2L85A

Solution nmr structures of cbp bromodomain with small molecule of hbs
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title A Small Molecule Binding to the Coactivator CREB-Binding Protein Blocks Apoptosis in Cardiomyocytes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2l85A00
2RI7A 3QZVA 4BW1A 2LSPB 2D82A 4Z1QA 4O7AA 5ETBA 5FE3A 4NYVA 4MR5A 5ENBA 5EGUA 5FE8A 2L5EA 5D3PA 5C85A 4PCIA 3D7CA 2WP1A 3GG3A 5CUGA 4J1PA 5DYXA 4NR8A 4PTBA 4UIYA 4UYDA 5COIA 4NXJA 5ENFA 4CFLA 5TB6A 5A5SA 4QSXA 5F36A 3SVHA 3UV2A 3P5OA 4IORA 4TU4A 3P1EA 5A83A 2E3KA 4CUUA 4HXMA 5FE7A 3IU5A 4QSVA 5FFYA 5A5RA 2OSSA 1EQFA 4LZSA 2E7NA 5CRMA 5C4QA 4QEVA 5DLZA 5KTWA 5LKUA 4TZ2A 5IGNA 5K29A 4XUAA 5D3HA 2L85A 3O36A 4YYJA 5DLXA 5L97A 2RS9B 4HBWA 5KTUA 3P1FA 2I7KA 4HXNA 4LYIA 4YYIA 5DYCA 5DY7A 5CY9A 5L99A 5KTXA 5CTLA 5I86A 3MXFA 5D25A 5AD2A 5EV9A 4QUTA 4UYFA 4CUTA 5FH6A 5EPRA 1WUGA 4QEUA 4YH3A 4KV1A 2R10A 1X0JA 3JVJA 3G0LA 4YBTA 5I7YA 4MR4A 4HXKA 4IR4A 4O71A 3MB3A 4QYDA 2DATA 4NR9A 5EPSA 4O72A 4NRCA 5FH7A 4QSSA 2YELA 2YYNA 3G0JA 5D3TA 4BW3A 5C89A 5CUBA 3JVLA 1N72A 4QY4A 4LRGA 3AQAA 5FB1A 4J0RA 4Q0NA 3ZYUA 4QSWA 2RNWA 5FBXA 4UYFB 5EPBA 5L96A 4O7FA 5FE2A 2RNYA 4TT2A 5HFQA 2RO1A 5HQ5A 3JVMA 3HMEA 3MUKA 4QC1A 2OO1A 2YW5A 5FE4A 5DBMA 5HCLA 5EWDA 5CQ8A 4NR7A 5CGPA 5J0DA 4LZRA 5H1VA 4PKLA 5F60A 3AADA 2F6JA 4UIZA 4Z93A 4N4FA 5EQ1A 4YYGA 4TYLA 4A9IA 4N4GA 5EWHA 5CQ5A 4Z6HA 5C7NA 2YEKA 4O74A 4MR6A 4MR3A 5E9MA 3DWYA 3SVGA 4HXPA 5KHMA 5C87A 4QB3A 2DWWA 3HMFA 4OGJA 4YATA 2I8NA 4YC9A 4NUCA 5CQTA 4YADA 3SVFA 5ETDA 5CZGA 4UIUA 3Q2FA 4F3IA 5CQ4A 5DKHA 4UYHA 3U5OA 5IGMA 4PY6A 5A7CA 5EI4A 5CUDA 5DFDA 2RNXA 4TU6A 5I83A 5EM3A 4UIWA 2F6NA 4QR4A 5CQ7A 3JVKA 2MJVB 5A5QA 4CLBA 5ENEA 5DKCA 5ENIA 4YAXA 4NR5A 5F25A 5DFCA 3LXJA 4NYWA 4QBMA 5IGLA 4QYLA 5BT5A 3UVWA 4QNSA 4J3IA 5EWWA 5KU3A 5EICA 4IOOA 4E96A 4MEPA 5E3DA 4A9KA 3LQIA 4BW2A 5G4SA 4HBXA 5D3LA 4N4IA 4LDFA 4ZW1A 5ENHA 3MQMA 5FFVA 4Q0OA 5ENJA 5IG6A 5D3SA 4YBMA 4PCEA 4QSQA 5CUEA 4XUBA 4XY8A 3U5KA 5AMFA 5JWMA 5F5ZA 4UIXA 3U5LA 2L84A 5A5NA 5D26A 4TZ8A 4NQNA 4WIVA 5CPEA 1JM4B 4HXRA 4QEWA 2OUOA 5KO4A 3UVDA 5F62A 4CUSA 4OGIA 5DYAA 5F3AA 4YYDA 5HQ7A 5D3JA 5CUCA 5E9YA 4UYGA 4MEQA 4PS5A 2DVVA 4A9NA 4HXLA 4IR3A 3QZTA 3FKMX 4NQMA 4QUUA 4BHWA 3IU6A 4IOQA 2NXBA 5CS8A 4C67A 4Z1SA 5FG6A 4A9OA 5IGKA 4RVRA 4J0SA 4LR6A 2H60A 3S91A 4IR6A 5E3GA 5D0CA 4YYMA 5F2PA 5II2A 5L8TA 3UVXA 3MB4A 4QSRA 5L98A 5C8GA 5F63A 4AKNA 4YYHA 5I88A 4HXOA 5LKZA 4A9EA 4LZ2A 4ALHA 5A5OA 4QSUA 5DYUA 5BT3A 2D9EA 5I80A 1WUMA 4O76A 4YYKA 5LUUA 3U5JA 5HEMA 4CFKA 3LQJA 5ENGA 3U5NA 4QR5A 4QZSA 4UYEA 5E9KA 5I7XA 4A9LA 5H1TA 3RCWA 4FLPA 3K2JA 3NXBA 5F1HA 5EK9A 5LJ2A 5CP5A 3O34A 5HRXA 5A5PA 4NR4A 4LYSA 2WP2A 5I40A 5BT4A 2YDWA 4NRBA 4TT4A 5FE5A 4WHUA 5HRVA 5L8UA 5E74A 5I29A 2FSAA 5HENA 5JI8A 3UV4A 4ZQLA 4YBSA 5EU1A 5LVQA 1JSPB 5CRZA 4O7CA 2R0YA 5H1UA 3QZSA 4GPJA 5D3RA 5E0RA 4YABA 3UVYA 4CURA 5FDZA 4CUQA 3DAIA 3P1CA 2R0SA 1E6IA 2YEMA 5CU8A 4QC3A 5I1QA 5E7DA 5DFBA 3MULA 4DONA 5FE6A 3UV5A 3HMHA 3O33A 1ZS5A 5CFWA 2G4AA 3U5MA 4KV4A 5E73A 4HBVA 5HRWA 2DVQA 3TLPA 4NUDA 5FB0A 4YY4A 4NR6A 5A85A 4MENA 5LVRA 2GRCA 5D3NA 5LKTA 5A82A 4TTEA 5LJ1A 3P1DA 5I89A 5DX4A 5EP7A 2DVRA 4QSTA 4LC2A 5HQ6A 5DW1A 4NS5A 5EA1A 5FFWA 4A9MA 2E7OA 3LJWA 4UIVA 2RFJA 5FE0A 5HM0A 4QSPA 2DKWA 5HFRA 4C66A 3O35A 5EWVA 5ENCA 4NYXA 5F61A 5EISA 4CUPA 2R0VA 5CQAA 4OUFA 2N9GA 4O77A 5A81A 4A9HA 5IBNA 4QR3A 3ONIA 5FG4A 4HBYA 4BW4A 4O7EA 5DW2A 4TQNA 5DKDA 5H85A 4IR5A 5AD3A 3I3JA 5LJ0A 5FE9A 5FE1A 3LQHA 5EWCA 3S92A 4YK0A 5HLSA 5AMEA 4NRAA 4O75A 3Q2EA 4A9FA 4XY9A 5CQ3A 4ZC9A 5TCMA 2DVSA 4HXSA 4O78A 5II1A 4TT6A 4WHWA 5IIDA 5ACYA 4O7BA 4BJXA 5CQ6A 5LKXA 4YYNA 1F68A 4O70A 4YH4A 3UW9A 4X2IA 5E9VA 4Y03A 5G4RA 4MEOA 4N4HA 3U5PA 2YQDA 4Z6IA 4A9JA 5D7XA 5E9LA 4ALGA 5D24A 2KTBB 5CUAA 5HELA 4UITA 4LYWA 5E9IA 4XYAA 4KCXA 3O37A 5F1LA 5HJCA 4CL9A 5FH8A 5EVAA 5FG5A 4TS8A 4YY6A 4N3WA 4NUEA
