5FG6A

Crystal structure of the bromodomain of human brd1 (brpf2) in complex with of-1 chemical probe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
RLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 1
publication title Crystal structure of the bromodomain of human BRD1 (BRPF2) in complex with OF-1 chemical probe
rcsb
source organism Homo sapiens
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fg6A00
5LUUA 4KV1A 2R0VA 4A9KA 5CUBA 5CQ6A 4LC2A 5FDZA 4C67A 4A9JA 5A7CA 5G4SA 4GPJA 2RFJA 5F1HA 4TT4A 5KTXA 5HENA 1WUMA 2DWWA 4PCIA 4QUUA 5FE4A 3TLPA 2GRCA 3SVFA 5I7YA 2N9GA 4Y03A 5EI4A 4YYKA 2KTBB 3U5OA 5HEMA 3MXFA 4NR8A 5EWCA 4QNSA 4NQNA 4OUFA 5A85A 4BW2A 3AQAA 5L98A 4HBVA 5I29A 5F2PA 4XYAA 5EA1A 4CLBA 4OGIA 4LDFA 4UIZA 4YAXA 4Q0NA 5DX4A 5KU3A 4NXJA 2RS9B 5D3LA 4UIXA 5CUAA 4O75A 5I83A 2G4AA 2DVVA 5IG6A 4HXPA 3K2JA 4RVRA 4UYFB 3UV5A 5A82A 3FKMX 4HXOA 3HMHA 5DKCA 5CFWA 4MR5A 4HBXA 2YELA 4O71A 4YY6A 4CL9A 4KV4A 4QSTA 5FH6A 5FFVA 4TZ8A 5FFWA 3LQIA 4YYIA 5EWVA 5HQ6A 4TS8A 5J0DA 4BW3A 5ENCA 4HXNA 5E74A 1F68A 5E73A 4YYGA 4XUBA 3DAIA 5HFRA 5FE0A 3MB3A 3O37A 5EU1A 5F1LA 5II1A 4A9NA 5LKXA 4X2IA 4NUDA 5FG6A 5E9MA 5AD2A 5CQ4A 3MULA 4UIVA 3U5LA 1JM4B 2DVQA 5IGMA 2I8NA 3LQHA 5DKHA 2YYNA 1X0JA 1E6IA 4QR3A 4TYLA 5DW2A 4HBYA 2I7KA 3LXJA 2RO1A 3DWYA 2DVSA 3O35A 2F6JA 5FE9A 3O33A 3I3JA 4UYFA 4QEUA 4PCEA 4YABA 4O70A 5D24A 5IGKA 4AKNA 5LVRA 5HJCA 4Z6IA 4O74A 4N4IA 4IORA 5ENEA 5FE6A 5DFBA 5FE2A 4YBMA 3S92A 5CUEA 4OGJA 4NRCA 4TT2A 5KTWA 2WP1A 5I89A 5LKTA 4QR4A 4QSPA 4MEOA 5IGLA 3QZVA 5E9IA 5I88A 4QC3A 5F60A 5EWHA 2FSAA 4YYHA 4TTEA 2DVRA 5C87A 2D9EA 5H85A 3UVXA 5EWDA 1WUGA 4N3WA 5LJ2A 5E3DA 5TB6A 4XY9A 5JWMA 4BW4A 3JVKA 4NYWA 2E7NA 4LYWA 5ENGA 4ZQLA 5F63A 5ETBA 4J0RA 5I7XA 5C4QA 5HCLA 5EM3A 4Z1QA 5K29A 4QSSA 5KTUA 4WIVA 5FFYA 5F36A 5DYCA 4NR7A 4O76A 5A81A 5D0CA 3MQMA 5ENHA 3P1EA 5HELA 4QEVA 4ALHA 5EGUA 5CRZA 4IR5A 4N4HA 5C89A 5D26A 5CQAA 3LJWA 5FBXA 5I80A 4HBWA 3Q2EA 4IOOA 4TT6A 4A9EA 4LZSA 5BT5A 5HM0A 4A9LA 2OSSA 4QYLA 2L5EA 5CUCA 5D3PA 5G4RA 4O72A 5H1TA 5LKZA 4NYVA 3P1CA 4LRGA 1JSPB 3RCWA 5CZGA 5BT3A 4QSVA 5EWWA 4MEQA 2RNWA 2YDWA 4TQNA 4MR3A 5DW1A 5HRVA 3G0JA 5DYXA 4F3IA 5L97A 5A5OA 5A5RA 5F5ZA 4CUPA 3U5MA 3QZTA 2MJVB 4UIWA 4DONA 5D7XA 4IR3A 5EQ1A 3UVWA 5LJ1A 4A9OA 4UYDA 5E7DA 2LSPB 5ENIA 5L8UA 5CTLA 5A5PA 2OO1A 4MR6A 4YADA 5DBMA 2DKWA 2E3KA 4QSRA 5FE3A 3IU5A 4NR5A 3HMEA 4N4GA 5HFQA 4J0SA 5A83A 4IR4A 4YYJA 4HXKA 4YC9A 5E9YA 4A9FA 4XY8A 5COIA 4TU4A 4YYNA 3O34A 4QSQA 4UYEA 4BJXA 4QY4A 2R0SA 2YEKA 4TZ2A 5AD3A 5EVAA 4QUTA 2RNYA 5AMFA 3JVLA 4BHWA 4KCXA 4J3IA 5CQ3A 1ZS5A 5HQ7A 5JI8A 4CUQA 5EPBA 5KHMA 5DLZA 5FB0A 5FH8A 4UIYA 4CFLA 5A5SA 3QZSA 4LZRA 4NS5A 5FB1A 4NR9A 2DATA 4QSWA 5C8GA 5CS8A 2RI7A 5AMEA 5CY9A 4UYHA 5DFCA 5CPEA 4Z6HA 3JVMA 5ENJA 5CRMA 5F3AA 4UYGA 4QZSA 2D82A 5LJ0A 5H1UA 5D3JA 4UITA 4PS5A 5I40A 5ENFA 5FH7A 4BW1A 5E9KA 5F25A 4IOQA 4O7FA 5DYAA 3SVGA 4YH3A 4YH4A 5FG4A 4PY6A 5A5QA 5HLSA 5F61A 1EQFA 5I1QA 4NRBA 5L96A 4PTBA 5E9VA 5ETDA 4E96A 5A5NA 4FLPA 3UV4A 3LQJA 5D3HA 5D3SA 4CURA 5EICA 3SVHA 5CQTA 5I86A 4WHUA 5EPSA 4YYDA 3JVJA 2L84A 2YW5A 5L99A 4QEWA 4IR6A 5DFDA 4O78A 4HXRA 3D7CA 3NXBA 4HXLA 1N72A 4MR4A 4N4FA 4Z93A 5D3TA 4TU6A 5EPRA 3U5KA 2L85A 4LR6A 4LYSA 3HMFA 5CU8A 2WP2A 3ONIA 4O7BA 4QC1A 4O7AA 4J1PA 3U5JA 5L8TA 5LKUA 5BT4A 3U5PA 3MB4A 3GG3A 3Q2FA 5DYUA 5FE7A 3O36A 4NYXA 4C66A 4LYIA 5IIDA 2NXBA 5IBNA 4Q0OA 4ZW1A 5EP7A 2YQDA 2H60A 3AADA 5E9LA 3UW9A 5LVQA 5II2A 4ALGA 4QBMA 4YY4A 4O7EA 3U5NA 5C85A 