5FG6A

Crystal structure of the bromodomain of human brd1 (brpf2) in complex with of-1 chemical probe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
RLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Crystal structure of the bromodomain of human BRD1 (BRPF2) in complex with OF-1 chemical probe
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fg6A00
5DFCA 5FE5A 5JI8A 5D3PA 4BJXA 4Q0OA 4NR8A 4YAXA 4HXOA 2YEKA 4QB3A 4O75A 5CRZA 5L99A 4TTEA 5ENFA 2R0YA 3ZYUA 1F68A 5CUAA 3U5PA 5IG6A 4O7BA 4WHUA 4BHWA 4MEQA 4YYDA 4PCEA 4KV1A 4QSVA 4XUAA 3IU5A 5LVQA 5FBXA 4IR5A 4FLPA 4XUBA 4YADA 3O33A 5E74A 5AD3A 5D7XA 5FE3A 4J0RA 4NR4A 3RCWA 4RVRA 4NYWA 5ENIA 5DKDA 3JVKA 5IBNA 5HFQA 5CTLA 2YDWA 3HMHA 5E73A 5L97A 2I7KA 3P1EA 5EWVA 5LKZA 2G4AA 5D26A 4J0SA 4MR4A 4YYGA 4TZ8A 5C4QA 5C85A 5FG6A 2D9EA 4DONA 5DFDA 5KTXA 4CFLA 5D3SA 3U5MA 5A5QA 4ALHA 4IOOA 4MEOA 2DATA 4YBMA 5KTUA 5KU3A 5EP7A 4HBVA 3QZSA 2DVSA 2RNXA 4TS8A 5EV9A 3UVDA 4ALGA 5EPSA 5FE8A 3UVXA 3UV5A 3UV4A 5D3HA 5I40A 5H1UA 5IGKA 4HXLA 5KTWA 4QSPA 2D82A 5ETBA 3SVHA 5CQ7A 5CUEA 5FH6A 5I7XA 2E7NA 5H1TA 5FG4A 4TT4A 4UIWA 4UIYA 4UYDA 3TLPA 5FE7A 4QC3A 3SVFA 4CUTA 5EPRA 3LQJA 5E3DA 4QSSA 2WP1A 5E9LA 4CL9A 5I89A 3LXJA 5CP5A 4ZC9A 5AD2A 5F60A 4AKNA 2DKWA 5EPBA 5D0CA 4YBTA 5DYXA 5BT4A 5E7DA 4UIUA 4BW3A 4QY4A 4UYEA 5EVAA 3U5KA 5LJ1A 4QR4A 3GG3A 4QR5A 3DAIA 4QC1A 5HRWA 5CGPA 5F1LA 4CLBA 4LC2A 5I86A 5HM0A 4MR6A 4OUFA 5CQ3A 5ENCA 1X0JA 4NR6A 5FE9A 4QSRA 4A9OA 5I88A 5D3TA 5D3LA 4N4GA 4CUQA 4Z6IA 3D7CA 3UW9A 4NUDA 5TCMA 5FFYA 3QZTA 4QSXA 5FE0A 3U5LA 5FE6A 4PCIA 5EU1A 4TQNA 2LSPB 5CQ8A 4NRBA 4WIVA 4YYMA 1JSPB 2OUOA 3UVYA 5LJ0A 2OO1A 5L8TA 4C67A 5A5OA 4CFKA 5AMEA 5HEMA 5CY9A 5EM3A 5EGUA 5HJCA 5FB0A 4UIXA 3U5JA 4UYGA 5FH8A 4QSWA 4N4IA 4F3IA 3QZVA 5CS8A 4PKLA 5KO4A 5E9YA 4HBWA 5I29A 5CQAA 2OSSA 5FE2A 2WP2A 5C89A 5LKUA 2N9GA 2I8NA 4Q0NA 3G0LA 2KTBB 5CQTA 5L8UA 1JM4B 5ACYA 4QYDA 4LR6A 4NUCA 3MUKA 5F62A 3HMFA 2YEMA 4NR9A 5C8GA 5LKTA 4LYWA 4UITA 4QR3A 5CFWA 1WUGA 5HFRA 4OGIA 4HBYA 3IU6A 1ZS5A 4MR3A 4HXMA 4LRGA 5A5SA 5FFVA 4PTBA 2E7OA 3O37A 5A7CA 4YABA 5A83A 4QNSA 5A82A 5L98A 2L5EA 4LZ2A 4YYKA 5FDZA 3G0JA 4LZRA 3P1FA 4Z93A 5I80A 5DYAA 4BW4A 4NYXA 5DKHA 5JWMA 4IR6A 4NRCA 5A85A 5II1A 4XYAA 4PY6A 5EISA 3U5NA 4E96A 5LJ2A 4UYFA 4TU6A 2NXBA 1WUMA 1EQFA 2RS9B 4A9NA 4HXNA 4O7AA 5CPEA 4IOQA 4UIZA 5E9VA 4GPJA 4LDFA 4XY9A 2YYNA 5DY7A 5EQ1A 4LYSA 4QUUA 3P1DA 5DW2A 3O35A 4NYVA 4O72A 4LZSA 4UYHA 5HRXA 5A5RA 5CRMA 5DYUA 4KCXA 5C87A 4QSQA 3S91A 4IR3A 4NR7A 4YH4A 3AQAA 3O36A 5FE1A 4YYNA 5EWDA 3MXFA 4NS5A 5ENEA 3LJWA 5E9KA 5I1QA 5CQ5A 2YW5A 4MENA 5ETDA 4A9MA 5CUDA 3Q2EA 5BT5A 5FG5A 5A5PA 3LQIA 4OGJA 2DWWA 4Z1SA 3P1CA 4QEWA 5F5ZA 4HBXA 4A9EA 5DW1A 4YYJA 4O70A 4QSUA 5CUGA 5CUCA 5II2A 4QEUA 4YATA 5F61A 5E9IA 5DLZA 5A5NA 5HCLA 3ONIA 5FB1A 3DWYA 5L96A 4YYIA 5COIA 2MJVB 5D3JA 4J1PA 2DVQA 2RFJA 4NXJA 5G4RA 4HXRA 1N72A 4WHWA 5CQ6A 5ENGA 5HRVA 5F3AA 2RNYA 4A9JA 5F36A 5E0RA 5DBMA 5IIDA 4QSTA 4A9LA 5K29A 3JVJA 4TT6A 4NRAA 4TZ2A 5IGNA 5EWHA 5LUUA 5CUBA 4O7EA 2YQDA 5H1VA 5D3RA 5HENA 2FSAA 3JVMA 5F1HA 5CQ4A 3HMEA 4CUPA 4CUSA 5EWCA 3JVLA 4TU4A 4YY6A 5F63A 4KV4A 4A9FA 2DVRA 4CURA 4XY8A 4C66A 3UV2A 4QEVA 5ENJA 4MR5A 2E3KA 5BT3A 4N3WA 5HQ5A 4QZSA 1E6IA 4N4FA 4HXKA 4YBSA 2F6NA 4QBMA 2H60A 2F6JA 4O7CA 5I7YA 5DLXA 5HQ7A 4NQMA 5HELA 5AMFA 5DKCA 4O77A 5LKXA 5CU8A 3AADA 5ENBA 4NR5A 5E3GA 4J3IA 4YC9A 4IR4A 5G4SA 4A9KA 3NXBA 3O34A 3MULA 4QYLA 5FE4A 5KHMA 5H85A 5HQ6A 4HXPA 4O76A 5F25A 4NUEA 4X2IA 5FH7A 4A9HA 5HLSA 4LYIA 3I3JA 2R0VA 3Q2FA 5ENHA 3UVWA 4ZW1A 5A81A 2RNWA 2DVVA 2L85A 4CUUA 3K2JA 3MB3A 4BW2A 5F2PA 2R0SA 5I83A 4A9IA 4HXSA 4O7FA 4O74A 4Z1QA 5FFWA 5D25A 2YELA 5EI4A 2L84A 3LQHA 4N4HA 3FKMX 4BW1A 2GRCA 5DX4A 5EICA 2R10A 5EA1A 4PS5A 4UIVA 3U5OA 4YY4A 5D3NA 5E9MA 5CZGA 4YK0A 5EWWA 4QUTA 5J0DA 4O78A 4MEPA 5IGMA 4TT2A 5TB6A 4IORA 5DFBA 4UYFB 5LVRA 4Y03A 3SVGA 5DYCA 3P5OA 3S92A 4YH3A 4YYHA 3MB4A 4O71A 4NQNA 5D24A 5C7NA 5IGLA 4ZQLA 2RO1A 3MQMA 4TYLA 2RI7A 4Z6HA 5EK9A