chains in the Genus database with same CATH superfamily
2RI7A 3QZVA 4BW1A 2LSPB 2D82A 4Z1QA 4O7AA 5ETBA 5FE3A 4NYVA 4MR5A 5ENBA 5EGUA 5FE8A 2L5EA 5D3PA 5C85A 4PCIA 3D7CA 2WP1A 3GG3A 5CUGA 4J1PA 5DYXA 4NR8A 4PTBA 4UIYA 3VKHA 4UYDA 5COIA 4NXJA 5ENFA 4CFLA 5TB6A 5A5SA 4QSXA 5F36A 3SVHA 3UV2A 3P5OA 4IORA 4TU4A 3P1EA 5A83A 2E3KA 4CUUA 1ZKRA 4HXMA 5FE7A 3IU5A 4QSVA 5FFYA 5A5RA 2OSSA 1EQFA 4LZSA 2E7NA 5CRMA 5C4QA 4QEVA 5DLZA 5KTWA 5LKUA 4TZ2A 5IGNA 5K29A 4XUAA 5D3HA 2L85A 3O36A 4YYJA 5DLXA 5L97A 2RS9B 4HBWA 5KTUA 3P1FA 2I7KA 4HXNA 4LYIA 4YYIA 5DYCA 5DY7A 5CY9A 5L99A 5KTXA 5CTLA 5I86A 3MXFA 5D25A 5AD2A 5EV9A 4QUTA 4UYFA 4CUTA 5FH6A 5EPRA 1WUGA 4QEUA 4YH3A 4KV1A 2R10A 1X0JA 3JVJA 3G0LA 4YBTA 5I7YA 4MR4A 4HXKA 4IR4A 4O71A 3MB3A 4QYDA 2DATA 4NR9A 5EPSA 4O72A 4NRCA 5FH7A 4QSSA 2YELA 2YYNA 3G0JA 5D3TA 4BW3A 5C89A 5CUBA 3JVLA 1N72A 4QY4A 4LRGA 3AQAA 5FB1A 4J0RA 4Q0NA 3ZYUA 4QSWA 2RNWA 5FBXA 4UYFB 5EPBA 5L96A 4O7FA 5FE2A 2RNYA 3D1BA 4TT2A 5HFQA 2RO1A 5HQ5A 3JVMA 3HMEA 3MUKA 4QC1A 2OO1A 2YW5A 5FE4A 5DBMA 5HCLA 5EWDA 5CQ8A 4AKIA 4NR7A 5CGPA 5J0DA 4LZRA 5H1VA 4PKLA 5F60A 3AADA 2F6JA 4UIZA 4Z93A 4N4FA 5EQ1A 4YYGA 4TYLA 4A9IA 4N4GA 5EWHA 5CQ5A 4Z6HA 5C7NA 2YEKA 4O74A 4MR6A 4MR3A 5E9MA 3DWYA 3SVGA 4HXPA 5KHMA 5C87A 4QB3A 2DWWA 3HMFA 4OGJA 4YATA 2I8NA 4YC9A 4NUCA 5CQTA 4YADA 3SVFA 4AKHA 5ETDA 5CZGA 4UIUA 3Q2FA 4F3IA 5CQ4A 5DKHA 4UYHA 3U5OA 5IGMA 4PY6A 5A7CA 5EI4A 5CUDA 5DFDA 2RNXA 4TU6A 5I83A 5EM3A 4UIWA 2F6NA 4QR4A 5CQ7A 3JVKA 2MJVB 5A5QA 4CLBA 5ENEA 5DKCA 5ENIA 4YAXA 4NR5A 5F25A 5DFCA 3LXJA 4NYWA 4QBMA 5IGLA 4QYLA 5BT5A 3UVWA 4QNSA 4J3IA 5EWWA 5KU3A 5EICA 4IOOA 4E96A 2EJNA 4MEPA 5E3DA 3LQIA 4A9KA 4BW2A 5G4SA 4HBXA 5D3LA 4N4IA 4LDFA 4ZW1A 5ENHA 3MQMA 5FFVA 4Q0OA 5ENJA 5IG6A 5D3SA 4YBMA 4PCEA 4QSQA 5CUEA 4XUBA 4XY8A 3U5KA 5AMFA 5JWMA 5F5ZA 4UIXA 3U5LA 2L84A 5A5NA 5D26A 4TZ8A 4NQNA 4WIVA 5CPEA 1JM4B 4HXRA 4QEWA 2OUOA 5KO4A 3UVDA 5F62A 4CUSA 4OGIA 5DYAA 3D1DA 5F3AA 4YYDA 5HQ7A 5D3JA 5CUCA 5E9YA 4UYGA 4MEQA 4PS5A 2DVVA 4A9NA 4HXLA 4IR3A 3QZTA 3FKMX 4NQMA 4AKGA 4QUUA 4BHWA 3IU6A 4IOQA 2NXBA 5CS8A 4C67A 4Z1SA 5FG6A 3VKGA 4A9OA 5IGKA 4RVRA 4J0SA 4LR6A 2H60A 3S91A 4IR6A 5E3GA 5D0CA 4YYMA 5F2PA 5II2A 5L8TA 3UVXA 3MB4A 4QSRA 5L98A 5C8GA 5F63A 4AKNA 4YYHA 5I88A 4HXOA 5LKZA 4A9EA 4LZ2A 4ALHA 5A5OA 4QSUA 5DYUA 5BT3A 2D9EA 5I80A 1WUMA 4O76A 4YYKA 5LUUA 3U5JA 5HEMA 4CFKA 3LQJA 5ENGA 3U5NA 4QR5A 4QZSA 4UYEA 5E9KA 5I7XA 4A9LA 5H1TA 3RCWA 4FLPA 3K2JA 3NXBA 5F1HA 5EK9A 5LJ2A 5CP5A 3O34A 5HRXA 5A5PA 4NR4A 4LYSA 1PUOA 2WP2A 5I40A 5BT4A 2YDWA 4NRBA 4TT4A 5FE5A 4WHUA 5HRVA 5L8UA 5E74A 5I29A 2FSAA 5HENA 5JI8A 3UV4A 4ZQLA 4YBSA 5EU1A 5LVQA 1JSPB 5CRZA 4O7CA 2R0YA 5H1UA 3QZSA 4GPJA 5D3RA 5E0RA 4YABA 3UVYA 4CURA 5FDZA 4CUQA 3DAIA 3P1CA 2R0SA 1E6IA 2YEMA 5CU8A 4QC3A 5I1QA 5E7DA 5DFBA 3MULA 4DONA 5FE6A 3UV5A 3HMHA 3O33A 1ZS5A 5CFWA 2G4AA 3U5MA 4KV4A 5E73A 4HBVA 5HRWA 2DVQA 3TLPA 4NUDA 5FB0A 4YY4A 4NR6A 5A85A 4MENA 5LVRA 2GRCA 5D3NA 5LKTA 5A82A 4TTEA 5LJ1A 3P1DA 5I89A 5DX4A 5EP7A 2DVRA 4QSTA 4LC2A 5HQ6A 5DW1A 4NS5A 