2L85A

Solution nmr structures of cbp bromodomain with small molecule of hbs
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title A Small Molecule Binding to the Coactivator CREB-Binding Protein Blocks Apoptosis in Cardiomyocytes.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2l85A00
3FKMX 4CUQA 5DFBA 3MB4A 5DFCA 5C7NA 5CUBA 5KHMA 2E7OA 5L97A 4QSRA 5DYCA 4X2IA 5A81A 4YABA 2FSAA 4UYHA 4N4FA 5IIDA 4NUDA 5CP5A 5A7CA 5EGUA 4O7EA 4KV1A 4AKNA 4QSUA 5F1HA 4A9MA 4MEOA 4YYMA 4N4GA 4YH3A 3S92A 4HXRA 4CFKA 3LXJA 5FE6A 5DKHA 4TT6A 3O34A 3O36A 4QUTA 4LYSA 4QSWA 5H1TA 5KTUA 4CUTA 5IGLA 4A9IA 5LVQA 1EQFA 5ENEA 3LQIA 5HQ6A 5I7YA 4YATA 4Z1QA 5LJ0A 5LVRA 5H1VA 5HENA 4BW3A 2F6JA 4PY6A 5D0CA 2YQDA 3QZTA 5EWCA 5EPRA 3O33A 2GRCA 4KCXA 2RNWA 5D7XA 2N9GA 4A9HA 4XYAA 3U5KA 4BW2A 5KTXA 4YYIA 5EV9A 4YC9A 5FG5A 5E3GA 5A5OA 3SVHA 4A9LA 5KTWA 4UIXA 4NQMA 2YEMA 4RVRA 5E74A 3UW9A 4OGIA 4NYVA 2DKWA 5CUCA 3P1CA 5TB6A 2R10A 5E0RA 4PS5A 5D26A 5D3NA 4A9JA 4NRBA 5IGKA 1WUMA 2E3KA 5FH6A 1E6IA 4XY8A 2RNYA 4QR5A 4TZ2A 5I7XA 2YEKA 5LJ1A 4IOOA 5HEMA 5CUGA 5BT5A 2I7KA 5EPBA 5K29A 4LZ2A 4O7AA 5FE8A 2MJVB 3JVKA 5ETBA 5HM0A 5AMFA 4YYNA 4QR3A 4TZ8A 4UIUA 5F1LA 1JSPB 5TCMA 5EISA 5FE2A 5CFWA 3UVYA 5LKUA 4UYEA 5AD3A 5D3RA 4NYWA 3IU5A 4O7BA 4ZW1A 5COIA 3P1FA 5DX4A 5DYUA 5IGNA 4QSPA 4CUSA 3JVJA 4YYHA 5CRMA 5FB1A 2DVVA 4UYFB 4C67A 4IR6A 5H85A 5II2A 3RCWA 2DVQA 4IR5A 5LJ2A 4CLBA 4IORA 4QC1A 4O77A 4CUUA 5EVAA 5HRXA 4YH4A 2NXBA 5EWVA 5F61A 4GPJA 4NXJA 3I3JA 3U5LA 5F36A 4BHWA 2LSPB 5JWMA 5CQ6A 5CZGA 4XUAA 5I40A 5DKDA 3AADA 4YYGA 3QZVA 4O7CA 5FE1A 5IGMA 4CL9A 5HJCA 5HQ5A 3SVGA 4BJXA 5C87A 4QSVA 5EU1A 4UITA 4QY4A 5DYXA 5HFQA 5L99A 2RO1A 5DFDA 5L98A 1X0JA 5EWWA 3MXFA 4A9NA 1F68A 4NRCA 5HCLA 5AMEA 4O71A 2WP2A 4J0SA 5CQ4A 2R0YA 4YADA 5J0DA 4YY4A 2YYNA 5FFWA 2OO1A 5LKZA 4HXLA 3G0LA 4NR5A 5ENFA 5A5SA 3UVWA 5C85A 4O72A 5DYAA 5D24A 4QSQA 4UIVA 5I86A 4FLPA 5F3AA 4HBYA 5CGPA 5F5ZA 2DATA 4A9FA 4UYDA 5A5QA 2F6NA 4UIWA 4O75A 4YYKA 4YYJA 3IU6A 2WP1A 4J3IA 5DW2A 5L8TA 5D3PA 4MEQA 4DONA 5LUUA 3NXBA 5FH7A 3AQAA 4QNSA 5EI4A 5FG4A 5IG6A 3MB3A 4MR4A 4UYGA 2YDWA 3MUKA 3UV5A 5II1A 5CU8A 4LYWA 4O7FA 4QYLA 4ALHA 4ZQLA 4NYXA 4QEWA 4NR7A 4MEPA 5EA1A 3K2JA 5EPSA 2OUOA 4UIYA 5CUEA 5EP7A 5ENIA 5AD2A 4HXPA 4J0RA 5I80A 5D3JA 5HRVA 4NR4A 4NS5A 5D3LA 5CUDA 4KV4A 4CFLA 5EWHA 5EM3A 5F25A 2L5EA 3UVXA 3SVFA 4NR8A 5FE5A 3D7CA 3ONIA 5FDZA 5FG6A 4LZSA 4Q0OA 4O74A 4HXOA 5ENBA 2R0VA 3Q2EA 4Z93A 2L85A 4ALGA 5D25A 2OSSA 4LC2A 4QZSA 4HXMA 5C8GA 4J1PA 4A9KA 4CUPA 3HMHA 4IOQA 5FFYA 5EWDA 4YAXA 5HFRA 5EK9A 3DAIA 3LQHA 5E9YA 5ENHA 4BW4A 4LYIA 4PTBA 5JI8A 4ZC9A 2RI7A 1ZS5A 4QEVA 3S91A 4NQNA 5C89A 5FE0A 5D3HA 4NR6A 5LKTA 5E9LA 5F62A 5FE3A 4Z6IA 5I29A 4BW1A 4TT2A 4YBSA 4Z1SA 5HQ7A 4PCIA 3DWYA 4YY6A 5DBMA 4TU6A 5HRWA 4LDFA 2L84A 5C4QA 3GG3A 4TU4A 4MR3A 4WHWA 4WIVA 4QC3A 5EQ1A 4Y03A 2E7NA 5FBXA 3O35A 3HMFA 3MULA 2KTBB 5FE9A 5G4RA 4PKLA 4TT4A 5D3SA 4YYDA 4N3WA 5L96A 5CTLA 5KO4A 4N4HA 5D3TA 4HXSA 2DWWA 5DKCA 4NR9A 3UVDA 3MQMA 5BT3A 4A9OA 5CQ7A 3G0JA 3JVLA 4QEUA 4TTEA 3O37A 4HBXA 5CPEA 4O70A 3U5OA 3U5PA 3Q2FA 4QSTA 4LZRA 5CUAA 4TYLA 2H60A 3P1EA 3P5OA 5ETDA 5A5NA 5ACYA 5FH8A 1N72A 5F60A 4OUFA 5CY9A 4QUUA 4TQNA 5E9VA 3LJWA 2YELA 4IR4A 5CQ8A 4QB3A 5I83A 4UIZA 5FE4A 5A82A 4MR6A 5E9KA 5E3DA 1JM4B 4NUEA 4OGJA 2D9EA 4YBTA 5I89A 4QR4A 4HBWA 5FE7A 5F63A 4MENA 5F2PA 2RNXA 5CRZA 3JVMA 3U5MA 4QBMA 4A9EA 5A83A 4NRAA 5BT4A 5H1UA 4YBMA 3HMEA 5A5RA 1WUGA 4E96A 4NUCA 5HELA 3TLPA 5I1QA 3LQJA 2RFJA 5L8UA 2R0SA 4XUBA 5DW1A 5FB0A 4LR6A 5HLSA 5CS8A 4QSXA 4HXKA 5KU3A 4Z6HA 4YK0A 5ENCA 4XY9A 5I88A 2DVSA 4WHUA 5G4SA 4QSSA 4C66A 5E9IA 3UV4A 5CQ5A 5IBNA 4F3IA 5DLZA 5E7DA 4Q0NA 4CURA 4PCEA 4TS8A 4HBVA 5E9MA 3QZSA 4UYFA 3ZYUA 4IR3A 2I8NA 4HXNA 5A85A 2YW5A 4O78A 5CQ3A 5EICA 2DVRA 4LRGA 5ENJA 5DLXA 2D82A 4N4IA 5A5PA 2G4AA 5ENGA 4MR5A 3U5NA 5E73A 3P1DA 4O76A 2RS9B 4QYDA 3UV2A 5CQAA 3U5JA 5DY7A 5FFVA 5LKXA 5CQTA