chains in the Genus database with same CATH superfamily
5DFCA 3D1BA 5FE5A 5JI8A 5D3PA 4BJXA 4Q0OA 4NR8A 4YAXA 4HXOA 2YEKA 4QB3A 4O75A 5CRZA 5L99A 4TTEA 5ENFA 2R0YA 3ZYUA 1F68A 5CUAA 3U5PA 5IG6A 4O7BA 4WHUA 4BHWA 4MEQA 4YYDA 4PCEA 4KV1A 4QSVA 4XUAA 3IU5A 5LVQA 5FBXA 4IR5A 4FLPA 4XUBA 4YADA 3O33A 5E74A 5AD3A 5D7XA 5FE3A 4J0RA 4NR4A 3RCWA 4RVRA 4NYWA 5ENIA 5DKDA 3JVKA 5IBNA 5HFQA 5CTLA 2YDWA 3HMHA 5E73A 5L97A 2I7KA 3P1EA 5EWVA 5LKZA 2G4AA 5D26A 4J0SA 4MR4A 4YYGA 4TZ8A 5C4QA 5C85A 5FG6A 2D9EA 4DONA 5DFDA 5KTXA 4CFLA 5D3SA 3U5MA 5A5QA 4ALHA 4IOOA 4MEOA 2DATA 4YBMA 5KTUA 5KU3A 5EP7A 4HBVA 3QZSA 2DVSA 2RNXA 4TS8A 5EV9A 3UVDA 4ALGA 5EPSA 5FE8A 3UVXA 3UV5A 3UV4A 5D3HA 5I40A 5H1UA 5IGKA 4HXLA 5KTWA 4QSPA 2D82A 5ETBA 3SVHA 5CQ7A 5CUEA 5FH6A 5I7XA 2E7NA 5H1TA 5FG4A 4TT4A 4UIWA 4UIYA 4UYDA 3TLPA 5FE7A 4QC3A 3SVFA 2EJNA 4CUTA 5EPRA 3LQJA 5E3DA 4QSSA 2WP1A 5E9LA 4CL9A 5I89A 3LXJA 5CP5A 4ZC9A 5AD2A 5F60A 4AKNA 2DKWA 5EPBA 5D0CA 4YBTA 5DYXA 5BT4A 5E7DA 4UIUA 4BW3A 4QY4A 4UYEA 5EVAA 3U5KA 5LJ1A 4QR4A 3GG3A 4QR5A 3DAIA 4QC1A 5HRWA 5CGPA 5F1LA 4CLBA 4LC2A 5I86A 5HM0A 4MR6A 4OUFA 5CQ3A 5ENCA 1X0JA 4NR6A 5FE9A 4QSRA 4A9OA 5I88A 5D3TA 5D3LA 4N4GA 4CUQA 4Z6IA 3D7CA 3UW9A 4NUDA 5TCMA 5FFYA 3QZTA 4QSXA 5FE0A 3U5LA 5FE6A 4PCIA 5EU1A 4TQNA 2LSPB 5CQ8A 4NRBA 4WIVA 4YYMA 1JSPB 2OUOA 3UVYA 5LJ0A 2OO1A 5L8TA 4C67A 5A5OA 4CFKA 5AMEA 5HEMA 5CY9A 5EM3A 5EGUA 5HJCA 5FB0A 4UIXA 3U5JA 4UYGA 4AKIA 5FH8A 4QSWA 4N4IA 4F3IA 3QZVA 5CS8A 4PKLA 5KO4A 5E9YA 4HBWA 5I29A 5CQAA 2OSSA 5FE2A 2WP2A 5C89A 5LKUA 2N9GA 2I8NA 4Q0NA 3G0LA 2KTBB 4AI6A 5CQTA 5L8UA 1JM4B 5ACYA 4QYDA 4LR6A 4NUCA 3MUKA 5F62A 3HMFA 2YEMA 4NR9A 5C8GA 5LKTA 4LYWA 4UITA 4QR3A 5CFWA 1WUGA 5HFRA 4OGIA 4HBYA 3IU6A 1ZS5A 4MR3A 4HXMA 4LRGA 5A5SA 5FFVA 3D1DA 4PTBA 2E7OA 3O37A 5A7CA 4YABA 5A83A 4QNSA 5A82A 5L98A 2L5EA 4LZ2A 4YYKA 5FDZA 3G0JA 4LZRA 3P1FA 4Z93A 5I80A 5DYAA 4BW4A 4NYXA 5DKHA 5JWMA 4IR6A 4NRCA 5A85A 5II1A 4XYAA 4PY6A 5EISA 3U5NA 4E96A 5LJ2A 4UYFA 4TU6A 2NXBA 1WUMA 1EQFA 2RS9B 4A9NA 4HXNA 4O7AA 5CPEA 4IOQA 4UIZA 5E9VA 4GPJA 4LDFA 4XY9A 2YYNA 5DY7A 5EQ1A 3ERRA 4LYSA 4QUUA 3P1DA 5DW2A 3O35A 4AKHA 4NYVA 4O72A 4LZSA 4UYHA 5HRXA 5A5RA 5CRMA 5DYUA 4KCXA 5C87A 4QSQA 3S91A 4IR3A 4NR7A 4YH4A 3AQAA 1PUOA 3O36A 5FE1A 4YYNA 5EWDA 3MXFA 4NS5A 5ENEA 3LJWA 5E9KA 5I1QA 5CQ5A 2YW5A 3VKHA 4MENA 5ETDA 4A9MA 5CUDA 3Q2EA 5BT5A 3VKGA 5FG5A 5A5PA 3LQIA 4OGJA 2DWWA 4Z1SA 3P1CA 4QEWA 5F5ZA 4HBXA 4A9EA 5DW1A 4YYJA 4O70A 4QSUA 5CUGA 5CUCA 5II2A 4QEUA 4YATA 5F61A 5E9IA 5DLZA 5A5NA 5HCLA 3ONIA 5FB1A 3DWYA 5L96A 4YYIA 5COIA 2MJVB 5D3JA 4J1PA 2DVQA 2RFJA 4NXJA 5G4RA 4HXRA 1N72A 4WHWA 5CQ6A 5ENGA 5HRVA 5F3AA 2RNYA 4A9JA 5F36A 5E0RA 5DBMA 5IIDA 4QSTA 4A9LA 5K29A 3JVJA 4TT6A 4NRAA 4TZ2A 1ZKRA 5IGNA 5EWHA 5LUUA 5CUBA 4O7EA 2YQDA 5H1VA 5D3RA 5HENA 2FSAA 3JVMA 5F1HA 5CQ4A 3HMEA 4CUPA 4CUSA 5EWCA 3JVLA 4TU4A 4YY6A 5F63A 4KV4A 4A9FA 2DVRA 4CURA 4XY8A 4C66A 3UV2A 4QEVA 5ENJA 4MR5A 2E3KA 4AKGA 5BT3A 4N3WA 5HQ5A 4QZSA 1E6IA 4N4FA 4HXKA 