4HXMA 5F62A 5HRXA 3S91A 4NR4A 4CFKA 4XUAA 5CQ8A 4O7CA 3IU6A 3UVYA 2RNXA 3P1DA 2OUOA 2YEMA 3P1FA 5FE1A 3UV2A 5CP5A 4QB3A 5TCMA 3UVDA 4LZ2A 4A9MA 4NQMA 5HQ5A 5D25A 4PKLA 3ZYUA 5D3NA 5FE5A 5EK9A 4CUSA 5CUDA 5ACYA 5CQ7A 4NRAA 5FG5A 2R10A 4Z1SA 3G0LA 4QSUA 2F6NA 4NUCA 4NUEA 5CUGA 5H1VA 5DKDA 5D3RA 4QR5A 2E7OA 4YBSA 3MUKA 3P5OA 5DY7A 4ZC9A 5CQ5A 4O77A 4CUTA 5HRWA 4YK0A 5E3GA 4A9IA 5EISA 5ENBA 5CGPA 5FE8A 4WHWA 4MENA 5KO4A 5DLXA 4A9HA 5IGNA 4QSXA 4YATA 4UIUA 4QYDA 4HXSA 5EV9A 4NR6A 5E0RA 4MEPA 5C7NA 4YBTA 4YYMA 2R0YA 4CUUA
chains in the Genus database with same CATH superfamily
5LUUA 4KV1A 2R0VA 4A9KA 5CUBA 5CQ6A 4LC2A 5FDZA 4C67A 4A9JA 5A7CA 5G4SA 4GPJA 2RFJA 5F1HA 4TT4A 5KTXA 5HENA 1WUMA 2DWWA 4PCIA 4QUUA 5FE4A 3TLPA 2GRCA 3SVFA 5I7YA 2N9GA 4Y03A 5EI4A 4YYKA 2KTBB 3U5OA 5HEMA 3MXFA 4NR8A 5EWCA 4QNSA 4NQNA 4OUFA 5A85A 4BW2A 3AQAA 5L98A 4HBVA 5I29A 5F2PA 4XYAA 5EA1A 4CLBA 4OGIA 4LDFA 4UIZA 4YAXA 4Q0NA 5DX4A 5KU3A 4NXJA 2RS9B 5D3LA 4UIXA 5CUAA 4O75A 5I83A 2G4AA 2DVVA 5IG6A 4HXPA 3K2JA 4RVRA 4UYFB 3UV5A 5A82A 3FKMX 4HXOA 3HMHA 5DKCA 5CFWA 4MR5A 4HBXA 2YELA 4O71A 4YY6A 4CL9A 2EJNA 4KV4A 4QSTA 5FH6A 5FFVA 4TZ8A 5FFWA 3LQIA 4YYIA 5EWVA 5HQ6A 4TS8A 5J0DA 4BW3A 5ENCA 4HXNA 5E74A 1F68A 5E73A 4YYGA 4XUBA 3DAIA 5HFRA 5FE0A 3MB3A 3D1BA 3O37A 5EU1A 5F1LA 5II1A 4A9NA 5LKXA 4X2IA 4NUDA 5FG6A 5E9MA 5AD2A 5CQ4A 3MULA 4UIVA 3U5LA 1JM4B 2DVQA 5IGMA 2I8NA 3LQHA 5DKHA 2YYNA 1X0JA 1E6IA 4QR3A 4TYLA 5DW2A 4HBYA 2I7KA 3LXJA 2RO1A 3DWYA 2DVSA 3O35A 2F6JA 5FE9A 3O33A 3I3JA 4UYFA 4QEUA 4PCEA 4YABA 4O70A 5D24A 5IGKA 4AKNA 5LVRA 5HJCA 4Z6IA 4O74A 4N4IA 4IORA 5ENEA 5FE6A 1ZKRA 5DFBA 5FE2A 4YBMA 3S92A 5CUEA 4OGJA 4NRCA 4TT2A 5KTWA 2WP1A 5I89A 5LKTA 4QR4A 4QSPA 3D1DA 4MEOA 5IGLA 3QZVA 5E9IA 5I88A 4QC3A 5F60A 5EWHA 2FSAA 4YYHA 4TTEA 2DVRA 5C87A 2D9EA 5H85A 3UVXA 5EWDA 1WUGA 4N3WA 5LJ2A 5E3DA 4AI6A 5TB6A 4XY9A 5JWMA 4BW4A 3JVKA 4NYWA 2E7NA 4LYWA 5ENGA 4ZQLA 5F63A 5ETBA 4J0RA 5I7XA 5C4QA 5HCLA 5EM3A 4Z1QA 5K29A 4QSSA 5KTUA 4WIVA 5FFYA 5F36A 5DYCA 4NR7A 4O76A 5A81A 5D0CA 3MQMA 5ENHA 3P1EA 5HELA 4AKGA 4QEVA 4ALHA 5EGUA 5CRZA 4IR5A 4N4HA 5C89A 5D26A 5CQAA 3LJWA 5FBXA 5I80A 4HBWA 3Q2EA 4IOOA 4TT6A 4A9EA 4LZSA 5BT5A 4AKIA 5HM0A 4A9LA 2OSSA 4QYLA 2L5EA 5CUCA 5D3PA 5G4RA 4O72A 5H1TA 5LKZA 4NYVA 3P1CA 4LRGA 1JSPB 3RCWA 5CZGA 5BT3A 4QSVA 5EWWA 4MEQA 2RNWA 2YDWA 4TQNA 4MR3A 5DW1A 5HRVA 3G0JA 5DYXA 4F3IA 5L97A 5A5OA 5A5RA 5F5ZA 4CUPA 3U5MA 3QZTA 2MJVB 4UIWA 4DONA 5D7XA 4IR3A 5EQ1A 3UVWA 5LJ1A 4A9OA 4UYDA 5E7DA 2LSPB 5ENIA 5L8UA 5CTLA 5A5PA 2OO1A 4MR6A 1PUOA 4YADA 5DBMA 2DKWA 2E3KA 4QSRA 5FE3A 3IU5A 4NR5A 3HMEA 4N4GA 5HFQA 4J0SA 5A83A 4IR4A 4YYJA 4HXKA 4YC9A 5E9YA 4A9FA 4XY8A 5COIA 4TU4A 4YYNA 3O34A 4QSQA 4UYEA 4BJXA 4QY4A 2R0SA 2YEKA 4TZ2A 5AD3A 5EVAA 4QUTA 2RNYA 5AMFA 3JVLA 4BHWA 4KCXA 4J3IA 5CQ3A 1ZS5A 5HQ7A 5JI8A 4CUQA 5EPBA 5KHMA 5DLZA 5FB0A 5FH8A 4UIYA 4CFLA 5A5SA 3QZSA 4LZRA 4NS5A 5FB1A 4NR9A 2DATA 4QSWA 5C8GA 5CS8A 2RI7A 5AMEA 5CY9A 4UYHA 5DFCA 5CPEA 4Z6HA 3ERRA 3JVMA 5ENJA 5CRMA 5F3AA 4UYGA 4QZSA 2D82A 5LJ0A 5H1UA 5D3JA 4UITA 4PS5A 5I40A 5ENFA 5FH7A 4BW1A 5E9KA 5F25A 4IOQA 4O7FA 5DYAA 3SVGA 4YH3A 4YH4A 5FG4A 4PY6A 5A5QA 5HLSA 5F61A 1EQFA 5I1QA 4NRBA 5L96A 4PTBA 5E9VA 5ETDA 4E96A 5A5NA 4FLPA 3UV4A 3LQJA 5D3HA 5D3SA 4CURA 5EICA 3SVHA 5CQTA 5I86A 4WHUA 5EPSA 4YYDA 3JVJA 2L84A 2YW5A 5L99A 4QEWA 4IR6A 5DFDA 4O78A 4HXRA 3D7CA 3NXBA 4HXLA 1N72A 4MR4A 4N4FA 4Z93A 5D3TA 4TU6A 5EPRA 3U5KA 2L85A 4LR6A 4LYSA 3HMFA 5CU8A 2WP2A 3ONIA 4O7BA 4QC1A 