L A;  4UYE A;  4KV1 A;  5EU1 A;  5CQ6 A;  4LZR A;  5H85 A;  2KTB B;  4X2I A;  4UIT A;  5DBM A;  1N72 A;  5EIS A;  5CQ4 A;  2R0Y A;  5CQA A;  3DAI A;  3S92 A;  3U5O A;  5DYC A;  4CUP A;  4XY8 A;  2NXB A;  5HFQ A;  5DYX A;  2OUO A;  5I40 A;  3ZYU A;  3SVF A;  4YYM A;  5DYA A;  4A9O A;  4NR4 A;  4N3W A;  5CQ7 A;  1ZS5 A;  4A9M A;  3NXB A;  4ALH A;  5A83 A;  3LQJ A;  5EGU A;  5HEL A;  4IR5 A;  3P1C A;  3AAD A;  5HFR A;  5HRV A;  2E3K A;  5D7X A;  2DKW A;  5HEM A;  5IID A;  4UIW A;  5CUC A;  5A5N A;  5HM0 A;  5DX4 A;  4HXN A;  4O7A A;  3UVW A;  4NYX A;  5H1T A;  5E9V A;  1EQF A;  5CGP A;  3S91 A;  4NR6 A;  5II1 A;  5EVA A;  5D26 A;  5I7X A;  3LJW A;  4Z1Q A;  3QZS A;  3P5O A;  2F6N A;  3O37 A;  4NR7 A;  4C66 A;  3RCW A;  3O35 A;  5AD2 A;  5C7N A;  4QR4 A;  5A81 A;  4NRA A;  2RFJ A;  2RNW A;  4LDF A;  4NYV A;  1E6I A;  5EWV A;  3FKM X;  5A5O A;  5FE1 A;  5ENH A;  5DYU A;  4UIX A;  5A5P A;  2DVS A;  4YYK A;  4HXL A;  5D3P A;  5LUU A;  2D9E A;  4N4I A;  4LC2 A;  4BW4 A;  4A9J A;  4YYG A;  4CUS A;  5CRZ A;  5D3S A;  4O7C A;  5FE4 A;  5A7C A;  5EI4 A;  3JVK A;  3MUL A;  1JSP B;  4NR9 A;  5EIC A;  4QUT A;  4QYD A;  5E74 A;  4YYD A;  5D3T A;  5LJ2 A;  3U5P A;  5ENG A;  4TT4 A;  5I88 A;  4O76 A;  4NR5 A;  4ZW1 A;  2MJV B;  2R10 A;  4NR8 A;  1JM4 B;  4YYI A;  4Y03 A;  4YAX A;  5CPE A;  4A9I A;  5FG5 A;  3P1E A;  4NRC A;  5DKD A;  3MUK A;  4WHW A;  5E9M A;  5FE0 A;  4N4G A;  4YC9 A;  3UV4 A;  5D3H A;  5A85 A;  4PCE A;  5CQ5 A;  2G4A A;  2R0S A;  5DLX A;  3UV5 A;  4YYN A;  5I89 A;  5D3L A;  5EP7 A;  5CUB A;  5F36 A;  4YYH A;  3TLP A;  4RVR A;  4CUR A;  4QB3 A;  4UYG A;  5HQ5 A;  4UYF B;  5CU8 A;  5K29 A;  4NUD A;  4Z6H A;  4QY4 A;  4HBX A;  4QR3 A;  5KO4 A;  5C89 A;  5ENB A;  4PS5 A;  5D25 A;  5HQ6 A;  3MB3 A;  4TQN A;  4J1P A;  3HME A;  2RNY A;  4MR4 A;  3ONI A;  4UYH A;  4N4F A;  5LVQ A;  3G0J A;  4HXP A;  4QSV A;  4QSW A;  4BW1 A;  5A5R A;  5EK9 A;  5I1Q A;  4TT6 A;  4AKN A;  5DW2 A;  4UIV A;  5CFW A;  5EQ1 A;  5I29 A;  4QC1 A;  4O7E A;  4Z93 A;  3UVX A;  4YBS A;  4O74 A;  3MXF A;  4IOQ A;  5LKT A;  5A5S A;  3UVD A;  2WP2 A;  4KV4 A;  4A9E A;  2L5E A;  5FFY A;  1X0J A;  5J0D A;  3GG3 A;  5FH8 A;  5ACY A;  5FB0 A;  5LVR A;  5DFD A;  4LYI A;  5KTW A;  2YEL A;  5FG4 A;  4UYD A;  3JVM A;  5F60 A;  3K2J A;  5D3R A;  5F61 A;  4BJX A;  4WHU A;  4QEW A;  2GRC A;  5DKH A;  4O7F A;  5IGL A;  4O70 A;  4IR3 A;  5G4R A;  5KU3 A;  4NQM A;  5G4S A;  2YW5 A;  4NS5 A;  5C4Q A;  4LZ2 A;  3QZT A;  4DON A;  2H60 A;  4YY6 A;  5A5Q A;  2LSP B;  4QR5 A;  5ENE A;  4O71 A;  5FB1 A;  3UV2 A;  4LYW A;  4QSQ A;  4O72 A;  4CUQ A;  5DLZ A;  5CQ8 A;  5D24 A;  3UW9 A;  3O34 A;  2F6J A;  5EWH A;  3U5M A;  3MB4 A;  3P1D A;  4BHW A;  4YAT A;  5CP5 A;  4CLB A;  5ENI A;  5CUA A;  4MEP A;  5CUE A;  4HXO A;  4XY9 A;  4QSP A;  5JI8 A;  5E7D A;  4QSR A;  5HCL A;  3IU5 A;  5FDZ A;  4LZS A;  2YYN A;  4QSX A;  4HXS A;  4PY6 A;  5ETD A;  4QC3 A;  4YBT A;  5E3D A;  4A9N A;  5F3A A;  3O36 A;  5I80 A;  4HXM A;  4QST A;  4BW2 A;  2WP1 A;  4OGJ A;  4A9L A;  4F3I A;  4YAB A;  5C85 A;  5CTL A;  5LKZ A;  3Q2E A;  2RO1 A;  3I3J A;  4Q0O A;  4IOO A;  5EV9 A;  4HBY A;  4NQN A;  5F2P A;  4CFL A;  5JWM A;  2YDW A;  5H1V A;  4QSU A;  5AME A;  5F63 A;  5IGK A;  4TU4 A;  5FE9 A;  3HMF A;  2I8N A;  3AQA A;  5TCM A;  4YH4 A;  4LRG A;  4IOR A;  5HJC A;  5CY9 A;  5DFB A;  4LYS A;  5IGM A;  5I7Y A;  3G0L A;  5F62 A;  5KHM A;  4MEN A;  5EWD A;  4TS8 A;  5E73 A;  5F25 A;  3U5J A;  2N9G A;  4J0R A;  3LQI A;  4ZC9 A;  4PTB A;  2YEK A;  4NRB A;  5F5Z A;  4O7B A;  3U5N A;  5IG6 A;  3IU6 A;  4MEQ A;  4NYW A;  4FLP A;  4J3I A;  4YYJ A;  4YAD A;  5BT5 A;  5F1H A;  2L84 A;  3U5L A;  4A9F A;  3LXJ A;  3QZV A;  4Q0N A;  5CZG A;  5CRM A;  5HLS A;  3JVJ A;  4E96 A;  4TU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...