chains in the Genus database with same CATH superfamily
3FKMX 4CUQA 5DFBA 3MB4A 5DFCA 5C7NA 5CUBA 5KHMA 2E7OA 5L97A 4QSRA 5DYCA 4X2IA 5A81A 4YABA 2FSAA 4UYHA 4N4FA 5IIDA 4NUDA 5CP5A 5A7CA 5EGUA 4O7EA 4KV1A 4AKNA 4QSUA 5F1HA 4A9MA 4MEOA 4YYMA 4N4GA 4YH3A 3S92A 4HXRA 4CFKA 3LXJA 5FE6A 5DKHA 4TT6A 3O34A 3O36A 4QUTA 4LYSA 4QSWA 5H1TA 5KTUA 4CUTA 5IGLA 4A9IA 5LVQA 1EQFA 5ENEA 3LQIA 5HQ6A 5I7YA 4YATA 4Z1QA 5LJ0A 5LVRA 5H1VA 5HENA 4BW3A 3ERRA 2F6JA 4PY6A 5D0CA 2YQDA 3QZTA 5EWCA 5EPRA 3O33A 2GRCA 1PUOA 4KCXA 2RNWA 4AI6A 5D7XA 2N9GA 4A9HA 4XYAA 3U5KA 4BW2A 5KTXA 4YYIA 5EV9A 4YC9A 5FG5A 5E3GA 5A5OA 3SVHA 4A9LA 5KTWA 4UIXA 4NQMA 2YEMA 4RVRA 5E74A 3UW9A 4OGIA 4NYVA 2DKWA 5CUCA 3P1CA 5TB6A 2R10A 5E0RA 4PS5A 5D26A 5D3NA 4A9JA 4NRBA 5IGKA 1WUMA 2E3KA 5FH6A 1E6IA 4XY8A 2RNYA 4QR5A 4TZ2A 5I7XA 2YEKA 5LJ1A 4IOOA 5HEMA 5CUGA 5BT5A 2EJNA 2I7KA 5EPBA 5K29A 4LZ2A 4O7AA 5FE8A 2MJVB 1ZKRA 3JVKA 5ETBA 5HM0A 5AMFA 4YYNA 4QR3A 4TZ8A 4UIUA 5F1LA 1JSPB 5TCMA 5EISA 5FE2A 5CFWA 3UVYA 5LKUA 4UYEA 5AD3A 5D3RA 4NYWA 3IU5A 4O7BA 4ZW1A 5COIA 3P1FA 5DX4A 5DYUA 5IGNA 4QSPA 4AKHA 4CUSA 3JVJA 4YYHA 5CRMA 5FB1A 2DVVA 4UYFB 4C67A 4IR6A 5H85A 5II2A 3RCWA 2DVQA 4IR5A 5LJ2A 4CLBA 4IORA 4QC1A 4O77A 4CUUA 5EVAA 5HRXA 4YH4A 2NXBA 5EWVA 5F61A 4GPJA 4NXJA 3I3JA 3U5LA 5F36A 4BHWA 2LSPB 5JWMA 5CQ6A 5CZGA 3VKHA 4XUAA 5I40A 5DKDA 3AADA 4YYGA 3QZVA 4O7CA 5FE1A 5IGMA 4CL9A 5HJCA 5HQ5A 3SVGA 4BJXA 5C87A 4QSVA 5EU1A 4UITA 4QY4A 5DYXA 5HFQA 5L99A 2RO1A 5DFDA 5L98A 1X0JA 5EWWA 3MXFA 4A9NA 1F68A 4NRCA 5HCLA 5AMEA 4O71A 2WP2A 4J0SA 5CQ4A 2R0YA 4YADA 5J0DA 4YY4A 2YYNA 5FFWA 2OO1A 5LKZA 4HXLA 3G0LA 4NR5A 5ENFA 5A5SA 3UVWA 5C85A 4O72A 5DYAA 5D24A 4QSQA 4UIVA 5I86A 4FLPA 5F3AA 4HBYA 5CGPA 5F5ZA 2DATA 4A9FA 4UYDA 5A5QA 2F6NA 4UIWA 4O75A 4YYKA 4YYJA 3IU6A 2WP1A 4J3IA 5DW2A 5L8TA 5D3PA 4MEQA 4DONA 5LUUA 3NXBA 5FH7A 3AQAA 4QNSA 5EI4A 3D1DA 5FG4A 5IG6A 3MB3A 4MR4A 4UYGA 2YDWA 3MUKA 3UV5A 5II1A 5CU8A 4LYWA 4O7FA 4QYLA 4ALHA 4ZQLA 4NYXA 4QEWA 4NR7A 4MEPA 5EA1A 3K2JA 5EPSA 2OUOA 4UIYA 5CUEA 3VKGA 5EP7A 5ENIA 5AD2A 4HXPA 4J0RA 5I80A 5D3JA 5HRVA 4NR4A 4NS5A 5D3LA 5CUDA 4KV4A 4CFLA 5EWHA 5EM3A 5F25A 2L5EA 3UVXA 3SVFA 4NR8A 5FE5A 3D7CA 3ONIA 5FDZA 5FG6A 4LZSA 4Q0OA 4O74A 4HXOA 5ENBA 2R0VA 3Q2EA 4Z93A 2L85A 4ALGA 5D25A 2OSSA 4LC2A 4QZSA 4HXMA 5C8GA 4J1PA 4A9KA 4CUPA 3HMHA 4IOQA 5FFYA 5EWDA 4YAXA 5HFRA 5EK9A 3DAIA 3LQHA 5E9YA 5ENHA 4BW4A 3D1BA 4LYIA 4PTBA 5JI8A 4ZC9A 2RI7A 1ZS5A 4QEVA 3S91A 4NQNA 5C89A 5FE0A 5D3HA 4NR6A 5LKTA 5E9LA 5F62A 5FE3A 4Z6IA 5I29A 4BW1A 4TT2A 4YBSA 4Z1SA 5HQ7A 4PCIA 3DWYA 4YY6A 5DBMA 4TU6A 5HRWA 4LDFA 2L84A 5C4QA 3GG3A 4TU4A 4MR3A 4WHWA 4WIVA 4QC3A 5EQ1A 4Y03A 2E7NA 5FBXA 3O35A 3HMFA 3MULA 2KTBB 5FE9A 5G4RA 4PKLA 4TT4A 5D3SA 4YYDA 4N3WA 5L96A 5CTLA 5KO4A 4N4HA 5D3TA 4HXSA 2DWWA 4AKIA 5DKCA 4NR9A 3UVDA 3MQMA 5BT3A 4A9OA 5CQ7A 3G0JA 3JVLA 4QEUA 4TTEA 3O37A 4HBXA 5CPEA 4O70A 3U5OA 3U5PA 3Q2FA 4QSTA 4LZRA 5CUAA 4TYLA 2H60A 3P1EA 3P5OA 5ETDA 5A5NA 5ACYA 4AKGA 5FH8A 1N72A 5F60A 4OUFA 5CY9A 4QUUA 4TQNA 5E9VA 3LJWA 2YELA 4IR4A 