5EA1A 5FFWA 4A9MA 2E7OA 3LJWA 4UIVA 2RFJA 3ERRA 5FE0A 5HM0A 4QSPA 2DKWA 5HFRA 4C66A 3O35A 5EWVA 5ENCA 4NYXA 5F61A 5EISA 4CUPA 2R0VA 5CQAA 4OUFA 2N9GA 4O77A 5A81A 4A9HA 5IBNA 4QR3A 3ONIA 5FG4A 4HBYA 4BW4A 4O7EA 5DW2A 4TQNA 5DKDA 5H85A 4IR5A 5AD3A 3I3JA 5LJ0A 5FE9A 5FE1A 3LQHA 5EWCA 3S92A 4YK0A 5HLSA 5AMEA 4AI6A 4NRAA 4O75A 3Q2EA 4A9FA 4XY9A 5CQ3A 4ZC9A 5TCMA 2DVSA 4HXSA 4O78A 5II1A 4TT6A 4WHWA 5IIDA 5ACYA 4O7BA 4BJXA 5CQ6A 5LKXA 4YYNA 1F68A 4O70A 4YH4A 3UW9A 4X2IA 5E9VA 4Y03A 5G4RA 4MEOA 4N4HA 3U5PA 2YQDA 4Z6IA 4A9JA 5D7XA 5E9LA 4ALGA 5D24A 2KTBB 5CUAA 5HELA 4UITA 4LYWA 5E9IA 4XYAA 4KCXA 3O37A 5F1LA 5HJCA 4CL9A 5FH8A 5EVAA 5FG5A 4TS8A 4YY6A 4N3WA 4NUEA
chains in the Genus database with same CATH topology
2RI7A 3QZVA 4BW1A 2LSPB 2D82A 4Z1QA 4O7AA 5ETBA 5FE3A 4NYVA 4MR5A 5ENBA 5EGUA 5FE8A 2L5EA 5D3PA 5C85A 4PCIA 3D7CA 2WP1A 3GG3A 5CUGA 4J1PA 5DYXA 4NR8A 4PTBA 4UIYA 4UYDA 5COIA 4NXJA 5ENFA 4CFLA 5TB6A 5A5SA 4QSXA 5F36A 3SVHA 3UV2A 3P5OA 4IORA 4TU4A 3P1EA 5A83A 2E3KA 4CUUA 4HXMA 5FE7A 3IU5A 4QSVA 5FFYA 5A5RA 2OSSA 1EQFA 4LZSA 2E7NA 5CRMA 5C4QA 4QEVA 5DLZA 5KTWA 5LKUA 4TZ2A 5IGNA 5K29A 4XUAA 5D3HA 2L85A 3O36A 4YYJA 5DLXA 5L97A 2RS9B 4HBWA 5KTUA 3P1FA 2I7KA 4HXNA 4LYIA 4YYIA 5DYCA 5DY7A 5CY9A 5L99A 5KTXA 5CTLA 5I86A 3MXFA 5D25A 5AD2A 5EV9A 4QUTA 4UYFA 4CUTA 5FH6A 5EPRA 1WUGA 4QEUA 4YH3A 4KV1A 2R10A 1X0JA 3JVJA 3G0LA 4YBTA 5I7YA 4MR4A 4HXKA 4IR4A 4O71A 3MB3A 4QYDA 2DATA 4NR9A 5EPSA 4O72A 4NRCA 5FH7A 4QSSA 2YELA 2YYNA 3G0JA 5D3TA 4BW3A 5C89A 5CUBA 3JVLA 1N72A 4QY4A 4LRGA 3AQAA 5FB1A 4J0RA 4Q0NA 3ZYUA 4QSWA 2RNWA 5FBXA 4UYFB 5EPBA 5L96A 4O7FA 5FE2A 2RNYA 4TT2A 5HFQA 2RO1A 5HQ5A 3JVMA 3HMEA 3MUKA 4QC1A 2OO1A 2YW5A 5FE4A 5DBMA 5HCLA 5EWDA 5CQ8A 4NR7A 5CGPA 5J0DA 4LZRA 5H1VA 4PKLA 5F60A 3AADA 2F6JA 4UIZA 4Z93A 4N4FA 5EQ1A 4YYGA 4TYLA 4A9IA 4N4GA 5EWHA 5CQ5A 4Z6HA 5C7NA 2YEKA 4O74A 4MR6A 4MR3A 5E9MA 3DWYA 3SVGA 4HXPA 5KHMA 5C87A 4QB3A 2DWWA 3HMFA 4OGJA 4YATA 2I8NA 4YC9A 4NUCA 5CQTA 4YADA 3SVFA 5ETDA 5CZGA 4UIUA 3Q2FA 4F3IA 5CQ4A 5DKHA 4UYHA 3U5OA 5IGMA 4PY6A 5A7CA 5EI4A 5CUDA 5DFDA 2RNXA 4TU6A 5I83A 5EM3A 4UIWA 2F6NA 4QR4A 5CQ7A 3JVKA 2MJVB 5A5QA 4CLBA 5ENEA 5DKCA 5ENIA 4YAXA 4NR5A 5F25A 5DFCA 3LXJA 4NYWA 4QBMA 5IGLA 4QYLA 5BT5A 3UVWA 4QNSA 4J3IA 5EWWA 5KU3A 5EICA 4IOOA 4E96A 4MEPA 5E3DA 4A9KA 3LQIA 4BW2A 5G4SA 4HBXA 5D3LA 4N4IA 4LDFA 4ZW1A 5ENHA 3MQMA 5FFVA 4Q0OA 5ENJA 5IG6A 5D3SA 4YBMA 4PCEA 4QSQA 5CUEA 4XUBA 4XY8A 3U5KA 5AMFA 5JWMA 5F5ZA 4UIXA 3U5LA 2L84A 5A5NA 5D26A 4TZ8A 4NQNA 4WIVA 5CPEA 1JM4B 4HXRA 4QEWA 2OUOA 5KO4A 3UVDA 5F62A 4CUSA 4OGIA 5DYAA 5F3AA 4YYDA 5HQ7A 5D3JA 5CUCA 5E9YA 4UYGA 4MEQA 4PS5A 2DVVA 4A9NA 4HXLA 4IR3A 3QZTA 3FKMX 4NQMA 4QUUA 4BHWA 3IU6A 4IOQA 2NXBA 5CS8A 4C67A 4Z1SA 5FG6A 4A9OA 5IGKA 4RVRA 4J0SA 4LR6A 2H60A 3S91A 4IR6A 5E3GA 5D0CA 4YYMA 5F2PA 5II2A 5L8TA 3UVXA 3MB4A 4QSRA 5L98A 5C8GA 5F63A 4AKNA 4YYHA 5I88A 4HXOA 5LKZA 4A9EA 4LZ2A 4ALHA 5A5OA 4QSUA 5DYUA 5BT3A 2D9EA 5I80A 1WUMA 4O76A 4YYKA 5LUUA 3U5JA 5HEMA 4CFKA 3LQJA 5ENGA 3U5NA 4QR5A 4QZSA 4UYEA 5E9KA 5I7XA 4A9LA 5H1TA 3RCWA 4FLPA 3K2JA 3NXBA 5F1HA 5EK9A 5LJ2A 5CP5A 3O34A 5HRXA 5A5PA 4NR4A 4LYSA 2WP2A 5I40A 5BT4A 2YDWA 4NRBA 4TT4A 5FE5A 4WHUA 5HRVA 5L8UA 5E74A 5I29A 2FSAA 5HENA 5JI8A 3UV4A 4ZQLA 4YBSA 5EU1A 5LVQA 1JSPB 5CRZA 4O7CA 2R0YA 5H1UA 3QZSA 4GPJA 5D3RA 5E0RA 4YABA 3UVYA 4CURA 5FDZA 4CUQA 3DAIA 3P1CA 2R0SA 1E6IA 2YEMA 5CU8A 4QC3A 5I1QA 5E7DA 5DFBA 3MULA 4DONA 5FE6A 3UV5A 3HMHA 3O33A 1ZS5A 5CFWA 2G4AA 