5EICA

Crystal structure of the bromodomain of human crebbp in complex with ayc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Binding Motifs in the CBP Bromodomain: An Analysis of 20 Crystal Structures of Complexes with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eicA00
3Q2FA 3O35A 4NUCA 4QBMA 4O75A 4CFKA 5EQ1A 5FFYA 3U5MA 2YDWA 5C7NA 5IGKA 3MB3A 4CUQA 4QSQA 4HXNA 4Z6HA 4NQMA 5HFRA 3GG3A 5IBNA 4QEVA 4HXMA 5EU1A 5ETBA 4YBTA 4O7CA 5CTLA 4UYDA 5EWVA 5DYXA 5E9YA 5FE2A 5L96A 5D3TA 5A83A 4YYJA 4Z1SA 3MB4A 4QR5A 4CL9A 4TU6A 5JI8A 3LQJA 4WHUA 5ENJA 5FG5A 4LR6A 4IOQA 5ENCA 2D9EA 5HLSA 5F3AA 3O33A 2DWWA 4HXPA 5CUBA 3S92A 5C8GA 5F62A 5F25A 5EPRA 4TZ8A 5E73A 4A9NA 4A9HA 5ENGA 4QSWA 4NXJA 4PS5A 5HQ5A 5CFWA 4Z93A 5ENHA 4MEOA 4ALGA 4E96A 1E6IA 4LRGA 4ALHA 5A5OA 5EA1A 4O78A 4QUUA 3RCWA 3JVLA 5FBXA 3O37A 5EP7A 4LZ2A 4YADA 5FFVA 2FSAA 5DX4A 5I40A 4XUBA 5A81A 4NRAA 4TYLA 5F36A 5FB0A 5F1LA 3NXBA 4HXLA 2R0VA 4PKLA 4UYFA 5A82A 5I29A 5CRZA 4PCEA 5IIDA 4NR9A 4A9JA 4YH4A 4UYFB 4YYGA 5FE4A 2R0SA 4MR4A 4OGJA 5J0DA 5ENFA 4YBSA 4DONA 5CGPA 1F68A 5EM3A 4O70A 5HQ7A 3P5OA 5DFCA 4BHWA 4NUDA 5D7XA 5DW2A 5I80A 5E3GA 5F5ZA 4N4IA 5F60A 3U5OA 3P1EA 5CQ6A 3UW9A 5A85A 4TT2A 4QYDA 5LKZA 4UIXA 3SVGA 5HEMA 4LYIA 5IGMA 3MULA 4YYMA 4QR4A 4YABA 5HCLA 2OSSA 5BT5A 5TB6A 4QSXA 3S91A 5KHMA 5DKCA 5A5PA 4A9IA 2I7KA 4QEWA 3UVYA 5FE9A 4TQNA 5A5QA 3QZTA 5H85A 4O7BA 4Q0NA 4N4FA 4F3IA 2RI7A 4BW4A 3I3JA 5ENEA 5II1A 5FE1A 4PY6A 4YYDA 5HM0A 5LJ0A 2YW5A 5EGUA 3LQHA 4UIVA 5EWCA 5EI4A 4MENA 4CLBA 5LVRA 4UYHA 2L85A 5H1VA 4NYXA 2YYNA 1WUMA 4ZQLA 4YY6A 4TT4A 4HBWA 4OGIA 4A9EA 4QSPA 3ONIA 2DVQA 4CUPA 3LXJA 3TLPA 4QY4A 2YQDA 3D7CA 4YYIA 5ACYA 5DYAA 3G0LA 5CUAA 2L5EA 5FB1A 1EQFA 5I7YA 4QSRA 2YEKA 5D3PA 5CZGA 5FE3A 4NS5A 3IU6A 4XY8A 2RS9B 5IG6A 4WHWA 5LKXA 4XUAA 4WIVA 5AD3A 4YH3A 5I1QA 4MEPA 4BJXA 4A9MA 5HRXA 2WP2A 4YK0A 3U5PA 4O76A 4ZW1A 5II2A 5FDZA 3HMEA 2DVRA 1X0JA 3Q2EA 3MXFA 5A5SA 5D3JA 5E9KA 5KO4A 4YAXA 5IGLA 4NUEA 4PTBA 5I86A 2KTBB 2E3KA 3UVXA 4UIWA 4IORA 5CPEA 4CUSA 5DY7A 