4YBSA 2F6NA 4QBMA 2H60A 2F6JA 4O7CA 5I7YA 5DLXA 5HQ7A 4NQMA 5HELA 5AMFA 5DKCA 4O77A 5LKXA 5CU8A 3AADA 5ENBA 4NR5A 5E3GA 4J3IA 4YC9A 4IR4A 5G4SA 4A9KA 3NXBA 3O34A 3MULA 4QYLA 5FE4A 5KHMA 5H85A 5HQ6A 4HXPA 4O76A 5F25A 4NUEA 4X2IA 5FH7A 4A9HA 5HLSA 4LYIA 3I3JA 2R0VA 3Q2FA 5ENHA 3UVWA 4ZW1A 5A81A 2RNWA 2DVVA 2L85A 4CUUA 3K2JA 3MB3A 4BW2A 5F2PA 2R0SA 5I83A 4A9IA 4HXSA 4O7FA 4O74A 4Z1QA 5FFWA 5D25A 2YELA 5EI4A 2L84A 3LQHA 4N4HA 3FKMX 4BW1A 2GRCA 5DX4A 5EICA 2R10A 5EA1A 4PS5A 4UIVA 3U5OA 4YY4A 5D3NA 5E9MA 5CZGA 4YK0A 5EWWA 4QUTA 5J0DA 4O78A 4MEPA 5IGMA 4TT2A 5TB6A 4IORA 5DFBA 4UYFB 5LVRA 4Y03A 3SVGA 5DYCA 3P5OA 3S92A 4YH3A 4YYHA 3MB4A 4O71A 4NQNA 5D24A 5C7NA 5IGLA 4ZQLA 2RO1A 3MQMA 4TYLA 2RI7A 4Z6HA 5EK9A
chains in the Genus database with same CATH topology
5DFCA 5FE5A 5JI8A 5D3PA 4BJXA 4Q0OA 4NR8A 4YAXA 4HXOA 2YEKA 4QB3A 4O75A 5CRZA 5L99A 4TTEA 5ENFA 2R0YA 3ZYUA 1F68A 5CUAA 3U5PA 5IG6A 4O7BA 4WHUA 4BHWA 4MEQA 4YYDA 4PCEA 4KV1A 4QSVA 4XUAA 3IU5A 5LVQA 5FBXA 4IR5A 4FLPA 4XUBA 4YADA 3O33A 5E74A 5AD3A 5D7XA 5FE3A 4J0RA 4NR4A 3RCWA 4RVRA 4NYWA 5ENIA 5DKDA 3JVKA 5IBNA 5HFQA 5CTLA 2YDWA 3HMHA 5E73A 5L97A 2I7KA 3P1EA 5EWVA 5LKZA 2G4AA 5D26A 4J0SA 4MR4A 4YYGA 4TZ8A 5C4QA 5C85A 5FG6A 2D9EA 4DONA 5DFDA 5KTXA 4CFLA 5D3SA 3U5MA 5A5QA 4ALHA 4IOOA 4MEOA 2DATA 4YBMA 5KTUA 5KU3A 5EP7A 4HBVA 3QZSA 2DVSA 2RNXA 4TS8A 5EV9A 3UVDA 4ALGA 5EPSA 5FE8A 3UVXA 3UV5A 3UV4A 5D3HA 5I40A 5H1UA 5IGKA 4HXLA 5KTWA 4QSPA 2D82A 5ETBA 3SVHA 5CQ7A 5CUEA 5FH6A 5I7XA 2E7NA 5H1TA 5FG4A 4TT4A 4UIWA 4UIYA 4UYDA 3TLPA 5FE7A 4QC3A 3SVFA 4CUTA 5EPRA 3LQJA 5E3DA 4QSSA 2WP1A 5E9LA 4CL9A 5I89A 3LXJA 5CP5A 4ZC9A 5AD2A 5F60A 4AKNA 2DKWA 5EPBA 5D0CA 4YBTA 5DYXA 5BT4A 5E7DA 4UIUA 4BW3A 4QY4A 4UYEA 5EVAA 3U5KA 5LJ1A 4QR4A 3GG3A 4QR5A 3DAIA 4QC1A 5HRWA 5CGPA 5F1LA 4CLBA 4LC2A 5I86A 5HM0A 4MR6A 4OUFA 5CQ3A 5ENCA 1X0JA 4NR6A 5FE9A 4QSRA 4A9OA 5I88A 5D3TA 5D3LA 4N4GA 4CUQA 4Z6IA 3D7CA 3UW9A 4NUDA 5TCMA 5FFYA 3QZTA 4QSXA 5FE0A 3U5LA 5FE6A 4PCIA 5EU1A 4TQNA 2LSPB 5CQ8A 4NRBA 4WIVA 4YYMA 1JSPB 2OUOA 3UVYA 5LJ0A 2OO1A 5L8TA 4C67A 5A5OA 4CFKA 5AMEA 5HEMA 5CY9A 5EM3A 5EGUA 5HJCA 5FB0A 4UIXA 3U5JA 4UYGA 5FH8A 4QSWA 4N4IA 4F3IA 3QZVA 5CS8A 4PKLA 5KO4A 5E9YA 4HBWA 5I29A 5CQAA 2OSSA 5FE2A 2WP2A 5C89A 5LKUA 2N9GA 2I8NA 4Q0NA 3G0LA 2KTBB 5CQTA 5L8UA 1JM4B 5ACYA 4QYDA 4LR6A 4NUCA 3MUKA 5F62A 3HMFA 2YEMA 4NR9A 5C8GA 5LKTA 4LYWA 4UITA 4QR3A 5CFWA 1WUGA 5HFRA 4OGIA 4HBYA 3IU6A 1ZS5A 4MR3A 4HXMA 4LRGA 5A5SA 5FFVA 4PTBA 2E7OA 3O37A 5A7CA 4YABA 5A83A 4QNSA 5A82A 5L98A 2L5EA 4LZ2A 4YYKA 5FDZA 3G0JA 4LZRA 3P1FA 4Z93A 5I80A 5DYAA 4BW4A 4NYXA 5DKHA 5JWMA 4IR6A 4NRCA 5A85A 5II1A 4XYAA 4PY6A 5EISA 3U5NA 4E96A 5LJ2A 4UYFA 4TU6A 2NXBA 1WUMA 1EQFA 2RS9B 4A9NA 4HXNA 4O7AA 5CPEA 4IOQA 4UIZA 5E9VA 4GPJA 4LDFA 4XY9A 2YYNA 5DY7A 5EQ1A 4LYSA 4QUUA 3P1DA 5DW2A 3O35A 4NYVA 4O72A 4LZSA 4UYHA 5HRXA 5A5RA 5CRMA 5DYUA 4KCXA 5C87A 4QSQA 3S91A 4IR3A 4NR7A 4YH4A 3AQAA 3O36A 5FE1A 4YYNA 5EWDA 3MXFA 4NS5A 5ENEA 3LJWA 5E9KA 5I1QA 5CQ5A 2YW5A 4MENA 5ETDA 4A9MA 5CUDA 3Q2EA 5BT5A 5FG5A 5A5PA 3LQIA 4OGJA 2DWWA 4Z1SA 3P1CA 4QEWA 5F5ZA 4HBXA 4A9EA 5DW1A 4YYJA 4O70A 4QSUA 5CUGA 5CUCA 5II2A 4QEUA 4YATA 5F61A 5E9IA 5DLZA 5A5NA 5HCLA 3ONIA 5FB1A 3DWYA 5L96A 4YYIA 5COIA 2MJVB 5D3JA 4J1PA 2DVQA 2RFJA 4NXJA 5G4RA 4HXRA 1N72A 4WHWA 5CQ6A 5ENGA 5HRVA 5F3AA 2RNYA 4A9JA 5F36A 5E0RA 5DBMA 5IIDA 4QSTA 4A9LA 5K29A 3JVJA 4TT6A 4NRAA 4TZ2A 5IGNA 5EWHA 5LUUA 5CUBA 4O7EA 2YQDA 5H1VA 5D3RA 5HENA 2FSAA 3JVMA 5F1HA 