3U5MA 4KV4A 5E73A 4HBVA 5HRWA 2DVQA 3TLPA 4NUDA 5FB0A 4YY4A 4NR6A 5A85A 4MENA 5LVRA 2GRCA 5D3NA 5LKTA 5A82A 4TTEA 5LJ1A 3P1DA 5I89A 5DX4A 5EP7A 2DVRA 4QSTA 4LC2A 5HQ6A 5DW1A 4NS5A 5EA1A 5FFWA 4A9MA 2E7OA 3LJWA 4UIVA 2RFJA 5FE0A 5HM0A 4QSPA 2DKWA 5HFRA 4C66A 3O35A 5EWVA 5ENCA 4NYXA 5F61A 5EISA 4CUPA 2R0VA 5CQAA 4OUFA 2N9GA 4O77A 5A81A 4A9HA 5IBNA 4QR3A 3ONIA 5FG4A 4HBYA 4BW4A 4O7EA 5DW2A 4TQNA 5DKDA 5H85A 4IR5A 5AD3A 3I3JA 5LJ0A 5FE9A 5FE1A 3LQHA 5EWCA 3S92A 4YK0A 5HLSA 5AMEA 4NRAA 4O75A 3Q2EA 4A9FA 4XY9A 5CQ3A 4ZC9A 5TCMA 2DVSA 4HXSA 4O78A 5II1A 4TT6A 4WHWA 5IIDA 5ACYA 4O7BA 4BJXA 5CQ6A 5LKXA 4YYNA 1F68A 4O70A 4YH4A 3UW9A 4X2IA 5E9VA 4Y03A 5G4RA 4MEOA 4N4HA 3U5PA 2YQDA 4Z6IA 4A9JA 5D7XA 5E9LA 4ALGA 5D24A 2KTBB 5CUAA 5HELA 4UITA 4LYWA 5E9IA 4XYAA 4KCXA 3O37A 5F1LA 5HJCA 4CL9A 5FH8A 5EVAA 5FG5A 4TS8A 4YY6A 4N3WA 4NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI7 A;  3QZV A;  4BW1 A;  2LSP B;  2D82 A;  4Z1Q A;  4O7A A;  5ETB A;  5FE3 A;  4NYV A;  4MR5 A;  5ENB A;  5EGU A;  5FE8 A;  2L5E A;  5D3P A;  5C85 A;  4PCI A;  3D7C A;  2WP1 A;  3GG3 A;  5CUG A;  4J1P A;  5DYX A;  4NR8 A;  4PTB A;  4UIY A;  4UYD A;  5COI A;  4NXJ A;  5ENF A;  4CFL A;  5TB6 A;  5A5S A;  4QSX A;  5F36 A;  3SVH A;  3UV2 A;  3P5O A;  4IOR A;  4TU4 A;  3P1E A;  5A83 A;  2E3K A;  4CUU A;  4HXM A;  5FE7 A;  3IU5 A;  4QSV A;  5FFY A;  5A5R A;  2OSS A;  1EQF A;  4LZS A;  2E7N A;  5CRM A;  5C4Q A;  4QEV A;  5DLZ A;  5KTW A;  5LKU A;  4TZ2 A;  5IGN A;  5K29 A;  4XUA A;  5D3H A;  2L85 A;  3O36 A;  4YYJ A;  5DLX A;  5L97 A;  2RS9 B;  4HBW A;  5KTU A;  3P1F A;  2I7K A;  4HXN A;  4LYI A;  4YYI A;  5DYC A;  5DY7 A;  5CY9 A;  5L99 A;  5KTX A;  5CTL A;  5I86 A;  3MXF A;  5D25 A;  5AD2 A;  5EV9 A;  4QUT A;  4UYF A;  4CUT A;  5FH6 A;  5EPR A;  1WUG A;  4QEU A;  4YH3 A;  4KV1 A;  2R10 A;  1X0J A;  3JVJ A;  3G0L A;  4YBT A;  5I7Y A;  4MR4 A;  4HXK A;  4IR4 A;  4O71 A;  3MB3 A;  4QYD A;  2DAT A;  4NR9 A;  5EPS A;  4O72 A;  4NRC A;  5FH7 A;  4QSS A;  2YEL A;  2YYN A;  3G0J A;  5D3T A;  4BW3 A;  5C89 A;  5CUB A;  3JVL A;  1N72 A;  4QY4 A;  4LRG A;  3AQA A;  5FB1 A;  4J0R A;  4Q0N A;  3ZYU A;  4QSW A;  2RNW A;  5FBX A;  4UYF B;  5EPB A;  5L96 A;  4O7F A;  5FE2 A;  2RNY A;  4TT2 A;  5HFQ A;  2RO1 A;  5HQ5 A;  3JVM A;  3HME A;  3MUK A;  4QC1 A;  2OO1 A;  2YW5 A;  5FE4 A;  5DBM A;  5HCL A;  5EWD A;  5CQ8 A;  4NR7 A;  5CGP A;  5J0D A;  4LZR A;  5H1V A;  4PKL A;  5F60 A;  3AAD A;  2F6J A;  4UIZ A;  4Z93 A;  4N4F A;  5EQ1 A;  4YYG A;  4TYL A;  4A9I A;  4N4G A;  5EWH A;  5CQ5 A;  4Z6H A;  5C7N A;  2YEK A;  4O74 A;  4MR6 A;  4MR3 A;  5E9M A;  3DWY A;  3SVG A;  4HXP A;  5KHM A;  5C87 A;  4QB3 A;  2DWW A;  3HMF A;  4OGJ A;  4YAT A;  2I8N A;  4YC9 A;  4NUC A;  5CQT A;  4YAD A;  3SVF A;  5ETD A;  5CZG A;  4UIU A;  3Q2F A;  4F3I A;  5CQ4 A;  5DKH A;  4UYH A;  3U5O A;  5IGM A;  4PY6 A;  5A7C A;  5EI4 A;  5CUD A;  5DFD A;  2RNX A;  4TU6 A;  5I83 A;  5EM3 A;  4UIW A;  2F6N A;  4QR4 A;  5CQ7 A;  3JVK A;  2MJV B;  5A5Q A;  4CLB A;  5ENE A;  5DKC A;  5ENI A;  4YAX A;  4NR5 A;  5F25 A;  5DFC A;  3LXJ A;  4NYW A;  4QBM A;  5IGL A;  4QYL A;  5BT5 A;  3UVW A;  4QNS A;  4J3I A;  5EWW A;  5KU3 A;  5EIC A;  4IOO A;  4E96 A;  4MEP A;  5E3D A;  4A9K A;  3LQI A;  4BW2 A;  5G4S A;  4HBX A;  5D3L A;  4N4I A;  4LDF A;  4ZW1 A;  5ENH A;  3MQM A;  5FFV A;  4Q0O A;  5ENJ A;  5IG6 A;  5D3S A;  4YBM A;  4PCE A;  4QSQ A;  5CUE A;  4XUB A;  4XY8 A;  3U5K A;  