4O7AA 4J1PA 3U5JA 5L8TA 5LKUA 5BT4A 3U5PA 3MB4A 3GG3A 3Q2FA 5DYUA 5FE7A 3O36A 4NYXA 4C66A 4LYIA 5IIDA 2NXBA 5IBNA 4Q0OA 4ZW1A 5EP7A 2YQDA 2H60A 3AADA 5E9LA 3UW9A 5LVQA 5II2A 4ALGA 4QBMA 4YY4A 4O7EA 3U5NA 5C85A 4HXMA 5F62A 5HRXA 3S91A 4NR4A 4CFKA 4XUAA 5CQ8A 3VKHA 4O7CA 3IU6A 3UVYA 2RNXA 3P1DA 2OUOA 2YEMA 3P1FA 5FE1A 3UV2A 5CP5A 4QB3A 5TCMA 3UVDA 4LZ2A 4A9MA 4NQMA 5HQ5A 5D25A 4PKLA 3ZYUA 5D3NA 5FE5A 5EK9A 4CUSA 5CUDA 5ACYA 5CQ7A 4NRAA 5FG5A 2R10A 4Z1SA 3G0LA 4QSUA 2F6NA 4NUCA 4NUEA 3VKGA 5CUGA 5H1VA 5DKDA 5D3RA 4QR5A 2E7OA 4YBSA 3MUKA 3P5OA 5DY7A 4ZC9A 5CQ5A 4O77A 4CUTA 5HRWA 4AKHA 4YK0A 5E3GA 4A9IA 5EISA 5ENBA 5CGPA 5FE8A 4WHWA 4MENA 5KO4A 5DLXA 4A9HA 5IGNA 4QSXA 4YATA 4UIUA 4QYDA 4HXSA 5EV9A 4NR6A 5E0RA 4MEPA 5C7NA 4YBTA 4YYMA 2R0YA 4CUUA
chains in the Genus database with same CATH topology
5LUUA 4KV1A 2R0VA 4A9KA 5CUBA 5CQ6A 4LC2A 5FDZA 4C67A 4A9JA 5A7CA 5G4SA 4GPJA 2RFJA 5F1HA 4TT4A 5KTXA 5HENA 1WUMA 2DWWA 4PCIA 4QUUA 5FE4A 3TLPA 2GRCA 3SVFA 5I7YA 2N9GA 4Y03A 5EI4A 4YYKA 2KTBB 3U5OA 5HEMA 3MXFA 4NR8A 5EWCA 4QNSA 4NQNA 4OUFA 5A85A 4BW2A 3AQAA 5L98A 4HBVA 5I29A 5F2PA 4XYAA 5EA1A 4CLBA 4OGIA 4LDFA 4UIZA 4YAXA 4Q0NA 5DX4A 5KU3A 4NXJA 2RS9B 5D3LA 4UIXA 5CUAA 4O75A 5I83A 2G4AA 2DVVA 5IG6A 4HXPA 3K2JA 4RVRA 4UYFB 3UV5A 5A82A 3FKMX 4HXOA 3HMHA 5DKCA 5CFWA 4MR5A 4HBXA 2YELA 4O71A 4YY6A 4CL9A 4KV4A 4QSTA 5FH6A 5FFVA 4TZ8A 5FFWA 3LQIA 4YYIA 5EWVA 5HQ6A 4TS8A 5J0DA 4BW3A 5ENCA 4HXNA 5E74A 1F68A 5E73A 4YYGA 4XUBA 3DAIA 5HFRA 5FE0A 3MB3A 3O37A 5EU1A 5F1LA 5II1A 4A9NA 5LKXA 4X2IA 4NUDA 5FG6A 5E9MA 5AD2A 5CQ4A 3MULA 4UIVA 3U5LA 1JM4B 2DVQA 5IGMA 2I8NA 3LQHA 5DKHA 2YYNA 1X0JA 1E6IA 4QR3A 4TYLA 5DW2A 4HBYA 2I7KA 3LXJA 2RO1A 3DWYA 2DVSA 3O35A 2F6JA 5FE9A 3O33A 3I3JA 4UYFA 4QEUA 4PCEA 4YABA 4O70A 5D24A 5IGKA 4AKNA 5LVRA 5HJCA 4Z6IA 4O74A 4N4IA 4IORA 5ENEA 5FE6A 5DFBA 5FE2A 4YBMA 3S92A 5CUEA 4OGJA 4NRCA 4TT2A 5KTWA 2WP1A 5I89A 5LKTA 4QR4A 4QSPA 4MEOA 5IGLA 3QZVA 5E9IA 5I88A 4QC3A 5F60A 5EWHA 2FSAA 4YYHA 4TTEA 2DVRA 5C87A 2D9EA 5H85A 3UVXA 5EWDA 1WUGA 4N3WA 5LJ2A 5E3DA 5TB6A 4XY9A 5JWMA 4BW4A 3JVKA 4NYWA 2E7NA 4LYWA 5ENGA 4ZQLA 5F63A 5ETBA 4J0RA 5I7XA 5C4QA 5HCLA 5EM3A 4Z1QA 5K29A 4QSSA 5KTUA 4WIVA 5FFYA 5F36A 5DYCA 4NR7A 4O76A 5A81A 5D0CA 3MQMA 5ENHA 3P1EA 5HELA 4QEVA 4ALHA 5EGUA 5CRZA 4IR5A 4N4HA 5C89A 5D26A 5CQAA 3LJWA 5FBXA 5I80A 4HBWA 3Q2EA 4IOOA 4TT6A 4A9EA 4LZSA 5BT5A 5HM0A 4A9LA 2OSSA 4QYLA 2L5EA 5CUCA 5D3PA 5G4RA 4O72A 5H1TA 5LKZA 4NYVA 3P1CA 4LRGA 1JSPB 3RCWA 5CZGA 5BT3A 4QSVA 5EWWA 4MEQA 2RNWA 2YDWA 4TQNA 4MR3A 5DW1A 5HRVA 3G0JA 5DYXA 4F3IA 5L97A 5A5OA 5A5RA 5F5ZA 4CUPA 3U5MA 3QZTA 2MJVB 4UIWA 4DONA 5D7XA 4IR3A 5EQ1A 3UVWA 5LJ1A 4A9OA 4UYDA 5E7DA 2LSPB 5ENIA 5L8UA 5CTLA 5A5PA 2OO1A 4MR6A 4YADA 5DBMA 2DKWA 2E3KA 4QSRA 5FE3A 3IU5A 4NR5A 3HMEA 4N4GA 5HFQA 4J0SA 5A83A 4IR4A 4YYJA 4HXKA 4YC9A 5E9YA 4A9FA 4XY8A 5COIA 4TU4A 4YYNA 3O34A 4QSQA 4UYEA 4BJXA 4QY4A 2R0SA 2YEKA 4TZ2A 5AD3A 5EVAA 4QUTA 2RNYA 5AMFA 3JVLA 4BHWA 4KCXA 4J3IA 5CQ3A 1ZS5A 5HQ7A 5JI8A 4CUQA 5EPBA 5KHMA 5DLZA 5FB0A 5FH8A 4UIYA 4CFLA 5A5SA 3QZSA 4LZRA 4NS5A 5FB1A 4NR9A 2DATA 4QSWA 5C8GA 5CS8A 2RI7A 5AMEA 5CY9A 4UYHA 5DFCA 5CPEA 4Z6HA 3JVMA 5ENJA 5CRMA 5F3AA 4UYGA 4QZSA 2D82A 5LJ0A 5H1UA 5D3JA 4UITA 4PS5A 5I40A 5ENFA 5FH7A 4BW1A 5E9KA 5F25A 4IOQA 4O7FA 5DYAA 3SVGA 4YH3A 4YH4A 5FG4A 4PY6A 5A5QA 5HLSA 5F61A 1EQFA 5I1QA 4NRBA 5L96A 4PTBA 5E9VA 5ETDA 4E96A 5A5NA 4FLPA 3UV4A 3LQJA 5D3HA 5D3SA 4CURA 5EICA 3SVHA 5CQTA 5I86A 4WHUA 5EPSA 4YYDA 