5CQ4A 3HMEA 4CUPA 4CUSA 5EWCA 3JVLA 4TU4A 4YY6A 5F63A 4KV4A 4A9FA 2DVRA 4CURA 4XY8A 4C66A 3UV2A 4QEVA 5ENJA 4MR5A 2E3KA 5BT3A 4N3WA 5HQ5A 4QZSA 1E6IA 4N4FA 4HXKA 4YBSA 2F6NA 4QBMA 2H60A 2F6JA 4O7CA 5I7YA 5DLXA 5HQ7A 4NQMA 5HELA 5AMFA 5DKCA 4O77A 5LKXA 5CU8A 3AADA 5ENBA 4NR5A 5E3GA 4J3IA 4YC9A 4IR4A 5G4SA 4A9KA 3NXBA 3O34A 3MULA 4QYLA 5FE4A 5KHMA 5H85A 5HQ6A 4HXPA 4O76A 5F25A 4NUEA 4X2IA 5FH7A 4A9HA 5HLSA 4LYIA 3I3JA 2R0VA 3Q2FA 5ENHA 3UVWA 4ZW1A 5A81A 2RNWA 2DVVA 2L85A 4CUUA 3K2JA 3MB3A 4BW2A 5F2PA 2R0SA 5I83A 4A9IA 4HXSA 4O7FA 4O74A 4Z1QA 5FFWA 5D25A 2YELA 5EI4A 2L84A 3LQHA 4N4HA 3FKMX 4BW1A 2GRCA 5DX4A 5EICA 2R10A 5EA1A 4PS5A 4UIVA 3U5OA 4YY4A 5D3NA 5E9MA 5CZGA 4YK0A 5EWWA 4QUTA 5J0DA 4O78A 4MEPA 5IGMA 4TT2A 5TB6A 4IORA 5DFBA 4UYFB 5LVRA 4Y03A 3SVGA 5DYCA 3P5OA 3S92A 4YH3A 4YYHA 3MB4A 4O71A 4NQNA 5D24A 5C7NA 5IGLA 4ZQLA 2RO1A 3MQMA 4TYLA 2RI7A 4Z6HA 5EK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFC A;  5FE5 A;  5JI8 A;  5D3P A;  4BJX A;  4Q0O A;  4NR8 A;  4YAX A;  4HXO A;  2YEK A;  4QB3 A;  4O75 A;  5CRZ A;  5L99 A;  4TTE A;  5ENF A;  2R0Y A;  3ZYU A;  1F68 A;  5CUA A;  3U5P A;  5IG6 A;  4O7B A;  4WHU A;  4BHW A;  4MEQ A;  4YYD A;  4PCE A;  4KV1 A;  4QSV A;  4XUA A;  3IU5 A;  5LVQ A;  5FBX A;  4IR5 A;  4FLP A;  4XUB A;  4YAD A;  3O33 A;  5E74 A;  5AD3 A;  5D7X A;  5FE3 A;  4J0R A;  4NR4 A;  3RCW A;  4RVR A;  4NYW A;  5ENI A;  5DKD A;  3JVK A;  5IBN A;  5HFQ A;  5CTL A;  2YDW A;  3HMH A;  5E73 A;  5L97 A;  2I7K A;  3P1E A;  5EWV A;  5LKZ A;  2G4A A;  5D26 A;  4J0S A;  4MR4 A;  4YYG A;  4TZ8 A;  5C4Q A;  5C85 A;  5FG6 A;  2D9E A;  4DON A;  5DFD A;  5KTX A;  4CFL A;  5D3S A;  3U5M A;  5A5Q A;  4ALH A;  4IOO A;  4MEO A;  2DAT A;  4YBM A;  5KTU A;  5KU3 A;  5EP7 A;  4HBV A;  3QZS A;  2DVS A;  2RNX A;  4TS8 A;  5EV9 A;  3UVD A;  4ALG A;  5EPS A;  5FE8 A;  3UVX A;  3UV5 A;  3UV4 A;  5D3H A;  5I40 A;  5H1U A;  5IGK A;  4HXL A;  5KTW A;  4QSP A;  2D82 A;  5ETB A;  3SVH A;  5CQ7 A;  5CUE A;  5FH6 A;  5I7X A;  2E7N A;  5H1T A;  5FG4 A;  4TT4 A;  4UIW A;  4UIY A;  4UYD A;  3TLP A;  5FE7 A;  4QC3 A;  3SVF A;  4CUT A;  5EPR A;  3LQJ A;  5E3D A;  4QSS A;  2WP1 A;  5E9L A;  4CL9 A;  5I89 A;  3LXJ A;  5CP5 A;  4ZC9 A;  5AD2 A;  5F60 A;  4AKN A;  2DKW A;  5EPB A;  5D0C A;  4YBT A;  5DYX A;  5BT4 A;  5E7D A;  4UIU A;  4BW3 A;  4QY4 A;  4UYE A;  5EVA A;  3U5K A;  5LJ1 A;  4QR4 A;  3GG3 A;  4QR5 A;  3DAI A;  4QC1 A;  5HRW A;  5CGP A;  5F1L A;  4CLB A;  4LC2 A;  5I86 A;  5HM0 A;  4MR6 A;  4OUF A;  5CQ3 A;  5ENC A;  1X0J A;  4NR6 A;  5FE9 A;  4QSR A;  4A9O A;  5I88 A;  5D3T A;  5D3L A;  4N4G A;  4CUQ A;  4Z6I A;  3D7C A;  3UW9 A;  4NUD A;  5TCM A;  5FFY A;  3QZT A;  4QSX A;  5FE0 A;  3U5L A;  5FE6 A;  4PCI A;  5EU1 A;  4TQN A;  2LSP B;  5CQ8 A;  4NRB A;  4WIV A;  4YYM A;  1JSP B;  2OUO A;  3UVY A;  5LJ0 A;  2OO1 A;  5L8T A;  4C67 A;  5A5O A;  4CFK A;  5AME A;  5HEM A;  5CY9 A;  5EM3 A;  5EGU A;  5HJC A;  5FB0 A;  4UIX A;  3U5J A;  4UYG A;  5FH8 A;  4QSW A;  4N4I A;  4F3I A;  3QZV A;  5CS8 A;  4PKL A;  5KO4 A;  5E9Y A;  4HBW A;  5I29 A;  5CQA A;  2OSS A;  5FE2 A;  2WP2 A;  5C89 A;  5LKU A;  2N9G A;  2I8N A;  4Q0N A;  3G0L A;  2KTB B;  5CQT A;  5L8U A;  1JM4 B;  5ACY A;  4QYD A;  4LR6 A;  4NUC A;  3MUK A;  5F62 A;  3HMF A;  2YEM A;  4NR9 A;  5C8G A;  5LKT A;  4LYW A;  4UIT A;  4QR3 A;  5CFW A;  1WUG A;  5HFR A;  4OGI A;  4HBY A;  3IU6 A;  1ZS5 A;  4MR3 A;  4HXM A;  4LRG A;  5A5S A;  5FFV A;  4PTB