5AMF A;  5JWM A;  5F5Z A;  4UIX A;  3U5L A;  2L84 A;  5A5N A;  5D26 A;  4TZ8 A;  4NQN A;  4WIV A;  5CPE A;  1JM4 B;  4HXR A;  4QEW A;  2OUO A;  5KO4 A;  3UVD A;  5F62 A;  4CUS A;  4OGI A;  5DYA A;  5F3A A;  4YYD A;  5HQ7 A;  5D3J A;  5CUC A;  5E9Y A;  4UYG A;  4MEQ A;  4PS5 A;  2DVV A;  4A9N A;  4HXL A;  4IR3 A;  3QZT A;  3FKM X;  4NQM A;  4QUU A;  4BHW A;  3IU6 A;  4IOQ A;  2NXB A;  5CS8 A;  4C67 A;  4Z1S A;  5FG6 A;  4A9O A;  5IGK A;  4RVR A;  4J0S A;  4LR6 A;  2H60 A;  3S91 A;  4IR6 A;  5E3G A;  5D0C A;  4YYM A;  5F2P A;  5II2 A;  5L8T A;  3UVX A;  3MB4 A;  4QSR A;  5L98 A;  5C8G A;  5F63 A;  4AKN A;  4YYH A;  5I88 A;  4HXO A;  5LKZ A;  4A9E A;  4LZ2 A;  4ALH A;  5A5O A;  4QSU A;  5DYU A;  5BT3 A;  2D9E A;  5I80 A;  1WUM A;  4O76 A;  4YYK A;  5LUU A;  3U5J A;  5HEM A;  4CFK A;  3LQJ A;  5ENG A;  3U5N A;  4QR5 A;  4QZS A;  4UYE A;  5E9K A;  5I7X A;  4A9L A;  5H1T A;  3RCW A;  4FLP A;  3K2J A;  3NXB A;  5F1H A;  5EK9 A;  5LJ2 A;  5CP5 A;  3O34 A;  5HRX A;  5A5P A;  4NR4 A;  4LYS A;  2WP2 A;  5I40 A;  5BT4 A;  2YDW A;  4NRB A;  4TT4 A;  5FE5 A;  4WHU A;  5HRV A;  5L8U A;  5E74 A;  5I29 A;  2FSA A;  5HEN A;  5JI8 A;  3UV4 A;  4ZQL A;  4YBS A;  5EU1 A;  5LVQ A;  1JSP B;  5CRZ A;  4O7C A;  2R0Y A;  5H1U A;  3QZS A;  4GPJ A;  5D3R A;  5E0R A;  4YAB A;  3UVY A;  4CUR A;  5FDZ A;  4CUQ A;  3DAI A;  3P1C A;  2R0S A;  1E6I A;  2YEM A;  5CU8 A;  4QC3 A;  5I1Q A;  5E7D A;  5DFB A;  3MUL A;  4DON A;  5FE6 A;  3UV5 A;  3HMH A;  3O33 A;  1ZS5 A;  5CFW A;  2G4A A;  3U5M A;  4KV4 A;  5E73 A;  4HBV A;  5HRW A;  2DVQ A;  3TLP A;  4NUD A;  5FB0 A;  4YY4 A;  4NR6 A;  5A85 A;  4MEN A;  5LVR A;  2GRC A;  5D3N A;  5LKT A;  5A82 A;  4TTE A;  5LJ1 A;  3P1D A;  5I89 A;  5DX4 A;  5EP7 A;  2DVR A;  4QST A;  4LC2 A;  5HQ6 A;  5DW1 A;  4NS5 A;  5EA1 A;  5FFW A;  4A9M A;  2E7O A;  3LJW A;  4UIV A;  2RFJ A;  5FE0 A;  5HM0 A;  4QSP A;  2DKW A;  5HFR A;  4C66 A;  3O35 A;  5EWV A;  5ENC A;  4NYX A;  5F61 A;  5EIS A;  4CUP A;  2R0V A;  5CQA A;  4OUF A;  2N9G A;  4O77 A;  5A81 A;  4A9H A;  5IBN A;  4QR3 A;  3ONI A;  5FG4 A;  4HBY A;  4BW4 A;  4O7E A;  5DW2 A;  4TQN A;  5DKD A;  5H85 A;  4IR5 A;  5AD3 A;  3I3J A;  5LJ0 A;  5FE9 A;  5FE1 A;  3LQH A;  5EWC A;  3S92 A;  4YK0 A;  5HLS A;  5AME A;  4NRA A;  4O75 A;  3Q2E A;  4A9F A;  4XY9 A;  5CQ3 A;  4ZC9 A;  5TCM A;  2DVS A;  4HXS A;  4O78 A;  5II1 A;  4TT6 A;  4WHW A;  5IID A;  5ACY A;  4O7B A;  4BJX A;  5CQ6 A;  5LKX A;  4YYN A;  1F68 A;  4O70 A;  4YH4 A;  3UW9 A;  4X2I A;  5E9V A;  4Y03 A;  5G4R A;  4MEO A;  4N4H A;  3U5P A;  2YQD A;  4Z6I A;  4A9J A;  5D7X A;  5E9L A;  4ALG A;  5D24 A;  2KTB B;  5CUA A;  5HEL A;  4UIT A;  4LYW A;  5E9I A;  4XYA A;  4KCX A;  3O37 A;  5F1L A;  5HJC A;  4CL9 A;  5FH8 A;  5EVA A;  5FG5 A;  4TS8 A;  4YY6 A;  4N3W A;  4NUE A; 
#chains in the Genus database with same CATH topology
 2RI7 A;  3QZV A;  4BW1 A;  2LSP B;  2D82 A;  4Z1Q A;  4O7A A;  5ETB A;  5FE3 A;  4NYV A;  4MR5 A;  5ENB A;  5EGU A;  5FE8 A;  2L5E A;  5D3P A;  5C85 A;  4PCI A;  3D7C A;  2WP1 A;  3GG3 A;  5CUG A;  4J1P A;  5DYX A;  4NR8 A;  4PTB A;  4UIY A;  3VKH A;  4UYD A;  5COI A;  4NXJ A;  5ENF A;  4CFL A;  5TB6 A;  5A5S A;  4QSX A;  5F36 A;  3SVH A;  3UV2 A;  3P5O A;  4IOR A;  4TU4 A;  3P1E A;  5A83 A;  2E3K A;  4CUU A;  1ZKR A;  4HXM A;  5FE7 A;  3IU5 A;  4QSV A;  5FFY A;  5A5R A;  2OSS A;  1EQF A;  4LZS A;  2E7N A;  5CRM A;  5C4Q A;  4QEV A;  5DLZ A;  5KTW A;  5LKU