5CQ8A 4QB3A 5I83A 4UIZA 5FE4A 5A82A 4MR6A 5E9KA 5E3DA 1JM4B 4NUEA 4OGJA 2D9EA 4YBTA 5I89A 4QR4A 4HBWA 5FE7A 5F63A 4MENA 5F2PA 2RNXA 5CRZA 3JVMA 3U5MA 4QBMA 4A9EA 5A83A 4NRAA 5BT4A 5H1UA 4YBMA 3HMEA 5A5RA 1WUGA 4E96A 4NUCA 5HELA 3TLPA 5I1QA 3LQJA 2RFJA 5L8UA 2R0SA 4XUBA 5DW1A 5FB0A 4LR6A 5HLSA 5CS8A 4QSXA 4HXKA 5KU3A 4Z6HA 4YK0A 5ENCA 4XY9A 5I88A 2DVSA 4WHUA 5G4SA 4QSSA 4C66A 5E9IA 3UV4A 5CQ5A 5IBNA 4F3IA 5DLZA 5E7DA 4Q0NA 4CURA 4PCEA 4TS8A 4HBVA 5E9MA 3QZSA 4UYFA 3ZYUA 4IR3A 2I8NA 4HXNA 5A85A 2YW5A 4O78A 5CQ3A 5EICA 2DVRA 4LRGA 5ENJA 5DLXA 2D82A 4N4IA 5A5PA 2G4AA 5ENGA 4MR5A 3U5NA 5E73A 3P1DA 4O76A 2RS9B 4QYDA 3UV2A 5CQAA 3U5JA 5DY7A 5FFVA 5LKXA 5CQTA
chains in the Genus database with same CATH topology
3FKMX 4CUQA 5DFBA 3MB4A 5DFCA 5C7NA 5CUBA 5KHMA 2E7OA 5L97A 4QSRA 5DYCA 4X2IA 5A81A 4YABA 2FSAA 4UYHA 4N4FA 5IIDA 4NUDA 5CP5A 5A7CA 5EGUA 4O7EA 4KV1A 4AKNA 4QSUA 5F1HA 4A9MA 4MEOA 4YYMA 4N4GA 4YH3A 3S92A 4HXRA 4CFKA 3LXJA 5FE6A 5DKHA 4TT6A 3O34A 3O36A 4QUTA 4LYSA 4QSWA 5H1TA 5KTUA 4CUTA 5IGLA 4A9IA 5LVQA 1EQFA 5ENEA 3LQIA 5HQ6A 5I7YA 4YATA 4Z1QA 5LJ0A 5LVRA 5H1VA 5HENA 4BW3A 2F6JA 4PY6A 5D0CA 2YQDA 3QZTA 5EWCA 5EPRA 3O33A 2GRCA 4KCXA 2RNWA 5D7XA 2N9GA 4A9HA 4XYAA 3U5KA 4BW2A 5KTXA 4YYIA 5EV9A 4YC9A 5FG5A 5E3GA 5A5OA 3SVHA 4A9LA 5KTWA 4UIXA 4NQMA 2YEMA 4RVRA 5E74A 3UW9A 4OGIA 4NYVA 2DKWA 5CUCA 3P1CA 5TB6A 2R10A 5E0RA 4PS5A 5D26A 5D3NA 4A9JA 4NRBA 5IGKA 1WUMA 2E3KA 5FH6A 1E6IA 4XY8A 2RNYA 4QR5A 4TZ2A 5I7XA 2YEKA 5LJ1A 4IOOA 5HEMA 5CUGA 5BT5A 2I7KA 5EPBA 5K29A 4LZ2A 4O7AA 5FE8A 2MJVB 3JVKA 5ETBA 5HM0A 5AMFA 4YYNA 4QR3A 4TZ8A 4UIUA 5F1LA 1JSPB 5TCMA 5EISA 5FE2A 5CFWA 3UVYA 5LKUA 4UYEA 5AD3A 5D3RA 4NYWA 3IU5A 4O7BA 4ZW1A 5COIA 3P1FA 5DX4A 5DYUA 5IGNA 4QSPA 4CUSA 3JVJA 4YYHA 5CRMA 5FB1A 2DVVA 4UYFB 4C67A 4IR6A 5H85A 5II2A 3RCWA 2DVQA 4IR5A 5LJ2A 4CLBA 4IORA 4QC1A 4O77A 4CUUA 5EVAA 5HRXA 4YH4A 2NXBA 5EWVA 5F61A 4GPJA 4NXJA 3I3JA 3U5LA 5F36A 4BHWA 2LSPB 5JWMA 5CQ6A 5CZGA 4XUAA 5I40A 5DKDA 3AADA 4YYGA 3QZVA 4O7CA 5FE1A 5IGMA 4CL9A 5HJCA 5HQ5A 3SVGA 4BJXA 5C87A 4QSVA 5EU1A 4UITA 4QY4A 5DYXA 5HFQA 5L99A 2RO1A 5DFDA 5L98A 1X0JA 5EWWA 3MXFA 4A9NA 1F68A 4NRCA 5HCLA 5AMEA 4O71A 2WP2A 4J0SA 5CQ4A 2R0YA 4YADA 5J0DA 4YY4A 2YYNA 5FFWA 2OO1A 5LKZA 4HXLA 3G0LA 4NR5A 5ENFA 5A5SA 3UVWA 5C85A 4O72A 5DYAA 5D24A 4QSQA 4UIVA 5I86A 4FLPA 5F3AA 4HBYA 5CGPA 5F5ZA 2DATA 4A9FA 4UYDA 5A5QA 2F6NA 4UIWA 4O75A 4YYKA 4YYJA 3IU6A 2WP1A 4J3IA 5DW2A 5L8TA 5D3PA 4MEQA 4DONA 5LUUA 3NXBA 5FH7A 3AQAA 4QNSA 5EI4A 5FG4A 5IG6A 3MB3A 4MR4A 4UYGA 2YDWA 3MUKA 3UV5A 5II1A 5CU8A 4LYWA 4O7FA 4QYLA 4ALHA 4ZQLA 4NYXA 4QEWA 4NR7A 4MEPA 5EA1A 3K2JA 5EPSA 2OUOA 4UIYA 5CUEA 5EP7A 5ENIA 5AD2A 4HXPA 4J0RA 5I80A 5D3JA 5HRVA 4NR4A 4NS5A 5D3LA 5CUDA 4KV4A 4CFLA 5EWHA 5EM3A 5F25A 2L5EA 3UVXA 3SVFA 4NR8A 5FE5A 3D7CA 3ONIA 5FDZA 5FG6A 4LZSA 4Q0OA 4O74A 4HXOA 5ENBA 2R0VA 3Q2EA 4Z93A 2L85A 4ALGA 5D25A 2OSSA 4LC2A 4QZSA 4HXMA 5C8GA 4J1PA 4A9KA 4CUPA 3HMHA 4IOQA 5FFYA 5EWDA 4YAXA 5HFRA 5EK9A 3DAIA 3LQHA 5E9YA 5ENHA 4BW4A 4LYIA 4PTBA 5JI8A 4ZC9A 2RI7A 1ZS5A 4QEVA 3S91A 4NQNA 5C89A 5FE0A 5D3HA 4NR6A 5LKTA 5E9LA 5F62A 5FE3A 4Z6IA 5I29A 4BW1A 4TT2A 4YBSA 4Z1SA 5HQ7A 4PCIA 3DWYA 4YY6A 5DBMA 4TU6A 5HRWA 4LDFA 2L84A 5C4QA 3GG3A 4TU4A 4MR3A 4WHWA 4WIVA 4QC3A 5EQ1A 4Y03A 2E7NA 5FBXA 3O35A 3HMFA 3MULA 2KTBB 5FE9A 5G4RA 4PKLA 4TT4A 5D3SA 4YYDA 4N3WA 5L96A 5CTLA 5KO4A 4N4HA 5D3TA 4HXSA 2DWWA 5DKCA 4NR9A 3UVDA 3MQMA 5BT3A 4A9OA 5CQ7A 3G0JA 3JVLA 4QEUA 4TTEA 