A;  2E7O A;  3O37 A;  5A7C A;  4YAB A;  5A83 A;  4QNS A;  5A82 A;  5L98 A;  2L5E A;  4LZ2 A;  4YYK A;  5FDZ A;  3G0J A;  4LZR A;  3P1F A;  4Z93 A;  5I80 A;  5DYA A;  4BW4 A;  4NYX A;  5DKH A;  5JWM A;  4IR6 A;  4NRC A;  5A85 A;  5II1 A;  4XYA A;  4PY6 A;  5EIS A;  3U5N A;  4E96 A;  5LJ2 A;  4UYF A;  4TU6 A;  2NXB A;  1WUM A;  1EQF A;  2RS9 B;  4A9N A;  4HXN A;  4O7A A;  5CPE A;  4IOQ A;  4UIZ A;  5E9V A;  4GPJ A;  4LDF A;  4XY9 A;  2YYN A;  5DY7 A;  5EQ1 A;  4LYS A;  4QUU A;  3P1D A;  5DW2 A;  3O35 A;  4NYV A;  4O72 A;  4LZS A;  4UYH A;  5HRX A;  5A5R A;  5CRM A;  5DYU A;  4KCX A;  5C87 A;  4QSQ A;  3S91 A;  4IR3 A;  4NR7 A;  4YH4 A;  3AQA A;  3O36 A;  5FE1 A;  4YYN A;  5EWD A;  3MXF A;  4NS5 A;  5ENE A;  3LJW A;  5E9K A;  5I1Q A;  5CQ5 A;  2YW5 A;  4MEN A;  5ETD A;  4A9M A;  5CUD A;  3Q2E A;  5BT5 A;  5FG5 A;  5A5P A;  3LQI A;  4OGJ A;  2DWW A;  4Z1S A;  3P1C A;  4QEW A;  5F5Z A;  4HBX A;  4A9E A;  5DW1 A;  4YYJ A;  4O70 A;  4QSU A;  5CUG A;  5CUC A;  5II2 A;  4QEU A;  4YAT A;  5F61 A;  5E9I A;  5DLZ A;  5A5N A;  5HCL A;  3ONI A;  5FB1 A;  3DWY A;  5L96 A;  4YYI A;  5COI A;  2MJV B;  5D3J A;  4J1P A;  2DVQ A;  2RFJ A;  4NXJ A;  5G4R A;  4HXR A;  1N72 A;  4WHW A;  5CQ6 A;  5ENG A;  5HRV A;  5F3A A;  2RNY A;  4A9J A;  5F36 A;  5E0R A;  5DBM A;  5IID A;  4QST A;  4A9L A;  5K29 A;  3JVJ A;  4TT6 A;  4NRA A;  4TZ2 A;  5IGN A;  5EWH A;  5LUU A;  5CUB A;  4O7E A;  2YQD A;  5H1V A;  5D3R A;  5HEN A;  2FSA A;  3JVM A;  5F1H A;  5CQ4 A;  3HME A;  4CUP A;  4CUS A;  5EWC A;  3JVL A;  4TU4 A;  4YY6 A;  5F63 A;  4KV4 A;  4A9F A;  2DVR A;  4CUR A;  4XY8 A;  4C66 A;  3UV2 A;  4QEV A;  5ENJ A;  4MR5 A;  2E3K A;  5BT3 A;  4N3W A;  5HQ5 A;  4QZS A;  1E6I A;  4N4F A;  4HXK A;  4YBS A;  2F6N A;  4QBM A;  2H60 A;  2F6J A;  4O7C A;  5I7Y A;  5DLX A;  5HQ7 A;  4NQM A;  5HEL A;  5AMF A;  5DKC A;  4O77 A;  5LKX A;  5CU8 A;  3AAD A;  5ENB A;  4NR5 A;  5E3G A;  4J3I A;  4YC9 A;  4IR4 A;  5G4S A;  4A9K A;  3NXB A;  3O34 A;  3MUL A;  4QYL A;  5FE4 A;  5KHM A;  5H85 A;  5HQ6 A;  4HXP A;  4O76 A;  5F25 A;  4NUE A;  4X2I A;  5FH7 A;  4A9H A;  5HLS A;  4LYI A;  3I3J A;  2R0V A;  3Q2F A;  5ENH A;  3UVW A;  4ZW1 A;  5A81 A;  2RNW A;  2DVV A;  2L85 A;  4CUU A;  3K2J A;  3MB3 A;  4BW2 A;  5F2P A;  2R0S A;  5I83 A;  4A9I A;  4HXS A;  4O7F A;  4O74 A;  4Z1Q A;  5FFW A;  5D25 A;  2YEL A;  5EI4 A;  2L84 A;  3LQH A;  4N4H A;  3FKM X;  4BW1 A;  2GRC A;  5DX4 A;  5EIC A;  2R10 A;  5EA1 A;  4PS5 A;  4UIV A;  3U5O A;  4YY4 A;  5D3N A;  5E9M A;  5CZG A;  4YK0 A;  5EWW A;  4QUT A;  5J0D A;  4O78 A;  4MEP A;  5IGM A;  4TT2 A;  5TB6 A;  4IOR A;  5DFB A;  4UYF B;  5LVR A;  4Y03 A;  3SVG A;  5DYC A;  3P5O A;  3S92 A;  4YH3 A;  4YYH A;  3MB4 A;  4O71 A;  4NQN A;  5D24 A;  5C7N A;  5IGL A;  4ZQL A;  2RO1 A;  3MQM A;  4TYL A;  2RI7 A;  4Z6H A;  5EK9 A; 
#chains in the Genus database with same CATH topology
 5DFC A;  3D1B A;  5FE5 A;  5JI8 A;  5D3P A;  4BJX A;  4Q0O A;  4NR8 A;  4YAX A;  4HXO A;  2YEK A;  4QB3 A;  4O75 A;  5CRZ A;  5L99 A;  4TTE A;  5ENF A;  2R0Y A;  3ZYU A;  1F68 A;  5CUA A;  3U5P A;  5IG6 A;  4O7B A;  4WHU A;  4BHW A;  4MEQ A;  4YYD A;  4PCE A;  4KV1 A;  4QSV A;  4XUA A;  3IU5 A;  5LVQ A;  5FBX A;  4IR5 A;  4FLP A;  4XUB A;  4YAD A;  3O33 A;  5E74 A;  5AD3 A;  5D7X A;  5FE3 A;  4J0R A;  4NR4 A;  3RCW A;  4RVR A;  4NYW A;  5ENI A;  5DKD A;  3JVK A;  5IBN A;  5HFQ A;  5CTL A;  2YDW A;  3HMH A;  5E73 A;  5L97 A;  2I7K