A;  4TZ2 A;  5IGN A;  5K29 A;  4XUA A;  5D3H A;  2L85 A;  3O36 A;  4YYJ A;  5DLX A;  5L97 A;  2RS9 B;  4HBW A;  5KTU A;  3P1F A;  2I7K A;  4HXN A;  4LYI A;  4YYI A;  5DYC A;  5DY7 A;  5CY9 A;  5L99 A;  5KTX A;  5CTL A;  5I86 A;  3MXF A;  5D25 A;  5AD2 A;  5EV9 A;  4QUT A;  4UYF A;  4CUT A;  5FH6 A;  5EPR A;  1WUG A;  4QEU A;  4YH3 A;  4KV1 A;  2R10 A;  1X0J A;  3JVJ A;  3G0L A;  4YBT A;  5I7Y A;  4MR4 A;  4HXK A;  4IR4 A;  4O71 A;  3MB3 A;  4QYD A;  2DAT A;  4NR9 A;  5EPS A;  4O72 A;  4NRC A;  5FH7 A;  4QSS A;  2YEL A;  2YYN A;  3G0J A;  5D3T A;  4BW3 A;  5C89 A;  5CUB A;  3JVL A;  1N72 A;  4QY4 A;  4LRG A;  3AQA A;  5FB1 A;  4J0R A;  4Q0N A;  3ZYU A;  4QSW A;  2RNW A;  5FBX A;  4UYF B;  5EPB A;  5L96 A;  4O7F A;  5FE2 A;  2RNY A;  3D1B A;  4TT2 A;  5HFQ A;  2RO1 A;  5HQ5 A;  3JVM A;  3HME A;  3MUK A;  4QC1 A;  2OO1 A;  2YW5 A;  5FE4 A;  5DBM A;  5HCL A;  5EWD A;  5CQ8 A;  4AKI A;  4NR7 A;  5CGP A;  5J0D A;  4LZR A;  5H1V A;  4PKL A;  5F60 A;  3AAD A;  2F6J A;  4UIZ A;  4Z93 A;  4N4F A;  5EQ1 A;  4YYG A;  4TYL A;  4A9I A;  4N4G A;  5EWH A;  5CQ5 A;  4Z6H A;  5C7N A;  2YEK A;  4O74 A;  4MR6 A;  4MR3 A;  5E9M A;  3DWY A;  3SVG A;  4HXP A;  5KHM A;  5C87 A;  4QB3 A;  2DWW A;  3HMF A;  4OGJ A;  4YAT A;  2I8N A;  4YC9 A;  4NUC A;  5CQT A;  4YAD A;  3SVF A;  4AKH A;  5ETD A;  5CZG A;  4UIU A;  3Q2F A;  4F3I A;  5CQ4 A;  5DKH A;  4UYH A;  3U5O A;  5IGM A;  4PY6 A;  5A7C A;  5EI4 A;  5CUD A;  5DFD A;  2RNX A;  4TU6 A;  5I83 A;  5EM3 A;  4UIW A;  2F6N A;  4QR4 A;  5CQ7 A;  3JVK A;  2MJV B;  5A5Q A;  4CLB A;  5ENE A;  5DKC A;  5ENI A;  4YAX A;  4NR5 A;  5F25 A;  5DFC A;  3LXJ A;  4NYW A;  4QBM A;  5IGL A;  4QYL A;  5BT5 A;  3UVW A;  4QNS A;  4J3I A;  5EWW A;  5KU3 A;  5EIC A;  4IOO A;  4E96 A;  2EJN A;  4MEP A;  5E3D A;  3LQI A;  4A9K A;  4BW2 A;  5G4S A;  4HBX A;  5D3L A;  4N4I A;  4LDF A;  4ZW1 A;  5ENH A;  3MQM A;  5FFV A;  4Q0O A;  5ENJ A;  5IG6 A;  5D3S A;  4YBM A;  4PCE A;  4QSQ A;  5CUE A;  4XUB A;  4XY8 A;  3U5K A;  5AMF A;  5JWM A;  5F5Z A;  4UIX A;  3U5L A;  2L84 A;  5A5N A;  5D26 A;  4TZ8 A;  4NQN A;  4WIV A;  5CPE A;  1JM4 B;  4HXR A;  4QEW A;  2OUO A;  5KO4 A;  3UVD A;  5F62 A;  4CUS A;  4OGI A;  5DYA A;  3D1D A;  5F3A A;  4YYD A;  5HQ7 A;  5D3J A;  5CUC A;  5E9Y A;  4UYG A;  4MEQ A;  4PS5 A;  2DVV A;  4A9N A;  4HXL A;  4IR3 A;  3QZT A;  3FKM X;  4NQM A;  4AKG A;  4QUU A;  4BHW A;  3IU6 A;  4IOQ A;  2NXB A;  5CS8 A;  4C67 A;  4Z1S A;  5FG6 A;  3VKG A;  4A9O A;  5IGK A;  4RVR A;  4J0S A;  4LR6 A;  2H60 A;  3S91 A;  4IR6 A;  5E3G A;  5D0C A;  4YYM A;  5F2P A;  5II2 A;  5L8T A;  3UVX A;  3MB4 A;  4QSR A;  5L98 A;  5C8G A;  5F63 A;  4AKN A;  4YYH A;  5I88 A;  4HXO A;  5LKZ A;  4A9E A;  4LZ2 A;  4ALH A;  5A5O A;  4QSU A;  5DYU A;  5BT3 A;  2D9E A;  5I80 A;  1WUM A;  4O76 A;  4YYK A;  5LUU A;  3U5J A;  5HEM A;  4CFK A;  3LQJ A;  5ENG A;  3U5N A;  4QR5 A;  4QZS A;  4UYE A;  5E9K A;  5I7X A;  4A9L A;  5H1T A;  3RCW A;  4FLP A;  3K2J A;  3NXB A;  5F1H A;  5EK9 A;  5LJ2 A;  5CP5 A;  3O34 A;  5HRX A;  5A5P A;  4NR4 A;  4LYS A;  1PUO A;  2WP2 A;  5I40 A;  5BT4 A;  2YDW A;  4NRB A;  4TT4 A;  5FE5 A;  4WHU A;  5HRV A;  5L8U A;  5E74 A;  5I29 A;  2FSA A;  5HEN A;  5JI8 A;  3UV4 A;  4ZQL A;  4YBS A;  5EU1 A;  5LVQ A;  1JSP B;  5CRZ A;  4O7C A;  2R0Y A;  5H1U A;  3QZS A;  4GPJ A;  5D3R A;  5E0R A;  4YAB A;  3UVY A;  4CUR A;  5FDZ A;  4CUQ A;  3DAI A;  3P1C A;  2R0S A;  1E6I A;  2YEM A;  