3O37A 4HBXA 5CPEA 4O70A 3U5OA 3U5PA 3Q2FA 4QSTA 4LZRA 5CUAA 4TYLA 2H60A 3P1EA 3P5OA 5ETDA 5A5NA 5ACYA 5FH8A 1N72A 5F60A 4OUFA 5CY9A 4QUUA 4TQNA 5E9VA 3LJWA 2YELA 4IR4A 5CQ8A 4QB3A 5I83A 4UIZA 5FE4A 5A82A 4MR6A 5E9KA 5E3DA 1JM4B 4NUEA 4OGJA 2D9EA 4YBTA 5I89A 4QR4A 4HBWA 5FE7A 5F63A 4MENA 5F2PA 2RNXA 5CRZA 3JVMA 3U5MA 4QBMA 4A9EA 5A83A 4NRAA 5BT4A 5H1UA 4YBMA 3HMEA 5A5RA 1WUGA 4E96A 4NUCA 5HELA 3TLPA 5I1QA 3LQJA 2RFJA 5L8UA 2R0SA 4XUBA 5DW1A 5FB0A 4LR6A 5HLSA 5CS8A 4QSXA 4HXKA 5KU3A 4Z6HA 4YK0A 5ENCA 4XY9A 5I88A 2DVSA 4WHUA 5G4SA 4QSSA 4C66A 5E9IA 3UV4A 5CQ5A 5IBNA 4F3IA 5DLZA 5E7DA 4Q0NA 4CURA 4PCEA 4TS8A 4HBVA 5E9MA 3QZSA 4UYFA 3ZYUA 4IR3A 2I8NA 4HXNA 5A85A 2YW5A 4O78A 5CQ3A 5EICA 2DVRA 4LRGA 5ENJA 5DLXA 2D82A 4N4IA 5A5PA 2G4AA 5ENGA 4MR5A 3U5NA 5E73A 3P1DA 4O76A 2RS9B 4QYDA 3UV2A 5CQAA 3U5JA 5DY7A 5FFVA 5LKXA 5CQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKM X;  4CUQ A;  5DFB A;  3MB4 A;  5DFC A;  5C7N A;  5CUB A;  5KHM A;  2E7O A;  5L97 A;  4QSR A;  5DYC A;  4X2I A;  5A81 A;  4YAB A;  2FSA A;  4UYH A;  4N4F A;  5IID A;  4NUD A;  5CP5 A;  5A7C A;  5EGU A;  4O7E A;  4KV1 A;  4AKN A;  4QSU A;  5F1H A;  4A9M A;  4MEO A;  4YYM A;  4N4G A;  4YH3 A;  3S92 A;  4HXR A;  4CFK A;  3LXJ A;  5FE6 A;  5DKH A;  4TT6 A;  3O34 A;  3O36 A;  4QUT A;  4LYS A;  4QSW A;  5H1T A;  5KTU A;  4CUT A;  5IGL A;  4A9I A;  5LVQ A;  1EQF A;  5ENE A;  3LQI A;  5HQ6 A;  5I7Y A;  4YAT A;  4Z1Q A;  5LJ0 A;  5LVR A;  5H1V A;  5HEN A;  4BW3 A;  2F6J A;  4PY6 A;  5D0C A;  2YQD A;  3QZT A;  5EWC A;  5EPR A;  3O33 A;  2GRC A;  4KCX A;  2RNW A;  5D7X A;  2N9G A;  4A9H A;  4XYA A;  3U5K A;  4BW2 A;  5KTX A;  4YYI A;  5EV9 A;  4YC9 A;  5FG5 A;  5E3G A;  5A5O A;  3SVH A;  4A9L A;  5KTW A;  4UIX A;  4NQM A;  2YEM A;  4RVR A;  5E74 A;  3UW9 A;  4OGI A;  4NYV A;  2DKW A;  5CUC A;  3P1C A;  5TB6 A;  2R10 A;  5E0R A;  4PS5 A;  5D26 A;  5D3N A;  4A9J A;  4NRB A;  5IGK A;  1WUM A;  2E3K A;  5FH6 A;  1E6I A;  4XY8 A;  2RNY A;  4QR5 A;  4TZ2 A;  5I7X A;  2YEK A;  5LJ1 A;  4IOO A;  5HEM A;  5CUG A;  5BT5 A;  2I7K A;  5EPB A;  5K29 A;  4LZ2 A;  4O7A A;  5FE8 A;  2MJV B;  3JVK A;  5ETB A;  5HM0 A;  5AMF A;  4YYN A;  4QR3 A;  4TZ8 A;  4UIU A;  5F1L A;  1JSP B;  5TCM A;  5EIS A;  5FE2 A;  5CFW A;  3UVY A;  5LKU A;  4UYE A;  5AD3 A;  5D3R A;  4NYW A;  3IU5 A;  4O7B A;  4ZW1 A;  5COI A;  3P1F A;  5DX4 A;  5DYU A;  5IGN A;  4QSP A;  4CUS A;  3JVJ A;  4YYH A;  5CRM A;  5FB1 A;  2DVV A;  4UYF B;  4C67 A;  4IR6 A;  5H85 A;  5II2 A;  3RCW A;  2DVQ A;  4IR5 A;  5LJ2 A;  4CLB A;  4IOR A;  4QC1 A;  4O77 A;  4CUU A;  5EVA A;  5HRX A;  4YH4 A;  2NXB A;  5EWV A;  5F61 A;  4GPJ A;  4NXJ A;  3I3J A;  3U5L A;  5F36 A;  4BHW A;  2LSP B;  5JWM A;  5CQ6 A;  5CZG A;  4XUA A;  5I40 A;  5DKD A;  3AAD A;  4YYG A;  3QZV A;  4O7C A;  5FE1 A;  5IGM A;  4CL9 A;  5HJC A;  5HQ5 A;  3SVG A;  4BJX A;  5C87 A;  4QSV A;  5EU1 A;  4UIT A;  4QY4 A;  5DYX A;  5HFQ A;  5L99 A;  2RO1 A;  5DFD A;  5L98 A;  1X0J A;  5EWW A;  3MXF A;  4A9N A;  1F68 A;  4NRC A;  5HCL A;  5AME A;  4O71 A;  2WP2 A;  4J0S A;  5CQ4 A;  2R0Y A;  4YAD A;  5J0D A;  4YY4 A;  2YYN A;  5FFW A;  2OO1 A;  5LKZ A;  4HXL A;  3G0L A;  4NR5 A;  5ENF A;  5A5S A;  3UVW A;  5C85 A;  4O72 A;  5DYA A;  5D24 A;  4QSQ A;  4UIV A;  5I86 A;  4FLP A;  5F3A A;  4HBY A;  5CGP A;  5F5Z A;  2DAT A;  4A9F A;  4UYD A;  5A5Q A;  2F6N A;  4UIW A;  4O75 A;  4YYK A;  4YYJ A;  3IU6 A;  2WP1 A;  4J3I A;  5DW2 A;  