A;  3P1E A;  5EWV A;  5LKZ A;  2G4A A;  5D26 A;  4J0S A;  4MR4 A;  4YYG A;  4TZ8 A;  5C4Q A;  5C85 A;  5FG6 A;  2D9E A;  4DON A;  5DFD A;  5KTX A;  4CFL A;  5D3S A;  3U5M A;  5A5Q A;  4ALH A;  4IOO A;  4MEO A;  2DAT A;  4YBM A;  5KTU A;  5KU3 A;  5EP7 A;  4HBV A;  3QZS A;  2DVS A;  2RNX A;  4TS8 A;  5EV9 A;  3UVD A;  4ALG A;  5EPS A;  5FE8 A;  3UVX A;  3UV5 A;  3UV4 A;  5D3H A;  5I40 A;  5H1U A;  5IGK A;  4HXL A;  5KTW A;  4QSP A;  2D82 A;  5ETB A;  3SVH A;  5CQ7 A;  5CUE A;  5FH6 A;  5I7X A;  2E7N A;  5H1T A;  5FG4 A;  4TT4 A;  4UIW A;  4UIY A;  4UYD A;  3TLP A;  5FE7 A;  4QC3 A;  3SVF A;  2EJN A;  4CUT A;  5EPR A;  3LQJ A;  5E3D A;  4QSS A;  2WP1 A;  5E9L A;  4CL9 A;  5I89 A;  3LXJ A;  5CP5 A;  4ZC9 A;  5AD2 A;  5F60 A;  4AKN A;  2DKW A;  5EPB A;  5D0C A;  4YBT A;  5DYX A;  5BT4 A;  5E7D A;  4UIU A;  4BW3 A;  4QY4 A;  4UYE A;  5EVA A;  3U5K A;  5LJ1 A;  4QR4 A;  3GG3 A;  4QR5 A;  3DAI A;  4QC1 A;  5HRW A;  5CGP A;  5F1L A;  4CLB A;  4LC2 A;  5I86 A;  5HM0 A;  4MR6 A;  4OUF A;  5CQ3 A;  5ENC A;  1X0J A;  4NR6 A;  5FE9 A;  4QSR A;  4A9O A;  5I88 A;  5D3T A;  5D3L A;  4N4G A;  4CUQ A;  4Z6I A;  3D7C A;  3UW9 A;  4NUD A;  5TCM A;  5FFY A;  3QZT A;  4QSX A;  5FE0 A;  3U5L A;  5FE6 A;  4PCI A;  5EU1 A;  4TQN A;  2LSP B;  5CQ8 A;  4NRB A;  4WIV A;  4YYM A;  1JSP B;  2OUO A;  3UVY A;  5LJ0 A;  2OO1 A;  5L8T A;  4C67 A;  5A5O A;  4CFK A;  5AME A;  5HEM A;  5CY9 A;  5EM3 A;  5EGU A;  5HJC A;  5FB0 A;  4UIX A;  3U5J A;  4UYG A;  4AKI A;  5FH8 A;  4QSW A;  4N4I A;  4F3I A;  3QZV A;  5CS8 A;  4PKL A;  5KO4 A;  5E9Y A;  4HBW A;  5I29 A;  5CQA A;  2OSS A;  5FE2 A;  2WP2 A;  5C89 A;  5LKU A;  2N9G A;  2I8N A;  4Q0N A;  3G0L A;  2KTB B;  4AI6 A;  5CQT A;  5L8U A;  1JM4 B;  5ACY A;  4QYD A;  4LR6 A;  4NUC A;  3MUK A;  5F62 A;  3HMF A;  2YEM A;  4NR9 A;  5C8G A;  5LKT A;  4LYW A;  4UIT A;  4QR3 A;  5CFW A;  1WUG A;  5HFR A;  4OGI A;  4HBY A;  3IU6 A;  1ZS5 A;  4MR3 A;  4HXM A;  4LRG A;  5A5S A;  5FFV A;  3D1D A;  4PTB A;  2E7O A;  3O37 A;  5A7C A;  4YAB A;  5A83 A;  4QNS A;  5A82 A;  5L98 A;  2L5E A;  4LZ2 A;  4YYK A;  5FDZ A;  3G0J A;  4LZR A;  3P1F A;  4Z93 A;  5I80 A;  5DYA A;  4BW4 A;  4NYX A;  5DKH A;  5JWM A;  4IR6 A;  4NRC A;  5A85 A;  5II1 A;  4XYA A;  4PY6 A;  5EIS A;  3U5N A;  4E96 A;  5LJ2 A;  4UYF A;  4TU6 A;  2NXB A;  1WUM A;  1EQF A;  2RS9 B;  4A9N A;  4HXN A;  4O7A A;  5CPE A;  4IOQ A;  4UIZ A;  5E9V A;  4GPJ A;  4LDF A;  4XY9 A;  2YYN A;  5DY7 A;  5EQ1 A;  3ERR A;  4LYS A;  4QUU A;  3P1D A;  5DW2 A;  3O35 A;  4AKH A;  4NYV A;  4O72 A;  4LZS A;  4UYH A;  5HRX A;  5A5R A;  5CRM A;  5DYU A;  4KCX A;  5C87 A;  4QSQ A;  3S91 A;  4IR3 A;  4NR7 A;  4YH4 A;  3AQA A;  1PUO A;  3O36 A;  5FE1 A;  4YYN A;  5EWD A;  3MXF A;  4NS5 A;  5ENE A;  3LJW A;  5E9K A;  5I1Q A;  5CQ5 A;  2YW5 A;  3VKH A;  4MEN A;  5ETD A;  4A9M A;  5CUD A;  3Q2E A;  5BT5 A;  3VKG A;  5FG5 A;  5A5P A;  3LQI A;  4OGJ A;  2DWW A;  4Z1S A;  3P1C A;  4QEW A;  5F5Z A;  4HBX A;  4A9E A;  5DW1 A;  4YYJ A;  4O70 A;  4QSU A;  5CUG A;  5CUC A;  5II2 A;  4QEU A;  4YAT A;  5F61 A;  5E9I A;  5DLZ A;  5A5N A;  5HCL A;  3ONI A;  5FB1 A;  3DWY A;  5L96 A;  4YYI A;  5COI A;  2MJV B;  5D3J A;  4J1P A;  2DVQ A;  2RFJ A;  4NXJ A;  5G4R A;  4HXR A;  1N72 A;  4WHW A;  5CQ6 A;  5ENG A;  5HRV A;  5F3A A;  2RNY A;  4A9J A;  5F36 A;  5E0R A;  5DBM A;  5IID A;  4QST A;  4A9L A;  5K29 A;  3JVJ A;  4TT6 A;  4NRA A;  4TZ2 A;  1ZKR A;  5IGN A;  5EWH A;  