5CU8 A;  4QC3 A;  5I1Q A;  5E7D A;  5DFB A;  3MUL A;  4DON A;  5FE6 A;  3UV5 A;  3HMH A;  3O33 A;  1ZS5 A;  5CFW A;  2G4A A;  3U5M A;  4KV4 A;  5E73 A;  4HBV A;  5HRW A;  2DVQ A;  3TLP A;  4NUD A;  5FB0 A;  4YY4 A;  4NR6 A;  5A85 A;  4MEN A;  5LVR A;  2GRC A;  5D3N A;  5LKT A;  5A82 A;  4TTE A;  5LJ1 A;  3P1D A;  5I89 A;  5DX4 A;  5EP7 A;  2DVR A;  4QST A;  4LC2 A;  5HQ6 A;  5DW1 A;  4NS5 A;  5EA1 A;  5FFW A;  4A9M A;  2E7O A;  3LJW A;  4UIV A;  2RFJ A;  3ERR A;  5FE0 A;  5HM0 A;  4QSP A;  2DKW A;  5HFR A;  4C66 A;  3O35 A;  5EWV A;  5ENC A;  4NYX A;  5F61 A;  5EIS A;  4CUP A;  2R0V A;  5CQA A;  4OUF A;  2N9G A;  4O77 A;  5A81 A;  4A9H A;  5IBN A;  4QR3 A;  3ONI A;  5FG4 A;  4HBY A;  4BW4 A;  4O7E A;  5DW2 A;  4TQN A;  5DKD A;  5H85 A;  4IR5 A;  5AD3 A;  3I3J A;  5LJ0 A;  5FE9 A;  5FE1 A;  3LQH A;  5EWC A;  3S92 A;  4YK0 A;  5HLS A;  5AME A;  4AI6 A;  4NRA A;  4O75 A;  3Q2E A;  4A9F A;  4XY9 A;  5CQ3 A;  4ZC9 A;  5TCM A;  2DVS A;  4HXS A;  4O78 A;  5II1 A;  4TT6 A;  4WHW A;  5IID A;  5ACY A;  4O7B A;  4BJX A;  5CQ6 A;  5LKX A;  4YYN A;  1F68 A;  4O70 A;  4YH4 A;  3UW9 A;  4X2I A;  5E9V A;  4Y03 A;  5G4R A;  4MEO A;  4N4H A;  3U5P A;  2YQD A;  4Z6I A;  4A9J A;  5D7X A;  5E9L A;  4ALG A;  5D24 A;  2KTB B;  5CUA A;  5HEL A;  4UIT A;  4LYW A;  5E9I A;  4XYA A;  4KCX A;  3O37 A;  5F1L A;  5HJC A;  4CL9 A;  5FH8 A;  5EVA A;  5FG5 A;  4TS8 A;  4YY6 A;  4N3W A;  4NUE A; 
#chains in the Genus database with same CATH homology
 2RI7 A;  3QZV A;  4BW1 A;  2LSP B;  2D82 A;  4Z1Q A;  4O7A A;  5ETB A;  5FE3 A;  4NYV A;  4MR5 A;  5ENB A;  5EGU A;  5FE8 A;  2L5E A;  5D3P A;  5C85 A;  4PCI A;  3D7C A;  2WP1 A;  3GG3 A;  5CUG A;  4J1P A;  5DYX A;  4NR8 A;  4PTB A;  4UIY A;  4UYD A;  5COI A;  4NXJ A;  5ENF A;  4CFL A;  5TB6 A;  5A5S A;  4QSX A;  5F36 A;  3SVH A;  3UV2 A;  3P5O A;  4IOR A;  4TU4 A;  3P1E A;  5A83 A;  2E3K A;  4CUU A;  4HXM A;  5FE7 A;  3IU5 A;  4QSV A;  5FFY A;  5A5R A;  2OSS A;  1EQF A;  4LZS A;  2E7N A;  5CRM A;  5C4Q A;  4QEV A;  5DLZ A;  5KTW A;  5LKU A;  4TZ2 A;  5IGN A;  5K29 A;  4XUA A;  5D3H A;  2L85 A;  3O36 A;  4YYJ A;  5DLX A;  5L97 A;  2RS9 B;  4HBW A;  5KTU A;  3P1F A;  2I7K A;  4HXN A;  4LYI A;  4YYI A;  5DYC A;  5DY7 A;  5CY9 A;  5L99 A;  5KTX A;  5CTL A;  5I86 A;  3MXF A;  5D25 A;  5AD2 A;  5EV9 A;  4QUT A;  4UYF A;  4CUT A;  5FH6 A;  5EPR A;  1WUG A;  4QEU A;  4YH3 A;  4KV1 A;  2R10 A;  1X0J A;  3JVJ A;  3G0L A;  4YBT A;  5I7Y A;  4MR4 A;  4HXK A;  4IR4 A;  4O71 A;  3MB3 A;  4QYD A;  2DAT A;  4NR9 A;  5EPS A;  4O72 A;  4NRC A;  5FH7 A;  4QSS A;  2YEL A;  2YYN A;  3G0J A;  5D3T A;  4BW3 A;  5C89 A;  5CUB A;  3JVL A;  1N72 A;  4QY4 A;  4LRG A;  3AQA A;  5FB1 A;  4J0R A;  4Q0N A;  3ZYU A;  4QSW A;  2RNW A;  5FBX A;  4UYF B;  5EPB A;  5L96 A;  4O7F A;  5FE2 A;  2RNY A;  4TT2 A;  5HFQ A;  2RO1 A;  5HQ5 A;  3JVM A;  3HME A;  3MUK A;  4QC1 A;  2OO1 A;  2YW5 A;  5FE4 A;  5DBM A;  5HCL A;  5EWD A;  5CQ8 A;  4NR7 A;  5CGP A;  5J0D A;  4LZR A;  5H1V A;  4PKL A;  5F60 A;  3AAD A;  2F6J A;  4UIZ A;  4Z93 A;  4N4F A;  5EQ1 A;  4YYG A;  4TYL A;  4A9I A;  4N4G A;  5EWH A;  5CQ5 A;  4Z6H A;  5C7N A;  2YEK A;  4O74 A;  4MR6 A;  4MR3 A;  5E9M A;  3DWY A;  3SVG A;  4HXP A;  5KHM A;  5C87 A;  4QB3 A;  2DWW A;  3HMF A;  4OGJ A;  4YAT A;  2I8N A;  4YC9 A;  4NUC A;  5CQT A;  4YAD A;  3SVF A;  5ETD A;  5CZG A;  4UIU A;  3Q2F A;  4F3I A;  5CQ4 A;  5DKH A;  4UYH A;  3U5O A;  5IGM A;  