5L8T A;  5D3P A;  4MEQ A;  4DON A;  5LUU A;  3NXB A;  5FH7 A;  3AQA A;  4QNS A;  5EI4 A;  5FG4 A;  5IG6 A;  3MB3 A;  4MR4 A;  4UYG A;  2YDW A;  3MUK A;  3UV5 A;  5II1 A;  5CU8 A;  4LYW A;  4O7F A;  4QYL A;  4ALH A;  4ZQL A;  4NYX A;  4QEW A;  4NR7 A;  4MEP A;  5EA1 A;  3K2J A;  5EPS A;  2OUO A;  4UIY A;  5CUE A;  5EP7 A;  5ENI A;  5AD2 A;  4HXP A;  4J0R A;  5I80 A;  5D3J A;  5HRV A;  4NR4 A;  4NS5 A;  5D3L A;  5CUD A;  4KV4 A;  4CFL A;  5EWH A;  5EM3 A;  5F25 A;  2L5E A;  3UVX A;  3SVF A;  4NR8 A;  5FE5 A;  3D7C A;  3ONI A;  5FDZ A;  5FG6 A;  4LZS A;  4Q0O A;  4O74 A;  4HXO A;  5ENB A;  2R0V A;  3Q2E A;  4Z93 A;  2L85 A;  4ALG A;  5D25 A;  2OSS A;  4LC2 A;  4QZS A;  4HXM A;  5C8G A;  4J1P A;  4A9K A;  4CUP A;  3HMH A;  4IOQ A;  5FFY A;  5EWD A;  4YAX A;  5HFR A;  5EK9 A;  3DAI A;  3LQH A;  5E9Y A;  5ENH A;  4BW4 A;  4LYI A;  4PTB A;  5JI8 A;  4ZC9 A;  2RI7 A;  1ZS5 A;  4QEV A;  3S91 A;  4NQN A;  5C89 A;  5FE0 A;  5D3H A;  4NR6 A;  5LKT A;  5E9L A;  5F62 A;  5FE3 A;  4Z6I A;  5I29 A;  4BW1 A;  4TT2 A;  4YBS A;  4Z1S A;  5HQ7 A;  4PCI A;  3DWY A;  4YY6 A;  5DBM A;  4TU6 A;  5HRW A;  4LDF A;  2L84 A;  5C4Q A;  3GG3 A;  4TU4 A;  4MR3 A;  4WHW A;  4WIV A;  4QC3 A;  5EQ1 A;  4Y03 A;  2E7N A;  5FBX A;  3O35 A;  3HMF A;  3MUL A;  2KTB B;  5FE9 A;  5G4R A;  4PKL A;  4TT4 A;  5D3S A;  4YYD A;  4N3W A;  5L96 A;  5CTL A;  5KO4 A;  4N4H A;  5D3T A;  4HXS A;  2DWW A;  5DKC A;  4NR9 A;  3UVD A;  3MQM A;  5BT3 A;  4A9O A;  5CQ7 A;  3G0J A;  3JVL A;  4QEU A;  4TTE A;  3O37 A;  4HBX A;  5CPE A;  4O70 A;  3U5O A;  3U5P A;  3Q2F A;  4QST A;  4LZR A;  5CUA A;  4TYL A;  2H60 A;  3P1E A;  3P5O A;  5ETD A;  5A5N A;  5ACY A;  5FH8 A;  1N72 A;  5F60 A;  4OUF A;  5CY9 A;  4QUU A;  4TQN A;  5E9V A;  3LJW A;  2YEL A;  4IR4 A;  5CQ8 A;  4QB3 A;  5I83 A;  4UIZ A;  5FE4 A;  5A82 A;  4MR6 A;  5E9K A;  5E3D A;  1JM4 B;  4NUE A;  4OGJ A;  2D9E A;  4YBT A;  5I89 A;  4QR4 A;  4HBW A;  5FE7 A;  5F63 A;  4MEN A;  5F2P A;  2RNX A;  5CRZ A;  3JVM A;  3U5M A;  4QBM A;  4A9E A;  5A83 A;  4NRA A;  5BT4 A;  5H1U A;  4YBM A;  3HME A;  5A5R A;  1WUG A;  4E96 A;  4NUC A;  5HEL A;  3TLP A;  5I1Q A;  3LQJ A;  2RFJ A;  5L8U A;  2R0S A;  4XUB A;  5DW1 A;  5FB0 A;  4LR6 A;  5HLS A;  5CS8 A;  4QSX A;  4HXK A;  5KU3 A;  4Z6H A;  4YK0 A;  5ENC A;  4XY9 A;  5I88 A;  2DVS A;  4WHU A;  5G4S A;  4QSS A;  4C66 A;  5E9I A;  3UV4 A;  5CQ5 A;  5IBN A;  4F3I A;  5DLZ A;  5E7D A;  4Q0N A;  4CUR A;  4PCE A;  4TS8 A;  4HBV A;  5E9M A;  3QZS A;  4UYF A;  3ZYU A;  4IR3 A;  2I8N A;  4HXN A;  5A85 A;  2YW5 A;  4O78 A;  5CQ3 A;  5EIC A;  2DVR A;  4LRG A;  5ENJ A;  5DLX A;  2D82 A;  4N4I A;  5A5P A;  2G4A A;  5ENG A;  4MR5 A;  3U5N A;  5E73 A;  3P1D A;  4O76 A;  2RS9 B;  4QYD A;  3UV2 A;  5CQA A;  3U5J A;  5DY7 A;  5FFV A;  5LKX A;  5CQT A; 
#chains in the Genus database with same CATH topology
 3FKM X;  4CUQ A;  5DFB A;  3MB4 A;  5DFC A;  5C7N A;  5CUB A;  5KHM A;  2E7O A;  5L97 A;  4QSR A;  5DYC A;  4X2I A;  5A81 A;  4YAB A;  2FSA A;  4UYH A;  4N4F A;  5IID A;  4NUD A;  5CP5 A;  5A7C A;  5EGU A;  4O7E A;  4KV1 A;  4AKN A;  4QSU A;  5F1H A;  4A9M A;  4MEO A;  4YYM A;  4N4G A;  4YH3 A;  3S92 A;  4HXR A;  4CFK A;  3LXJ A;  5FE6 A;  5DKH A;  4TT6 A;  3O34 A;  3O36 A;  4QUT A;  4LYS A;  4QSW A;  5H1T A;  5KTU A;  4CUT A;  5IGL A;  4A9I A;  5LVQ A;  1EQF A;  5ENE A;  3LQI A;  5HQ6 A;  5I7Y A;  4YAT A;  4Z1Q A;  5LJ0 A;  5LVR A;  5H1V A;  5HEN A;  4BW3 A;  3ERR A;  2F6J A;  4PY6 A;  5D0C A;  2YQD A;  3QZT A;  5EWC A;  5EPR A;  3O33 A;  2GRC A;  1PUO A;  4KCX A;  2RNW A;  4AI6 A;  5D7X A;  2N9G A;  4A9H A;  4XYA A;  3U5K A;  4BW2 A;  5KTX A;  4YYI A;  5EV9 A;  4YC9 A;  5FG5 A;  5E3G A;  5A5O A;  3SVH A;  4A9L A;  5KTW A;  4UIX A;  4NQM A;  2YEM A;  4RVR A;  5E74 A;  3UW9 A;  4OGI A;  4NYV A;  2DKW A;  5CUC A;  3P1C A;  5TB6 A;  2R10 A;  5E0R A;  4PS5 A;  5D26 A;  5D3N A;  4A9J A;  4NRB A;  5IGK A;  1WUM A;  2E3K A;  5FH6 A;  1E6I A;  4XY8 A;  2RNY A;  4QR5 A;  4TZ2 A;  5I7X A;  2YEK A;  5LJ1 A;  4IOO A;  5HEM A;  5CUG A;  5BT5 A;  2EJN A;  2I7K A;  5EPB A;  5K29 A;  4LZ2 A;  4O7A A;  5FE8 A;  2MJV B;  1ZKR A;  3JVK A;  5ETB A;  5HM0 A;  5AMF A;  4YYN A;  4QR3 A;  4TZ8 A;  4UIU A;  5F1L A;  1JSP B;  5TCM A;  5EIS A;  5FE2 A;  5CFW A;  3UVY A;  5LKU A;  4UYE A;  5AD3 A;  5D3R A;  4NYW A;  3IU5 A;  4O7B A;  4ZW1 A;  5COI A;  3P1F A;  5DX4 A;  5DYU A;  5IGN A;  4QSP A;  4AKH A;  4CUS A;  3JVJ A;  4YYH A;  5CRM A;  5FB1 A;  2DVV A;  4UYF B;  4C67 A;  4IR6 A;  5H85 A;  5II2 A;  3RCW A;  2DVQ A;  4IR5 A;  5LJ2 A;  4CLB A;  4IOR A;  4QC1 A;  4O77 A;  4CUU A;  5EVA A;  5HRX A;  4YH4 A;  2NXB A;  5EWV A;  5F61 A;  4GPJ A;  4NXJ A;  3I3J A;  3U5L A;  5F36 A;  4BHW A;  2LSP B;  5JWM A;  5CQ6 A;  5CZG A;  3VKH A;  4XUA A;  5I40 A;  5DKD A;  3AAD A;  4YYG A;  3QZV A;  4O7C A;  5FE1 A;  5IGM A;  4CL9 A;  5HJC A;  5HQ5 A;  3SVG A;  4BJX A;  5C87 A;  4QSV A;  5EU1 A;  4UIT A;  4QY4 A;  5DYX A;  5HFQ A;  5L99 A;  2RO1 A;  5DFD A;  5L98 A;  1X0J A;  5EWW A;  3MXF A;  4A9N A;  1F68 A;  4NRC A;  5HCL A;  5AME A;  4O71 A;  2WP2 A;  4J0S A;  5CQ4 A;  2R0Y A;  4YAD A;  5J0D A;  4YY4 A;  2YYN A;  5FFW A;  2OO1 A;  5LKZ A;  4HXL A;  3G0L A;  4NR5 A;  5ENF A;  5A5S A;  3UVW A;  5C85 A;  4O72 A;  5DYA A;  5D24 A;  4QSQ A;  4UIV A;  5I86 A;  4FLP A;  5F3A A;  4HBY A;  5CGP A;  5F5Z A;  2DAT A;  4A9F A;  4UYD A;  5A5Q A;  2F6N A;  4UIW A;  4O75 A;  4YYK A;  4YYJ A;  3IU6 A;  2WP1 A;  4J3I A;  5DW2 A;  5L8T A;  5D3P A;  4MEQ A;  4DON A;  5LUU A;  3NXB A;  5FH7 A;  3AQA A;  4QNS A;  5EI4 A;  3D1D A;  5FG4 A;  5IG6 A;  3MB3 A;  4MR4 A;  4UYG A;  2YDW A;  3MUK A;  3UV5 A;  5II1 A;  5CU8 A;  4LYW A;  4O7F A;  4QYL A;  4ALH A;  4ZQL A;  4NYX A;  4QEW A;  4NR7 A;  4MEP A;  5EA1 A;  3K2J A;  5EPS A;  2OUO A;  4UIY A;  5CUE A;  3VKG A;  5EP7 A;  5ENI A;  5AD2 A;  4HXP A;  4J0R A;  5I80 A;  5D3J A;  5HRV A;  4NR4 A;  4NS5 A;  5D3L A;  5CUD A;  4KV4 A;  4CFL A;  5EWH A;  5EM3 A;  5F25 A;  2L5E A;  3UVX A;  3SVF A;  4NR8 A;  5FE5 A;  3D7C A;  3ONI A;  5FDZ A;  5FG6 A;  4LZS A;  4Q0O A;  4O74 A;  4HXO A;  5ENB A;  2R0V A;  3Q2E A;  4Z93 A;  2L85 A;  4ALG A;  5D25 A;  2OSS A;  4LC2 A;  4QZS A;  4HXM A;  5C8G A;  4J1P A;  4A9K A;  4CUP A;  3HMH A;  4IOQ A;  5FFY A;  5EWD A;  4YAX A;  5HFR A;  5EK9 A;  3DAI A;  3LQH A;  5E9Y A;  5ENH A;  4BW4 A;  3D1B A;  4LYI A;  4PTB A;  5JI8 A;  4ZC9 A;  2RI7 A;  1ZS5 A;  4QEV A;  3S91 A;  4NQN A;  5C89 A;  5FE0 A;  5D3H A;  4NR6 A;  5LKT A;  5E9L A;  5F62 A;  5FE3 A;  4Z6I A;  5I29 A;  4BW1 A;  4TT2 A;  4YBS A;  4Z1S A;  5HQ7 A;  4PCI A;  3DWY A;  4YY6 A;  5DBM A;  4TU6 A;  5HRW A;  4LDF A;  2L84 A;  5C4Q A;  3GG3 A;  4TU4 A;  4MR3 A;  4WHW A;  4WIV A;  4QC3 A;  5EQ1 A;  4Y03 A;  2E7N A;  5FBX A;  3O35 A;  3HMF A;  3MUL A;  2KTB B;  5FE9 A;  5G4R A;  4PKL A;  4TT4 A;  5D3S A;  4YYD A;  4N3W A;  5L96 A;  5CTL A;  5KO4 A;  4N4H A;  