3JVJA 2L84A 2YW5A 5L99A 4QEWA 4IR6A 5DFDA 4O78A 4HXRA 3D7CA 3NXBA 4HXLA 1N72A 4MR4A 4N4FA 4Z93A 5D3TA 4TU6A 5EPRA 3U5KA 2L85A 4LR6A 4LYSA 3HMFA 5CU8A 2WP2A 3ONIA 4O7BA 4QC1A 4O7AA 4J1PA 3U5JA 5L8TA 5LKUA 5BT4A 3U5PA 3MB4A 3GG3A 3Q2FA 5DYUA 5FE7A 3O36A 4NYXA 4C66A 4LYIA 5IIDA 2NXBA 5IBNA 4Q0OA 4ZW1A 5EP7A 2YQDA 2H60A 3AADA 5E9LA 3UW9A 5LVQA 5II2A 4ALGA 4QBMA 4YY4A 4O7EA 3U5NA 5C85A 4HXMA 5F62A 5HRXA 3S91A 4NR4A 4CFKA 4XUAA 5CQ8A 4O7CA 3IU6A 3UVYA 2RNXA 3P1DA 2OUOA 2YEMA 3P1FA 5FE1A 3UV2A 5CP5A 4QB3A 5TCMA 3UVDA 4LZ2A 4A9MA 4NQMA 5HQ5A 5D25A 4PKLA 3ZYUA 5D3NA 5FE5A 5EK9A 4CUSA 5CUDA 5ACYA 5CQ7A 4NRAA 5FG5A 2R10A 4Z1SA 3G0LA 4QSUA 2F6NA 4NUCA 4NUEA 5CUGA 5H1VA 5DKDA 5D3RA 4QR5A 2E7OA 4YBSA 3MUKA 3P5OA 5DY7A 4ZC9A 5CQ5A 4O77A 4CUTA 5HRWA 4YK0A 5E3GA 4A9IA 5EISA 5ENBA 5CGPA 5FE8A 4WHWA 4MENA 5KO4A 5DLXA 4A9HA 5IGNA 4QSXA 4YATA 4UIUA 4QYDA 4HXSA 5EV9A 4NR6A 5E0RA 4MEPA 5C7NA 4YBTA 4YYMA 2R0YA 4CUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LUU A;  4KV1 A;  2R0V A;  4A9K A;  5CUB A;  5CQ6 A;  4LC2 A;  5FDZ A;  4C67 A;  4A9J A;  5A7C A;  5G4S A;  4GPJ A;  2RFJ A;  5F1H A;  4TT4 A;  5KTX A;  5HEN A;  1WUM A;  2DWW A;  4PCI A;  4QUU A;  5FE4 A;  3TLP A;  2GRC A;  3SVF A;  5I7Y A;  2N9G A;  4Y03 A;  5EI4 A;  4YYK A;  2KTB B;  3U5O A;  5HEM A;  3MXF A;  4NR8 A;  5EWC A;  4QNS A;  4NQN A;  4OUF A;  5A85 A;  4BW2 A;  3AQA A;  5L98 A;  4HBV A;  5I29 A;  5F2P A;  4XYA A;  5EA1 A;  4CLB A;  4OGI A;  4LDF A;  4UIZ A;  4YAX A;  4Q0N A;  5DX4 A;  5KU3 A;  4NXJ A;  2RS9 B;  5D3L A;  4UIX A;  5CUA A;  4O75 A;  5I83 A;  2G4A A;  2DVV A;  5IG6 A;  4HXP A;  3K2J A;  4RVR A;  4UYF B;  3UV5 A;  5A82 A;  3FKM X;  4HXO A;  3HMH A;  5DKC A;  5CFW A;  4MR5 A;  4HBX A;  2YEL A;  4O71 A;  4YY6 A;  4CL9 A;  4KV4 A;  4QST A;  5FH6 A;  5FFV A;  4TZ8 A;  5FFW A;  3LQI A;  4YYI A;  5EWV A;  5HQ6 A;  4TS8 A;  5J0D A;  4BW3 A;  5ENC A;  4HXN A;  5E74 A;  1F68 A;  5E73 A;  4YYG A;  4XUB A;  3DAI A;  5HFR A;  5FE0 A;  3MB3 A;  3O37 A;  5EU1 A;  5F1L A;  5II1 A;  4A9N A;  5LKX A;  4X2I A;  4NUD A;  5FG6 A;  5E9M A;  5AD2 A;  5CQ4 A;  3MUL A;  4UIV A;  3U5L A;  1JM4 B;  2DVQ A;  5IGM A;  2I8N A;  3LQH A;  5DKH A;  2YYN A;  1X0J A;  1E6I A;  4QR3 A;  4TYL A;  5DW2 A;  4HBY A;  2I7K A;  3LXJ A;  2RO1 A;  3DWY A;  2DVS A;  3O35 A;  2F6J A;  5FE9 A;  3O33 A;  3I3J A;  4UYF A;  4QEU A;  4PCE A;  4YAB A;  4O70 A;  5D24 A;  5IGK A;  4AKN A;  5LVR A;  5HJC A;  4Z6I A;  4O74 A;  4N4I A;  4IOR A;  5ENE A;  5FE6 A;  5DFB A;  5FE2 A;  4YBM A;  3S92 A;  5CUE A;  4OGJ A;  4NRC A;  4TT2 A;  5KTW A;  2WP1 A;  5I89 A;  5LKT A;  4QR4 A;  4QSP A;  4MEO A;  5IGL A;  3QZV A;  5E9I A;  5I88 A;  4QC3 A;  5F60 A;  5EWH A;  2FSA A;  4YYH A;  4TTE A;  2DVR A;  5C87 A;  2D9E A;  5H85 A;  3UVX A;  5EWD A;  1WUG A;  4N3W A;  5LJ2 A;  5E3D A;  5TB6 A;  4XY9 A;  5JWM A;  4BW4 A;  3JVK A;  4NYW A;  2E7N A;  4LYW A;  5ENG A;  4ZQL A;  5F63 A;  5ETB A;  4J0R A;  5I7X A;  5C4Q A;  5HCL A;  5EM3 A;  4Z1Q A;  5K29 A;  4QSS A;  5KTU A;  4WIV A;  5FFY A;  5F36 A;  5DYC A;  4NR7 A;  4O76 A;  5A81 A;  5D0C A;  3MQM A;  5ENH A;  3P1E A;  5HEL A;  4QEV A;  4ALH A;  5EGU A;  5CRZ A;  4IR5 A;  4N4H A;  5C89 A;  5D26 A;  5CQA A;  3LJW A;  5FBX A;  5I80 A;  4HBW A;  3Q2E A;  4IOO A;  4TT6 A;  4A9E A;  4LZS A;  5BT5 A;  5HM0 A;  4A9L A;  2OSS A;  4QYL A;  2L5E A;  5CUC A;  5D3P A;  5G4R A;  4O72 A;  5H1T A;  5LKZ A;  4NYV A;  3P1C A;  4LRG A;  1JSP B;  3RCW A;  5CZG A;  