5LUU A;  5CUB A;  4O7E A;  2YQD A;  5H1V A;  5D3R A;  5HEN A;  2FSA A;  3JVM A;  5F1H A;  5CQ4 A;  3HME A;  4CUP A;  4CUS A;  5EWC A;  3JVL A;  4TU4 A;  4YY6 A;  5F63 A;  4KV4 A;  4A9F A;  2DVR A;  4CUR A;  4XY8 A;  4C66 A;  3UV2 A;  4QEV A;  5ENJ A;  4MR5 A;  2E3K A;  4AKG A;  5BT3 A;  4N3W A;  5HQ5 A;  4QZS A;  1E6I A;  4N4F A;  4HXK A;  4YBS A;  2F6N A;  4QBM A;  2H60 A;  2F6J A;  4O7C A;  5I7Y A;  5DLX A;  5HQ7 A;  4NQM A;  5HEL A;  5AMF A;  5DKC A;  4O77 A;  5LKX A;  5CU8 A;  3AAD A;  5ENB A;  4NR5 A;  5E3G A;  4J3I A;  4YC9 A;  4IR4 A;  5G4S A;  4A9K A;  3NXB A;  3O34 A;  3MUL A;  4QYL A;  5FE4 A;  5KHM A;  5H85 A;  5HQ6 A;  4HXP A;  4O76 A;  5F25 A;  4NUE A;  4X2I A;  5FH7 A;  4A9H A;  5HLS A;  4LYI A;  3I3J A;  2R0V A;  3Q2F A;  5ENH A;  3UVW A;  4ZW1 A;  5A81 A;  2RNW A;  2DVV A;  2L85 A;  4CUU A;  3K2J A;  3MB3 A;  4BW2 A;  5F2P A;  2R0S A;  5I83 A;  4A9I A;  4HXS A;  4O7F A;  4O74 A;  4Z1Q A;  5FFW A;  5D25 A;  2YEL A;  5EI4 A;  2L84 A;  3LQH A;  4N4H A;  3FKM X;  4BW1 A;  2GRC A;  5DX4 A;  5EIC A;  2R10 A;  5EA1 A;  4PS5 A;  4UIV A;  3U5O A;  4YY4 A;  5D3N A;  5E9M A;  5CZG A;  4YK0 A;  5EWW A;  4QUT A;  5J0D A;  4O78 A;  4MEP A;  5IGM A;  4TT2 A;  5TB6 A;  4IOR A;  5DFB A;  4UYF B;  5LVR A;  4Y03 A;  3SVG A;  5DYC A;  3P5O A;  3S92 A;  4YH3 A;  4YYH A;  3MB4 A;  4O71 A;  4NQN A;  5D24 A;  5C7N A;  5IGL A;  4ZQL A;  2RO1 A;  3MQM A;  4TYL A;  2RI7 A;  4Z6H A;  5EK9 A; 
#chains in the Genus database with same CATH homology
 5DFC A;  5FE5 A;  5JI8 A;  5D3P A;  4BJX A;  4Q0O A;  4NR8 A;  4YAX A;  4HXO A;  2YEK A;  4QB3 A;  4O75 A;  5CRZ A;  5L99 A;  4TTE A;  5ENF A;  2R0Y A;  3ZYU A;  1F68 A;  5CUA A;  3U5P A;  5IG6 A;  4O7B A;  4WHU A;  4BHW A;  4MEQ A;  4YYD A;  4PCE A;  4KV1 A;  4QSV A;  4XUA A;  3IU5 A;  5LVQ A;  5FBX A;  4IR5 A;  4FLP A;  4XUB A;  4YAD A;  3O33 A;  5E74 A;  5AD3 A;  5D7X A;  5FE3 A;  4J0R A;  4NR4 A;  3RCW A;  4RVR A;  4NYW A;  5ENI A;  5DKD A;  3JVK A;  5IBN A;  5HFQ A;  5CTL A;  2YDW A;  3HMH A;  5E73 A;  5L97 A;  2I7K A;  3P1E A;  5EWV A;  5LKZ A;  2G4A A;  5D26 A;  4J0S A;  4MR4 A;  4YYG A;  4TZ8 A;  5C4Q A;  5C85 A;  5FG6 A;  2D9E A;  4DON A;  5DFD A;  5KTX A;  4CFL A;  5D3S A;  3U5M A;  5A5Q A;  4ALH A;  4IOO A;  4MEO A;  2DAT A;  4YBM A;  5KTU A;  5KU3 A;  5EP7 A;  4HBV A;  3QZS A;  2DVS A;  2RNX A;  4TS8 A;  5EV9 A;  3UVD A;  4ALG A;  5EPS A;  5FE8 A;  3UVX A;  3UV5 A;  3UV4 A;  5D3H A;  5I40 A;  5H1U A;  5IGK A;  4HXL A;  5KTW A;  4QSP A;  2D82 A;  5ETB A;  3SVH A;  5CQ7 A;  5CUE A;  5FH6 A;  5I7X A;  2E7N A;  5H1T A;  5FG4 A;  4TT4 A;  4UIW A;  4UIY A;  4UYD A;  3TLP A;  5FE7 A;  4QC3 A;  3SVF A;  4CUT A;  5EPR A;  3LQJ A;  5E3D A;  4QSS A;  2WP1 A;  5E9L A;  4CL9 A;  5I89 A;  3LXJ A;  5CP5 A;  4ZC9 A;  5AD2 A;  5F60 A;  4AKN A;  2DKW A;  5EPB A;  5D0C A;  4YBT A;  5DYX A;  5BT4 A;  5E7D A;  4UIU A;  4BW3 A;  4QY4 A;  4UYE A;  5EVA A;  3U5K A;  5LJ1 A;  4QR4 A;  3GG3 A;  4QR5 A;  3DAI A;  4QC1 A;  5HRW A;  5CGP A;  5F1L A;  4CLB A;  4LC2 A;  5I86 A;  5HM0 A;  4MR6 A;  4OUF A;  5CQ3 A;  5ENC A;  1X0J A;  4NR6 A;  5FE9 A;  4QSR A;  4A9O A;  5I88 A;  5D3T A;  5D3L A;  4N4G A;  4CUQ A;  4Z6I A;  3D7C A;  3UW9 A;  4NUD A;  5TCM A;  5FFY A;  3QZT A;  4QSX A;  5FE0 A;  3U5L A;  5FE6 A;  4PCI A;  5EU1 A;  4TQN A;  2LSP B;  5CQ8 A;  4NRB A;  4WIV A;  4YYM A;  1JSP B;  2OUO A;  3UVY A;  5LJ0 A;  2OO1 A;  5L8T A;  4C67 A;  5A5O A;  4CFK A;  5AME A;  