5D3T A;  4HXS A;  2DWW A;  4AKI A;  5DKC A;  4NR9 A;  3UVD A;  3MQM A;  5BT3 A;  4A9O A;  5CQ7 A;  3G0J A;  3JVL A;  4QEU A;  4TTE A;  3O37 A;  4HBX A;  5CPE A;  4O70 A;  3U5O A;  3U5P A;  3Q2F A;  4QST A;  4LZR A;  5CUA A;  4TYL A;  2H60 A;  3P1E A;  3P5O A;  5ETD A;  5A5N A;  5ACY A;  4AKG A;  5FH8 A;  1N72 A;  5F60 A;  4OUF A;  5CY9 A;  4QUU A;  4TQN A;  5E9V A;  3LJW A;  2YEL A;  4IR4 A;  5CQ8 A;  4QB3 A;  5I83 A;  4UIZ A;  5FE4 A;  5A82 A;  4MR6 A;  5E9K A;  5E3D A;  1JM4 B;  4NUE A;  4OGJ A;  2D9E A;  4YBT A;  5I89 A;  4QR4 A;  4HBW A;  5FE7 A;  5F63 A;  4MEN A;  5F2P A;  2RNX A;  5CRZ A;  3JVM A;  3U5M A;  4QBM A;  4A9E A;  5A83 A;  4NRA A;  5BT4 A;  5H1U A;  4YBM A;  3HME A;  5A5R A;  1WUG A;  4E96 A;  4NUC A;  5HEL A;  3TLP A;  5I1Q A;  3LQJ A;  2RFJ A;  5L8U A;  2R0S A;  4XUB A;  5DW1 A;  5FB0 A;  4LR6 A;  5HLS A;  5CS8 A;  4QSX A;  4HXK A;  5KU3 A;  4Z6H A;  4YK0 A;  5ENC A;  4XY9 A;  5I88 A;  2DVS A;  4WHU A;  5G4S A;  4QSS A;  4C66 A;  5E9I A;  3UV4 A;  5CQ5 A;  5IBN A;  4F3I A;  5DLZ A;  5E7D A;  4Q0N A;  4CUR A;  4PCE A;  4TS8 A;  4HBV A;  5E9M A;  3QZS A;  4UYF A;  3ZYU A;  4IR3 A;  2I8N A;  4HXN A;  5A85 A;  2YW5 A;  4O78 A;  5CQ3 A;  5EIC A;  2DVR A;  4LRG A;  5ENJ A;  5DLX A;  2D82 A;  4N4I A;  5A5P A;  2G4A A;  5ENG A;  4MR5 A;  3U5N A;  5E73 A;  3P1D A;  4O76 A;  2RS9 B;  4QYD A;  3UV2 A;  5CQA A;  3U5J A;  5DY7 A;  5FFV A;  5LKX A;  5CQT A; 
#chains in the Genus database with same CATH homology
 3FKM X;  4CUQ A;  5DFB A;  3MB4 A;  5DFC A;  5C7N A;  5CUB A;  5KHM A;  2E7O A;  5L97 A;  4QSR A;  5DYC A;  4X2I A;  5A81 A;  4YAB A;  2FSA A;  4UYH A;  4N4F A;  5IID A;  4NUD A;  5CP5 A;  5A7C A;  5EGU A;  4O7E A;  4KV1 A;  4AKN A;  4QSU A;  5F1H A;  4A9M A;  4MEO A;  4YYM A;  4N4G A;  4YH3 A;  3S92 A;  4HXR A;  4CFK A;  3LXJ A;  5FE6 A;  5DKH A;  4TT6 A;  3O34 A;  3O36 A;  4QUT A;  4LYS A;  4QSW A;  5H1T A;  5KTU A;  4CUT A;  5IGL A;  4A9I A;  5LVQ A;  1EQF A;  5ENE A;  3LQI A;  5HQ6 A;  5I7Y A;  4YAT A;  4Z1Q A;  5LJ0 A;  5LVR A;  5H1V A;  5HEN A;  4BW3 A;  2F6J A;  4PY6 A;  5D0C A;  2YQD A;  3QZT A;  5EWC A;  5EPR A;  3O33 A;  2GRC A;  4KCX A;  2RNW A;  5D7X A;  2N9G A;  4A9H A;  4XYA A;  3U5K A;  4BW2 A;  5KTX A;  4YYI A;  5EV9 A;  4YC9 A;  5FG5 A;  5E3G A;  5A5O A;  3SVH A;  4A9L A;  5KTW A;  4UIX A;  4NQM A;  2YEM A;  4RVR A;  5E74 A;  3UW9 A;  4OGI A;  4NYV A;  2DKW A;  5CUC A;  3P1C A;  5TB6 A;  2R10 A;  5E0R A;  4PS5 A;  5D26 A;  5D3N A;  4A9J A;  4NRB A;  5IGK A;  1WUM A;  2E3K A;  5FH6 A;  1E6I A;  4XY8 A;  2RNY A;  4QR5 A;  4TZ2 A;  5I7X A;  2YEK A;  5LJ1 A;  4IOO A;  5HEM A;  5CUG A;  5BT5 A;  2I7K A;  5EPB A;  5K29 A;  4LZ2 A;  4O7A A;  5FE8 A;  2MJV B;  3JVK A;  5ETB A;  5HM0 A;  5AMF A;  4YYN A;  4QR3 A;  4TZ8 A;  4UIU A;  5F1L A;  1JSP B;  5TCM A;  5EIS A;  5FE2 A;  5CFW A;  3UVY A;  5LKU A;  4UYE A;  5AD3 A;  5D3R A;  4NYW A;  3IU5 A;  4O7B A;  4ZW1 A;  5COI A;  3P1F A;  5DX4 A;  5DYU A;  5IGN A;  4QSP A;  4CUS A;  3JVJ A;  4YYH A;  5CRM A;  5FB1 A;  2DVV A;  4UYF B;  4C67 A;  4IR6 A;  5H85 A;  5II2 A;  3RCW A;  2DVQ A;  4IR5 A;  5LJ2 A;  4CLB A;  4IOR A;  4QC1 A;  4O77 A;  4CUU A;  5EVA A;  5HRX A;  4YH4 A;  2NXB A;  5EWV A;  5F61 A;  4GPJ A;  4NXJ A;  3I3J A;  3U5L A;  5F36 A;  4BHW A;  2LSP B;  5JWM A;  5CQ6 A;  5CZG A;  4XUA A;  5I40 A;  5DKD A;  3AAD A;  4YYG A;  3QZV A;  4O7C A;  5FE1 A;  5IGM A;  4CL9 A;  5HJC A;  5HQ5 A;  3SVG A;  