5BT3 A;  4QSV A;  5EWW A;  4MEQ A;  2RNW A;  2YDW A;  4TQN A;  4MR3 A;  5DW1 A;  5HRV A;  3G0J A;  5DYX A;  4F3I A;  5L97 A;  5A5O A;  5A5R A;  5F5Z A;  4CUP A;  3U5M A;  3QZT A;  2MJV B;  4UIW A;  4DON A;  5D7X A;  4IR3 A;  5EQ1 A;  3UVW A;  5LJ1 A;  4A9O A;  4UYD A;  5E7D A;  2LSP B;  5ENI A;  5L8U A;  5CTL A;  5A5P A;  2OO1 A;  4MR6 A;  4YAD A;  5DBM A;  2DKW A;  2E3K A;  4QSR A;  5FE3 A;  3IU5 A;  4NR5 A;  3HME A;  4N4G A;  5HFQ A;  4J0S A;  5A83 A;  4IR4 A;  4YYJ A;  4HXK A;  4YC9 A;  5E9Y A;  4A9F A;  4XY8 A;  5COI A;  4TU4 A;  4YYN A;  3O34 A;  4QSQ A;  4UYE A;  4BJX A;  4QY4 A;  2R0S A;  2YEK A;  4TZ2 A;  5AD3 A;  5EVA A;  4QUT A;  2RNY A;  5AMF A;  3JVL A;  4BHW A;  4KCX A;  4J3I A;  5CQ3 A;  1ZS5 A;  5HQ7 A;  5JI8 A;  4CUQ A;  5EPB A;  5KHM A;  5DLZ A;  5FB0 A;  5FH8 A;  4UIY A;  4CFL A;  5A5S A;  3QZS A;  4LZR A;  4NS5 A;  5FB1 A;  4NR9 A;  2DAT A;  4QSW A;  5C8G A;  5CS8 A;  2RI7 A;  5AME A;  5CY9 A;  4UYH A;  5DFC A;  5CPE A;  4Z6H A;  3JVM A;  5ENJ A;  5CRM A;  5F3A A;  4UYG A;  4QZS A;  2D82 A;  5LJ0 A;  5H1U A;  5D3J A;  4UIT A;  4PS5 A;  5I40 A;  5ENF A;  5FH7 A;  4BW1 A;  5E9K A;  5F25 A;  4IOQ A;  4O7F A;  5DYA A;  3SVG A;  4YH3 A;  4YH4 A;  5FG4 A;  4PY6 A;  5A5Q A;  5HLS A;  5F61 A;  1EQF A;  5I1Q A;  4NRB A;  5L96 A;  4PTB A;  5E9V A;  5ETD A;  4E96 A;  5A5N A;  4FLP A;  3UV4 A;  3LQJ A;  5D3H A;  5D3S A;  4CUR A;  5EIC A;  3SVH A;  5CQT A;  5I86 A;  4WHU A;  5EPS A;  4YYD A;  3JVJ A;  2L84 A;  2YW5 A;  5L99 A;  4QEW A;  4IR6 A;  5DFD A;  4O78 A;  4HXR A;  3D7C A;  3NXB A;  4HXL A;  1N72 A;  4MR4 A;  4N4F A;  4Z93 A;  5D3T A;  4TU6 A;  5EPR A;  3U5K A;  2L85 A;  4LR6 A;  4LYS A;  3HMF A;  5CU8 A;  2WP2 A;  3ONI A;  4O7B A;  4QC1 A;  4O7A A;  4J1P A;  3U5J A;  5L8T A;  5LKU A;  5BT4 A;  3U5P A;  3MB4 A;  3GG3 A;  3Q2F A;  5DYU A;  5FE7 A;  3O36 A;  4NYX A;  4C66 A;  4LYI A;  5IID A;  2NXB A;  5IBN A;  4Q0O A;  4ZW1 A;  5EP7 A;  2YQD A;  2H60 A;  3AAD A;  5E9L A;  3UW9 A;  5LVQ A;  5II2 A;  4ALG A;  4QBM A;  4YY4 A;  4O7E A;  3U5N A;  5C85 A;  4HXM A;  5F62 A;  5HRX A;  3S91 A;  4NR4 A;  4CFK A;  4XUA A;  5CQ8 A;  4O7C A;  3IU6 A;  3UVY A;  2RNX A;  3P1D A;  2OUO A;  2YEM A;  3P1F A;  5FE1 A;  3UV2 A;  5CP5 A;  4QB3 A;  5TCM A;  3UVD A;  4LZ2 A;  4A9M A;  4NQM A;  5HQ5 A;  5D25 A;  4PKL A;  3ZYU A;  5D3N A;  5FE5 A;  5EK9 A;  4CUS A;  5CUD A;  5ACY A;  5CQ7 A;  4NRA A;  5FG5 A;  2R10 A;  4Z1S A;  3G0L A;  4QSU A;  2F6N A;  4NUC A;  4NUE A;  5CUG A;  5H1V A;  5DKD A;  5D3R A;  4QR5 A;  2E7O A;  4YBS A;  3MUK A;  3P5O A;  5DY7 A;  4ZC9 A;  5CQ5 A;  4O77 A;  4CUT A;  5HRW A;  4YK0 A;  5E3G A;  4A9I A;  5EIS A;  5ENB A;  5CGP A;  5FE8 A;  4WHW A;  4MEN A;  5KO4 A;  5DLX A;  4A9H A;  5IGN A;  4QSX A;  4YAT A;  4UIU A;  4QYD A;  4HXS A;  5EV9 A;  4NR6 A;  5E0R A;  4MEP A;  5C7N A;  4YBT A;  4YYM A;  2R0Y A;  4CUU A; 
#chains in the Genus database with same CATH topology
 5LUU A;  4KV1 A;  2R0V A;  4A9K A;  5CUB A;  5CQ6 A;  4LC2 A;  5FDZ A;  4C67 A;  4A9J A;  5A7C A;  5G4S A;  4GPJ A;  2RFJ A;  5F1H A;  4TT4 A;  5KTX A;  5HEN A;  1WUM A;  2DWW A;  4PCI A;  4QUU A;  5FE4 A;  3TLP A;  2GRC A;  3SVF A;  5I7Y A;  2N9G A;  4Y03 A;  5EI4 A;  4YYK A;  2KTB B;  3U5O A;  5HEM A;  3MXF A;  4NR8 A;  5EWC A;  4QNS A;  4NQN A;  4OUF A;  5A85 A;  4BW2 A;  3AQA A;  5L98 A;  4HBV A;  5I29 A;  5F2P A;  4XYA A;  5EA1 A;  4CLB A;  4OGI A;  4LDF A;  4UIZ A;  4YAX A;  4Q0N A;  5DX4 A;  5KU3 A;  4NXJ A;  2RS9 B;  5D3L A;  4UIX A;  5CUA A;  4O75 A;  5I83 A;  2G4A A;  2DVV A;  5IG6 A;  4HXP A;  3K2J A;  4RVR A;  4UYF B;  3UV5 A;  5A82 A;  3FKM X;  4HXO A;  3HMH A;  5DKC A;  5CFW A;  4MR5 A;  4HBX A;  2YEL A;  4O71 A;  4YY6 A;  4CL9 A;  2EJN A;  4KV4 A;  4QST A;  5FH6 A;  5FFV A;  4TZ8 A;  5FFW A;  3LQI A;  4YYI A;  5EWV A;  5HQ6 A;  4TS8 A;  5J0D A;  4BW3 A;  5ENC A;  4HXN A;  5E74 A;  1F68 A;  5E73 A;  4YYG A;  4XUB A;  3DAI A;  5HFR A;  5FE0 A;  3MB3 A;  3D1B A;  3O37 A;  5EU1 A;  5F1L A;  5II1 A;  4A9N A;  5LKX A;  4X2I A;  4NUD A;  5FG6 A;  5E9M A;  5AD2 A;  5CQ4 A;  3MUL A;  4UIV A;  3U5L A;  1JM4 B;  2DVQ A;  5IGM A;  2I8N A;  3LQH A;  5DKH A;  2YYN A;  1X0J A;  1E6I A;  4QR3 A;  4TYL A;  5DW2 A;  4HBY A;  2I7K A;  3LXJ A;  2RO1 A;  3DWY A;  2DVS A;  3O35 A;  2F6J A;  5FE9 A;  3O33 A;  3I3J A;  4UYF A;  4QEU A;  4PCE A;  4YAB A;  4O70 A;  5D24 A;  5IGK A;  4AKN A;  5LVR A;  5HJC A;  4Z6I A;  4O74 A;  4N4I A;  4IOR A;  5ENE A;  5FE6 A;  1ZKR A;  5DFB A;  5FE2 A;  4YBM A;  3S92 A;  5CUE A;  4OGJ A;  4NRC A;  4TT2 A;  5KTW A;  2WP1 A;  5I89 A;  5LKT A;  4QR4 A;  4QSP A;  3D1D A;  4MEO A;  5IGL A;  3QZV A;  5E9I A;  5I88 A;  4QC3 A;  5F60 A;  5EWH A;  2FSA A;  4YYH A;  4TTE A;  2DVR A;  5C87 A;  2D9E A;  5H85 A;  3UVX A;  5EWD A;  1WUG A;  4N3W A;  5LJ2 A;  5E3D A;  4AI6 A;  5TB6 A;  4XY9 A;  5JWM A;  4BW4 A;  3JVK A;  4NYW A;  2E7N A;  4LYW A;  5ENG A;  4ZQL A;  5F63 A;  5ETB A;  4J0R A;  5I7X A;  5C4Q A;  5HCL A;  5EM3 A;  4Z1Q A;  5K29 A;  4QSS A;  5KTU A;  4WIV A;  5FFY A;  5F36 A;  5DYC A;  4NR7 A;  4O76 A;  5A81 A;  5D0C A;  3MQM A;  5ENH A;  3P1E A;  5HEL A;  4AKG A;  4QEV A;  4ALH A;  5EGU A;  5CRZ A;  4IR5 A;  4N4H A;  5C89 A;  5D26 A;  5CQA A;  3LJW A;  5FBX A;  5I80 A;  4HBW A;  3Q2E A;  4IOO A;  4TT6 A;  4A9E A;  4LZS A;  5BT5 A;  4AKI A;  5HM0 A;  4A9L A;  2OSS A;  4QYL A;  2L5E A;  5CUC A;  5D3P A;  5G4R A;  4O72 A;  5H1T A;  5LKZ A;  4NYV A;  3P1C A;  4LRG A;  1JSP B;  3RCW A;  5CZG A;  5BT3 A;  4QSV A;  5EWW A;  4MEQ A;  2RNW A;  2YDW A;  4TQN A;  4MR3 A;  5DW1 A;  5HRV A;  3G0J A;  5DYX A;  4F3I A;  5L97 A;  5A5O A;  5A5R A;  5F5Z A;  4CUP A;  3U5M A;  3QZT A;  2MJV B;  4UIW A;  4DON A;  5D7X A;  4IR3 A;  5EQ1 A;  3UVW A;  5LJ1 A;  4A9O A;  4UYD A;  5E7D A;  2LSP B;  5ENI A;  5L8U A;  5CTL A;  5A5P A;  2OO1 A;  4MR6 A;  1PUO A;  4YAD A;  5DBM A;  2DKW A;  2E3K A;  4QSR A;  5FE3 A;  3IU5 A;  4NR5 A;  3HME A;  4N4G A;  5HFQ A;  4J0S A;  5A83 A;  4IR4 A;  4YYJ A;  4HXK A;  4YC9 A;  5E9Y A;  4A9F A;  4XY8 A;  5COI A;  4TU4 A;  4YYN A;  3O34 A;  4QSQ A;  4UYE A;  4BJX A;  4QY4 A;  2R0S A;  2YEK A;  4TZ2 A;  5AD3 A;  5EVA A;  4QUT A;  2RNY A;  5AMF A;  3JVL A;  4BHW A;  4KCX A;  4J3I A;  5CQ3 A;  1ZS5 A;  5HQ7 A;  5JI8 A;  4CUQ A;  5EPB A;  5KHM A;  5DLZ A;  5FB0 A;  5FH8 A;  4UIY A;  4CFL A;  5A5S A;  3QZS A;  4LZR A;  4NS5 A;  5FB1 A;  4NR9 A;  2DAT A;  4QSW A;  5C8G A;  5CS8 A;  2RI7 A;  5AME A;  5CY9 A;  4UYH A;  5DFC A;  5CPE A;  4Z6H A;  3ERR A;  3JVM A;  5ENJ A;  5CRM A;  5F3A A;  4UYG A;  4QZS A;  2D82 A;  5LJ0 A;  5H1U A;  5D3J A;  4UIT A;  4PS5 A;  5I40 A;  5ENF A;  5FH7 A;  4BW1 A;  5E9K A;  5F25 A;  4IOQ A;  4O7F A;  5DYA A;  3SVG A;  4YH3 A;  4YH4 A;  5FG4 A;  4PY6 A;  5A5Q A;  5HLS A;  5F61 A;  1EQF A;  5I1Q A;  4NRB A;  5L96 A;  4PTB A;  5E9V A;  5ETD A;  4E96 A;  5A5N A;  4FLP A;  3UV4 A;  3LQJ A;  5D3H A;  5D3S A;  4CUR A;  5EIC A;  3SVH A;  5CQT A;  5I86 