5HEM A;  5CY9 A;  5EM3 A;  5EGU A;  5HJC A;  5FB0 A;  4UIX A;  3U5J A;  4UYG A;  5FH8 A;  4QSW A;  4N4I A;  4F3I A;  3QZV A;  5CS8 A;  4PKL A;  5KO4 A;  5E9Y A;  4HBW A;  5I29 A;  5CQA A;  2OSS A;  5FE2 A;  2WP2 A;  5C89 A;  5LKU A;  2N9G A;  2I8N A;  4Q0N A;  3G0L A;  2KTB B;  5CQT A;  5L8U A;  1JM4 B;  5ACY A;  4QYD A;  4LR6 A;  4NUC A;  3MUK A;  5F62 A;  3HMF A;  2YEM A;  4NR9 A;  5C8G A;  5LKT A;  4LYW A;  4UIT A;  4QR3 A;  5CFW A;  1WUG A;  5HFR A;  4OGI A;  4HBY A;  3IU6 A;  1ZS5 A;  4MR3 A;  4HXM A;  4LRG A;  5A5S A;  5FFV A;  4PTB A;  2E7O A;  3O37 A;  5A7C A;  4YAB A;  5A83 A;  4QNS A;  5A82 A;  5L98 A;  2L5E A;  4LZ2 A;  4YYK A;  5FDZ A;  3G0J A;  4LZR A;  3P1F A;  4Z93 A;  5I80 A;  5DYA A;  4BW4 A;  4NYX A;  5DKH A;  5JWM A;  4IR6 A;  4NRC A;  5A85 A;  5II1 A;  4XYA A;  4PY6 A;  5EIS A;  3U5N A;  4E96 A;  5LJ2 A;  4UYF A;  4TU6 A;  2NXB A;  1WUM A;  1EQF A;  2RS9 B;  4A9N A;  4HXN A;  4O7A A;  5CPE A;  4IOQ A;  4UIZ A;  5E9V A;  4GPJ A;  4LDF A;  4XY9 A;  2YYN A;  5DY7 A;  5EQ1 A;  4LYS A;  4QUU A;  3P1D A;  5DW2 A;  3O35 A;  4NYV A;  4O72 A;  4LZS A;  4UYH A;  5HRX A;  5A5R A;  5CRM A;  5DYU A;  4KCX A;  5C87 A;  4QSQ A;  3S91 A;  4IR3 A;  4NR7 A;  4YH4 A;  3AQA A;  3O36 A;  5FE1 A;  4YYN A;  5EWD A;  3MXF A;  4NS5 A;  5ENE A;  3LJW A;  5E9K A;  5I1Q A;  5CQ5 A;  2YW5 A;  4MEN A;  5ETD A;  4A9M A;  5CUD A;  3Q2E A;  5BT5 A;  5FG5 A;  5A5P A;  3LQI A;  4OGJ A;  2DWW A;  4Z1S A;  3P1C A;  4QEW A;  5F5Z A;  4HBX A;  4A9E A;  5DW1 A;  4YYJ A;  4O70 A;  4QSU A;  5CUG A;  5CUC A;  5II2 A;  4QEU A;  4YAT A;  5F61 A;  5E9I A;  5DLZ A;  5A5N A;  5HCL A;  3ONI A;  5FB1 A;  3DWY A;  5L96 A;  4YYI A;  5COI A;  2MJV B;  5D3J A;  4J1P A;  2DVQ A;  2RFJ A;  4NXJ A;  5G4R A;  4HXR A;  1N72 A;  4WHW A;  5CQ6 A;  5ENG A;  5HRV A;  5F3A A;  2RNY A;  4A9J A;  5F36 A;  5E0R A;  5DBM A;  5IID A;  4QST A;  4A9L A;  5K29 A;  3JVJ A;  4TT6 A;  4NRA A;  4TZ2 A;  5IGN A;  5EWH A;  5LUU A;  5CUB A;  4O7E A;  2YQD A;  5H1V A;  5D3R A;  5HEN A;  2FSA A;  3JVM A;  5F1H A;  5CQ4 A;  3HME A;  4CUP A;  4CUS A;  5EWC A;  3JVL A;  4TU4 A;  4YY6 A;  5F63 A;  4KV4 A;  4A9F A;  2DVR A;  4CUR A;  4XY8 A;  4C66 A;  3UV2 A;  4QEV A;  5ENJ A;  4MR5 A;  2E3K A;  5BT3 A;  4N3W A;  5HQ5 A;  4QZS A;  1E6I A;  4N4F A;  4HXK A;  4YBS A;  2F6N A;  4QBM A;  2H60 A;  2F6J A;  4O7C A;  5I7Y A;  5DLX A;  5HQ7 A;  4NQM A;  5HEL A;  5AMF A;  5DKC A;  4O77 A;  5LKX A;  5CU8 A;  3AAD A;  5ENB A;  4NR5 A;  5E3G A;  4J3I A;  4YC9 A;  4IR4 A;  5G4S A;  4A9K A;  3NXB A;  3O34 A;  3MUL A;  4QYL A;  5FE4 A;  5KHM A;  5H85 A;  5HQ6 A;  4HXP A;  4O76 A;  5F25 A;  4NUE A;  4X2I A;  5FH7 A;  4A9H A;  5HLS A;  4LYI A;  3I3J A;  2R0V A;  3Q2F A;  5ENH A;  3UVW A;  4ZW1 A;  5A81 A;  2RNW A;  2DVV A;  2L85 A;  4CUU A;  3K2J A;  3MB3 A;  4BW2 A;  5F2P A;  2R0S A;  5I83 A;  4A9I A;  4HXS A;  4O7F A;  4O74 A;  4Z1Q A;  5FFW A;  5D25 A;  2YEL A;  5EI4 A;  2L84 A;  3LQH A;  4N4H A;  3FKM X;  4BW1 A;  2GRC A;  5DX4 A;  5EIC A;  2R10 A;  5EA1 A;  4PS5 A;  4UIV A;  3U5O A;  4YY4 A;  5D3N A;  5E9M A;  5CZG A;  4YK0 A;  5EWW A;  4QUT A;  5J0D A;  4O78 A;  4MEP A;  5IGM A;  4TT2 A;  5TB6 A;  4IOR A;  5DFB A;  4UYF B;  5LVR A;  4Y03 A;  3SVG A;  5DYC A;  3P5O A;  3S92 A;  4YH3 A;  4YYH A;  3MB4 A;  4O71 A;  4NQN A;  5D24 A;  5C7N A;  5IGL A;  4ZQL A;  2RO1 A;  3MQM A;  4TYL A;  2RI7 A;  4Z6H A;  5EK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...