4PY6 A;  5A7C A;  5EI4 A;  5CUD A;  5DFD A;  2RNX A;  4TU6 A;  5I83 A;  5EM3 A;  4UIW A;  2F6N A;  4QR4 A;  5CQ7 A;  3JVK A;  2MJV B;  5A5Q A;  4CLB A;  5ENE A;  5DKC A;  5ENI A;  4YAX A;  4NR5 A;  5F25 A;  5DFC A;  3LXJ A;  4NYW A;  4QBM A;  5IGL A;  4QYL A;  5BT5 A;  3UVW A;  4QNS A;  4J3I A;  5EWW A;  5KU3 A;  5EIC A;  4IOO A;  4E96 A;  4MEP A;  5E3D A;  4A9K A;  3LQI A;  4BW2 A;  5G4S A;  4HBX A;  5D3L A;  4N4I A;  4LDF A;  4ZW1 A;  5ENH A;  3MQM A;  5FFV A;  4Q0O A;  5ENJ A;  5IG6 A;  5D3S A;  4YBM A;  4PCE A;  4QSQ A;  5CUE A;  4XUB A;  4XY8 A;  3U5K A;  5AMF A;  5JWM A;  5F5Z A;  4UIX A;  3U5L A;  2L84 A;  5A5N A;  5D26 A;  4TZ8 A;  4NQN A;  4WIV A;  5CPE A;  1JM4 B;  4HXR A;  4QEW A;  2OUO A;  5KO4 A;  3UVD A;  5F62 A;  4CUS A;  4OGI A;  5DYA A;  5F3A A;  4YYD A;  5HQ7 A;  5D3J A;  5CUC A;  5E9Y A;  4UYG A;  4MEQ A;  4PS5 A;  2DVV A;  4A9N A;  4HXL A;  4IR3 A;  3QZT A;  3FKM X;  4NQM A;  4QUU A;  4BHW A;  3IU6 A;  4IOQ A;  2NXB A;  5CS8 A;  4C67 A;  4Z1S A;  5FG6 A;  4A9O A;  5IGK A;  4RVR A;  4J0S A;  4LR6 A;  2H60 A;  3S91 A;  4IR6 A;  5E3G A;  5D0C A;  4YYM A;  5F2P A;  5II2 A;  5L8T A;  3UVX A;  3MB4 A;  4QSR A;  5L98 A;  5C8G A;  5F63 A;  4AKN A;  4YYH A;  5I88 A;  4HXO A;  5LKZ A;  4A9E A;  4LZ2 A;  4ALH A;  5A5O A;  4QSU A;  5DYU A;  5BT3 A;  2D9E A;  5I80 A;  1WUM A;  4O76 A;  4YYK A;  5LUU A;  3U5J A;  5HEM A;  4CFK A;  3LQJ A;  5ENG A;  3U5N A;  4QR5 A;  4QZS A;  4UYE A;  5E9K A;  5I7X A;  4A9L A;  5H1T A;  3RCW A;  4FLP A;  3K2J A;  3NXB A;  5F1H A;  5EK9 A;  5LJ2 A;  5CP5 A;  3O34 A;  5HRX A;  5A5P A;  4NR4 A;  4LYS A;  2WP2 A;  5I40 A;  5BT4 A;  2YDW A;  4NRB A;  4TT4 A;  5FE5 A;  4WHU A;  5HRV A;  5L8U A;  5E74 A;  5I29 A;  2FSA A;  5HEN A;  5JI8 A;  3UV4 A;  4ZQL A;  4YBS A;  5EU1 A;  5LVQ A;  1JSP B;  5CRZ A;  4O7C A;  2R0Y A;  5H1U A;  3QZS A;  4GPJ A;  5D3R A;  5E0R A;  4YAB A;  3UVY A;  4CUR A;  5FDZ A;  4CUQ A;  3DAI A;  3P1C A;  2R0S A;  1E6I A;  2YEM A;  5CU8 A;  4QC3 A;  5I1Q A;  5E7D A;  5DFB A;  3MUL A;  4DON A;  5FE6 A;  3UV5 A;  3HMH A;  3O33 A;  1ZS5 A;  5CFW A;  2G4A A;  3U5M A;  4KV4 A;  5E73 A;  4HBV A;  5HRW A;  2DVQ A;  3TLP A;  4NUD A;  5FB0 A;  4YY4 A;  4NR6 A;  5A85 A;  4MEN A;  5LVR A;  2GRC A;  5D3N A;  5LKT A;  5A82 A;  4TTE A;  5LJ1 A;  3P1D A;  5I89 A;  5DX4 A;  5EP7 A;  2DVR A;  4QST A;  4LC2 A;  5HQ6 A;  5DW1 A;  4NS5 A;  5EA1 A;  5FFW A;  4A9M A;  2E7O A;  3LJW A;  4UIV A;  2RFJ A;  5FE0 A;  5HM0 A;  4QSP A;  2DKW A;  5HFR A;  4C66 A;  3O35 A;  5EWV A;  5ENC A;  4NYX A;  5F61 A;  5EIS A;  4CUP A;  2R0V A;  5CQA A;  4OUF A;  2N9G A;  4O77 A;  5A81 A;  4A9H A;  5IBN A;  4QR3 A;  3ONI A;  5FG4 A;  4HBY A;  4BW4 A;  4O7E A;  5DW2 A;  4TQN A;  5DKD A;  5H85 A;  4IR5 A;  5AD3 A;  3I3J A;  5LJ0 A;  5FE9 A;  5FE1 A;  3LQH A;  5EWC A;  3S92 A;  4YK0 A;  5HLS A;  5AME A;  4NRA A;  4O75 A;  3Q2E A;  4A9F A;  4XY9 A;  5CQ3 A;  4ZC9 A;  5TCM A;  2DVS A;  4HXS A;  4O78 A;  5II1 A;  4TT6 A;  4WHW A;  5IID A;  5ACY A;  4O7B A;  4BJX A;  5CQ6 A;  5LKX A;  4YYN A;  1F68 A;  4O70 A;  4YH4 A;  3UW9 A;  4X2I A;  5E9V A;  4Y03 A;  5G4R A;  4MEO A;  4N4H A;  3U5P A;  2YQD A;  4Z6I A;  4A9J A;  5D7X A;  5E9L A;  4ALG A;  5D24 A;  2KTB B;  5CUA A;  5HEL A;  4UIT A;  4LYW A;  5E9I A;  4XYA A;  4KCX A;  3O37 A;  5F1L A;  5HJC A;  4CL9 A;  5FH8 A;  5EVA A;  5FG5 A;  4TS8 A;  4YY6 A;  4N3W A;  4NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...