A;  4WHU A;  5EPS A;  4YYD A;  3JVJ A;  2L84 A;  2YW5 A;  5L99 A;  4QEW A;  4IR6 A;  5DFD A;  4O78 A;  4HXR A;  3D7C A;  3NXB A;  4HXL A;  1N72 A;  4MR4 A;  4N4F A;  4Z93 A;  5D3T A;  4TU6 A;  5EPR A;  3U5K A;  2L85 A;  4LR6 A;  4LYS A;  3HMF A;  5CU8 A;  2WP2 A;  3ONI A;  4O7B A;  4QC1 A;  4O7A A;  4J1P A;  3U5J A;  5L8T A;  5LKU A;  5BT4 A;  3U5P A;  3MB4 A;  3GG3 A;  3Q2F A;  5DYU A;  5FE7 A;  3O36 A;  4NYX A;  4C66 A;  4LYI A;  5IID A;  2NXB A;  5IBN A;  4Q0O A;  4ZW1 A;  5EP7 A;  2YQD A;  2H60 A;  3AAD A;  5E9L A;  3UW9 A;  5LVQ A;  5II2 A;  4ALG A;  4QBM A;  4YY4 A;  4O7E A;  3U5N A;  5C85 A;  4HXM A;  5F62 A;  5HRX A;  3S91 A;  4NR4 A;  4CFK A;  4XUA A;  5CQ8 A;  3VKH A;  4O7C A;  3IU6 A;  3UVY A;  2RNX A;  3P1D A;  2OUO A;  2YEM A;  3P1F A;  5FE1 A;  3UV2 A;  5CP5 A;  4QB3 A;  5TCM A;  3UVD A;  4LZ2 A;  4A9M A;  4NQM A;  5HQ5 A;  5D25 A;  4PKL A;  3ZYU A;  5D3N A;  5FE5 A;  5EK9 A;  4CUS A;  5CUD A;  5ACY A;  5CQ7 A;  4NRA A;  5FG5 A;  2R10 A;  4Z1S A;  3G0L A;  4QSU A;  2F6N A;  4NUC A;  4NUE A;  3VKG A;  5CUG A;  5H1V A;  5DKD A;  5D3R A;  4QR5 A;  2E7O A;  4YBS A;  3MUK A;  3P5O A;  5DY7 A;  4ZC9 A;  5CQ5 A;  4O77 A;  4CUT A;  5HRW A;  4AKH A;  4YK0 A;  5E3G A;  4A9I A;  5EIS A;  5ENB A;  5CGP A;  5FE8 A;  4WHW A;  4MEN A;  5KO4 A;  5DLX A;  4A9H A;  5IGN A;  4QSX A;  4YAT A;  4UIU A;  4QYD A;  4HXS A;  5EV9 A;  4NR6 A;  5E0R A;  4MEP A;  5C7N A;  4YBT A;  4YYM A;  2R0Y A;  4CUU A; 
#chains in the Genus database with same CATH homology
 5LUU A;  4KV1 A;  2R0V A;  4A9K A;  5CUB A;  5CQ6 A;  4LC2 A;  5FDZ A;  4C67 A;  4A9J A;  5A7C A;  5G4S A;  4GPJ A;  2RFJ A;  5F1H A;  4TT4 A;  5KTX A;  5HEN A;  1WUM A;  2DWW A;  4PCI A;  4QUU A;  5FE4 A;  3TLP A;  2GRC A;  3SVF A;  5I7Y A;  2N9G A;  4Y03 A;  5EI4 A;  4YYK A;  2KTB B;  3U5O A;  5HEM A;  3MXF A;  4NR8 A;  5EWC A;  4QNS A;  4NQN A;  4OUF A;  5A85 A;  4BW2 A;  3AQA A;  5L98 A;  4HBV A;  5I29 A;  5F2P A;  4XYA A;  5EA1 A;  4CLB A;  4OGI A;  4LDF A;  4UIZ A;  4YAX A;  4Q0N A;  5DX4 A;  5KU3 A;  4NXJ A;  2RS9 B;  5D3L A;  4UIX A;  5CUA A;  4O75 A;  5I83 A;  2G4A A;  2DVV A;  5IG6 A;  4HXP A;  3K2J A;  4RVR A;  4UYF B;  3UV5 A;  5A82 A;  3FKM X;  4HXO A;  3HMH A;  5DKC A;  5CFW A;  4MR5 A;  4HBX A;  2YEL A;  4O71 A;  4YY6 A;  4CL9 A;  4KV4 A;  4QST A;  5FH6 A;  5FFV A;  4TZ8 A;  5FFW A;  3LQI A;  4YYI A;  5EWV A;  5HQ6 A;  4TS8 A;  5J0D A;  4BW3 A;  5ENC A;  4HXN A;  5E74 A;  1F68 A;  5E73 A;  4YYG A;  4XUB A;  3DAI A;  5HFR A;  5FE0 A;  3MB3 A;  3O37 A;  5EU1 A;  5F1L A;  5II1 A;  4A9N A;  5LKX A;  4X2I A;  4NUD A;  5FG6 A;  5E9M A;  5AD2 A;  5CQ4 A;  3MUL A;  4UIV A;  3U5L A;  1JM4 B;  2DVQ A;  5IGM A;  2I8N A;  3LQH A;  5DKH A;  2YYN A;  1X0J A;  1E6I A;  4QR3 A;  4TYL A;  5DW2 A;  4HBY A;  2I7K A;  3LXJ A;  2RO1 A;  3DWY A;  2DVS A;  3O35 A;  2F6J A;  5FE9 A;  3O33 A;  3I3J A;  4UYF A;  4QEU A;  4PCE A;  4YAB A;  4O70 A;  5D24 A;  5IGK A;  4AKN A;  5LVR A;  5HJC A;  4Z6I A;  4O74 A;  4N4I A;  4IOR A;  5ENE A;  5FE6 A;  5DFB A;  5FE2 A;  4YBM A;  3S92 A;  5CUE A;  4OGJ A;  4NRC A;  4TT2 A;  5KTW A;  2WP1 A;  5I89 A;  5LKT A;  4QR4 A;  4QSP A;  4MEO A;  5IGL A;  3QZV A;  5E9I A;  5I88 A;  4QC3 A;  5F60 A;  5EWH A;  2FSA A;  4YYH A;  4TTE A;  2DVR A;  5C87 A;  2D9E A;  5H85 A;  3UVX A;  5EWD A;  1WUG A;  4N3W A;  5LJ2 A;  5E3D A;  5TB6 A;  4XY9 A;  5JWM A;  4BW4 A;  3JVK A;  4NYW A;  2E7N A;  4LYW A;  5ENG A;  4ZQL A;  5F63 A;  5ETB