4BJX A;  5C87 A;  4QSV A;  5EU1 A;  4UIT A;  4QY4 A;  5DYX A;  5HFQ A;  5L99 A;  2RO1 A;  5DFD A;  5L98 A;  1X0J A;  5EWW A;  3MXF A;  4A9N A;  1F68 A;  4NRC A;  5HCL A;  5AME A;  4O71 A;  2WP2 A;  4J0S A;  5CQ4 A;  2R0Y A;  4YAD A;  5J0D A;  4YY4 A;  2YYN A;  5FFW A;  2OO1 A;  5LKZ A;  4HXL A;  3G0L A;  4NR5 A;  5ENF A;  5A5S A;  3UVW A;  5C85 A;  4O72 A;  5DYA A;  5D24 A;  4QSQ A;  4UIV A;  5I86 A;  4FLP A;  5F3A A;  4HBY A;  5CGP A;  5F5Z A;  2DAT A;  4A9F A;  4UYD A;  5A5Q A;  2F6N A;  4UIW A;  4O75 A;  4YYK A;  4YYJ A;  3IU6 A;  2WP1 A;  4J3I A;  5DW2 A;  5L8T A;  5D3P A;  4MEQ A;  4DON A;  5LUU A;  3NXB A;  5FH7 A;  3AQA A;  4QNS A;  5EI4 A;  5FG4 A;  5IG6 A;  3MB3 A;  4MR4 A;  4UYG A;  2YDW A;  3MUK A;  3UV5 A;  5II1 A;  5CU8 A;  4LYW A;  4O7F A;  4QYL A;  4ALH A;  4ZQL A;  4NYX A;  4QEW A;  4NR7 A;  4MEP A;  5EA1 A;  3K2J A;  5EPS A;  2OUO A;  4UIY A;  5CUE A;  5EP7 A;  5ENI A;  5AD2 A;  4HXP A;  4J0R A;  5I80 A;  5D3J A;  5HRV A;  4NR4 A;  4NS5 A;  5D3L A;  5CUD A;  4KV4 A;  4CFL A;  5EWH A;  5EM3 A;  5F25 A;  2L5E A;  3UVX A;  3SVF A;  4NR8 A;  5FE5 A;  3D7C A;  3ONI A;  5FDZ A;  5FG6 A;  4LZS A;  4Q0O A;  4O74 A;  4HXO A;  5ENB A;  2R0V A;  3Q2E A;  4Z93 A;  2L85 A;  4ALG A;  5D25 A;  2OSS A;  4LC2 A;  4QZS A;  4HXM A;  5C8G A;  4J1P A;  4A9K A;  4CUP A;  3HMH A;  4IOQ A;  5FFY A;  5EWD A;  4YAX A;  5HFR A;  5EK9 A;  3DAI A;  3LQH A;  5E9Y A;  5ENH A;  4BW4 A;  4LYI A;  4PTB A;  5JI8 A;  4ZC9 A;  2RI7 A;  1ZS5 A;  4QEV A;  3S91 A;  4NQN A;  5C89 A;  5FE0 A;  5D3H A;  4NR6 A;  5LKT A;  5E9L A;  5F62 A;  5FE3 A;  4Z6I A;  5I29 A;  4BW1 A;  4TT2 A;  4YBS A;  4Z1S A;  5HQ7 A;  4PCI A;  3DWY A;  4YY6 A;  5DBM A;  4TU6 A;  5HRW A;  4LDF A;  2L84 A;  5C4Q A;  3GG3 A;  4TU4 A;  4MR3 A;  4WHW A;  4WIV A;  4QC3 A;  5EQ1 A;  4Y03 A;  2E7N A;  5FBX A;  3O35 A;  3HMF A;  3MUL A;  2KTB B;  5FE9 A;  5G4R A;  4PKL A;  4TT4 A;  5D3S A;  4YYD A;  4N3W A;  5L96 A;  5CTL A;  5KO4 A;  4N4H A;  5D3T A;  4HXS A;  2DWW A;  5DKC A;  4NR9 A;  3UVD A;  3MQM A;  5BT3 A;  4A9O A;  5CQ7 A;  3G0J A;  3JVL A;  4QEU A;  4TTE A;  3O37 A;  4HBX A;  5CPE A;  4O70 A;  3U5O A;  3U5P A;  3Q2F A;  4QST A;  4LZR A;  5CUA A;  4TYL A;  2H60 A;  3P1E A;  3P5O A;  5ETD A;  5A5N A;  5ACY A;  5FH8 A;  1N72 A;  5F60 A;  4OUF A;  5CY9 A;  4QUU A;  4TQN A;  5E9V A;  3LJW A;  2YEL A;  4IR4 A;  5CQ8 A;  4QB3 A;  5I83 A;  4UIZ A;  5FE4 A;  5A82 A;  4MR6 A;  5E9K A;  5E3D A;  1JM4 B;  4NUE A;  4OGJ A;  2D9E A;  4YBT A;  5I89 A;  4QR4 A;  4HBW A;  5FE7 A;  5F63 A;  4MEN A;  5F2P A;  2RNX A;  5CRZ A;  3JVM A;  3U5M A;  4QBM A;  4A9E A;  5A83 A;  4NRA A;  5BT4 A;  5H1U A;  4YBM A;  3HME A;  5A5R A;  1WUG A;  4E96 A;  4NUC A;  5HEL A;  3TLP A;  5I1Q A;  3LQJ A;  2RFJ A;  5L8U A;  2R0S A;  4XUB A;  5DW1 A;  5FB0 A;  4LR6 A;  5HLS A;  5CS8 A;  4QSX A;  4HXK A;  5KU3 A;  4Z6H A;  4YK0 A;  5ENC A;  4XY9 A;  5I88 A;  2DVS A;  4WHU A;  5G4S A;  4QSS A;  4C66 A;  5E9I A;  3UV4 A;  5CQ5 A;  5IBN A;  4F3I A;  5DLZ A;  5E7D A;  4Q0N A;  4CUR A;  4PCE A;  4TS8 A;  4HBV A;  5E9M A;  3QZS A;  4UYF A;  3ZYU A;  4IR3 A;  2I8N A;  4HXN A;  5A85 A;  2YW5 A;  4O78 A;  5CQ3 A;  5EIC A;  2DVR A;  4LRG A;  5ENJ A;  5DLX A;  2D82 A;  4N4I A;  5A5P A;  2G4A A;  5ENG A;  4MR5 A;  3U5N A;  5E73 A;  3P1D A;  4O76 A;  2RS9 B;  4QYD A;  3UV2 A;  5CQA A;  3U5J A;  5DY7 A;  5FFV A;  5LKX A;  5CQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...