A;  4J0R A;  5I7X A;  5C4Q A;  5HCL A;  5EM3 A;  4Z1Q A;  5K29 A;  4QSS A;  5KTU A;  4WIV A;  5FFY A;  5F36 A;  5DYC A;  4NR7 A;  4O76 A;  5A81 A;  5D0C A;  3MQM A;  5ENH A;  3P1E A;  5HEL A;  4QEV A;  4ALH A;  5EGU A;  5CRZ A;  4IR5 A;  4N4H A;  5C89 A;  5D26 A;  5CQA A;  3LJW A;  5FBX A;  5I80 A;  4HBW A;  3Q2E A;  4IOO A;  4TT6 A;  4A9E A;  4LZS A;  5BT5 A;  5HM0 A;  4A9L A;  2OSS A;  4QYL A;  2L5E A;  5CUC A;  5D3P A;  5G4R A;  4O72 A;  5H1T A;  5LKZ A;  4NYV A;  3P1C A;  4LRG A;  1JSP B;  3RCW A;  5CZG A;  5BT3 A;  4QSV A;  5EWW A;  4MEQ A;  2RNW A;  2YDW A;  4TQN A;  4MR3 A;  5DW1 A;  5HRV A;  3G0J A;  5DYX A;  4F3I A;  5L97 A;  5A5O A;  5A5R A;  5F5Z A;  4CUP A;  3U5M A;  3QZT A;  2MJV B;  4UIW A;  4DON A;  5D7X A;  4IR3 A;  5EQ1 A;  3UVW A;  5LJ1 A;  4A9O A;  4UYD A;  5E7D A;  2LSP B;  5ENI A;  5L8U A;  5CTL A;  5A5P A;  2OO1 A;  4MR6 A;  4YAD A;  5DBM A;  2DKW A;  2E3K A;  4QSR A;  5FE3 A;  3IU5 A;  4NR5 A;  3HME A;  4N4G A;  5HFQ A;  4J0S A;  5A83 A;  4IR4 A;  4YYJ A;  4HXK A;  4YC9 A;  5E9Y A;  4A9F A;  4XY8 A;  5COI A;  4TU4 A;  4YYN A;  3O34 A;  4QSQ A;  4UYE A;  4BJX A;  4QY4 A;  2R0S A;  2YEK A;  4TZ2 A;  5AD3 A;  5EVA A;  4QUT A;  2RNY A;  5AMF A;  3JVL A;  4BHW A;  4KCX A;  4J3I A;  5CQ3 A;  1ZS5 A;  5HQ7 A;  5JI8 A;  4CUQ A;  5EPB A;  5KHM A;  5DLZ A;  5FB0 A;  5FH8 A;  4UIY A;  4CFL A;  5A5S A;  3QZS A;  4LZR A;  4NS5 A;  5FB1 A;  4NR9 A;  2DAT A;  4QSW A;  5C8G A;  5CS8 A;  2RI7 A;  5AME A;  5CY9 A;  4UYH A;  5DFC A;  5CPE A;  4Z6H A;  3JVM A;  5ENJ A;  5CRM A;  5F3A A;  4UYG A;  4QZS A;  2D82 A;  5LJ0 A;  5H1U A;  5D3J A;  4UIT A;  4PS5 A;  5I40 A;  5ENF A;  5FH7 A;  4BW1 A;  5E9K A;  5F25 A;  4IOQ A;  4O7F A;  5DYA A;  3SVG A;  4YH3 A;  4YH4 A;  5FG4 A;  4PY6 A;  5A5Q A;  5HLS A;  5F61 A;  1EQF A;  5I1Q A;  4NRB A;  5L96 A;  4PTB A;  5E9V A;  5ETD A;  4E96 A;  5A5N A;  4FLP A;  3UV4 A;  3LQJ A;  5D3H A;  5D3S A;  4CUR A;  5EIC A;  3SVH A;  5CQT A;  5I86 A;  4WHU A;  5EPS A;  4YYD A;  3JVJ A;  2L84 A;  2YW5 A;  5L99 A;  4QEW A;  4IR6 A;  5DFD A;  4O78 A;  4HXR A;  3D7C A;  3NXB A;  4HXL A;  1N72 A;  4MR4 A;  4N4F A;  4Z93 A;  5D3T A;  4TU6 A;  5EPR A;  3U5K A;  2L85 A;  4LR6 A;  4LYS A;  3HMF A;  5CU8 A;  2WP2 A;  3ONI A;  4O7B A;  4QC1 A;  4O7A A;  4J1P A;  3U5J A;  5L8T A;  5LKU A;  5BT4 A;  3U5P A;  3MB4 A;  3GG3 A;  3Q2F A;  5DYU A;  5FE7 A;  3O36 A;  4NYX A;  4C66 A;  4LYI A;  5IID A;  2NXB A;  5IBN A;  4Q0O A;  4ZW1 A;  5EP7 A;  2YQD A;  2H60 A;  3AAD A;  5E9L A;  3UW9 A;  5LVQ A;  5II2 A;  4ALG A;  4QBM A;  4YY4 A;  4O7E A;  3U5N A;  5C85 A;  4HXM A;  5F62 A;  5HRX A;  3S91 A;  4NR4 A;  4CFK A;  4XUA A;  5CQ8 A;  4O7C A;  3IU6 A;  3UVY A;  2RNX A;  3P1D A;  2OUO A;  2YEM A;  3P1F A;  5FE1 A;  3UV2 A;  5CP5 A;  4QB3 A;  5TCM A;  3UVD A;  4LZ2 A;  4A9M A;  4NQM A;  5HQ5 A;  5D25 A;  4PKL A;  3ZYU A;  5D3N A;  5FE5 A;  5EK9 A;  4CUS A;  5CUD A;  5ACY A;  5CQ7 A;  4NRA A;  5FG5 A;  2R10 A;  4Z1S A;  3G0L A;  4QSU A;  2F6N A;  4NUC A;  4NUE A;  5CUG A;  5H1V A;  5DKD A;  5D3R A;  4QR5 A;  2E7O A;  4YBS A;  3MUK A;  3P5O A;  5DY7 A;  4ZC9 A;  5CQ5 A;  4O77 A;  4CUT A;  5HRW A;  4YK0 A;  5E3G A;  4A9I A;  5EIS A;  5ENB A;  5CGP A;  5FE8 A;  4WHW A;  4MEN A;  5KO4 A;  5DLX A;  4A9H A;  5IGN A;  4QSX A;  4YAT A;  4UIU A;  4QYD A;  4HXS A;  5EV9 A;  4NR6 A;  5E0R A;  4MEP A;  5C7N A;  4YBT A;  4YYM A;  2R0Y A;  4CUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...