3HMHA 4MEQA 5E9VA 5E74A 3U5LA 4O7EA 4QUTA 4O72A 2F6JA 2RO1A 2F6NA 4QZSA 5I89A 4NR6A 4CUUA 5CUCA 3AQAA 5E9LA 4UYEA 4HBVA 5DYCA 4LYWA 5E7DA 3U5KA 2OUOA 5G4RA 2N9GA 4LZRA 3UVDA 3UV4A 4UITA 2RNXA 5LKUA 5LJ1A 4O71A 4YYKA 5CY9A 2I8NA 5DLZA 3JVMA 2H60A 4O74A 5FE0A 4QYLA 4C66A 5EICA 5EWHA 5IGNA 5FH6A 4O7AA 5LJ2A 2DKWA 5HENA 5EVAA 5ETDA 1JM4B 3U5JA 5FE8A 4LC2A 5CQ3A 2GRCA 4NYVA 5CQTA 4J0RA 4TS8A 3UV2A 4NYWA 5HJCA 3UVWA 5D3LA 4Q0OA 5KTWA 2E7OA 5H1TA 5CQAA 5FG4A 4HXKA 4QR3A 3P1FA 5CUDA 1JSPB 5KU3A 5I88A 5CUEA 5FH8A 3AADA 5C4QA 4IR5A 5ENIA 5CS8A 4ZC9A 4UYGA 2RFJA 4NR8A 4QSUA 4CUTA 2D82A 4NR7A 5D25A 5C87A 4GPJA 4BW3A 4BW2A 5E9IA 5A5NA 4RVRA 4YC9A 4YYHA 5DYUA 2DVSA 5L99A 4XY9A 3O34A 5I83A 5FE5A 3QZSA 5CP5A 5JWMA 2WP1A 5KTXA 1ZS5A 4O77A 2DATA 4LZSA 5A7CA 5EWWA 4NRBA 5TCMA 4HXOA 3DAIA 4C67A 3JVKA 5CUGA 4LYSA 5AMFA 4QSTA 5D24A 5D3HA 4UIYA 5CRMA 4XYAA 3P1DA 5F2PA 4IOOA 5CQ5A 4QEUA 3LJWA 4YY4A 5HQ6A 3O36A 5HRWA 4AKNA 5DKHA 5FG6A 3HMFA 5EISA 3MQMA 4HXRA 5G4SA 5F63A 5L98A 3ZYUA 4A9FA 5FE7A 5DFBA 4KCXA 4PCIA 4NR5A 5D3RA 4TT6A 3QZVA 4NR4A 5EK9A 4HXSA 3U5NA 5FFWA 5COIA 5F1HA 5KTUA 3P1CA 5D26A 5EWDA 3UV5A 5DLXA 5DKDA 5DW1A 2NXBA 4X2IA 3SVFA 4MR5A 5DBMA 5K29A 5L8TA 4N3WA 4Z1QA 5AMEA 4QC1A 5HRVA 2YELA 5EV9A 4FLPA 5EPSA 4Z6IA 2DVVA 2LSPB 4J1PA 4QNSA 5DFDA 5HELA 2MJVB 5E9MA 5FH7A 2R10A 4Y03A 4CURA 2OO1A 2L84A 5EPBA 2RNYA 3JVJA 3IU5A 4J3IA 3SVHA 3K2JA 4TTEA 4TU4A 5FE6A 4KV4A 5BT4A 4QSVA 3FKMX 2YEMA 4UIUA 5D0CA 4YBMA 4HBYA 4IR4A 4IR6A 4HBXA 4MR3A 4QC3A 4O7FA 3LQIA 5F61A 5L97A 5C89A 5I7XA 4KV1A 5D3SA 4UIZA 5LVQA 1N72A 5AD2A 2R0YA 5C85A 4CFLA 3MUKA 4NRCA 4A9KA 4A9OA 4NQNA 5E0RA 5L8UA 5D3NA 2RNWA 4YATA 5LUUA 2E7NA 4YYNA 1WUGA 5CQ4A 4IR3A 5LKTA 5A5RA 5HFQA 4LDFA 4QB3A 4QSSA 4A9LA 5H1UA 4TZ2A 5ENBA 4MR6A 3G0JA 4OUFA 4BW1A 5CU8A 5CQ7A 4N4GA 4J0SA 2G4AA 5CQ8A 5BT3A 3DWYA 4N4HA 5E3DA
chains in the Genus database with same CATH superfamily
3Q2FA 3O35A 4NUCA 4AKIA 4QBMA 4O75A 4CFKA 5EQ1A 5FFYA 3U5MA 2YDWA 5C7NA 5IGKA 3MB3A 4CUQA 4QSQA 4HXNA 4Z6HA 4NQMA 5HFRA 3GG3A 5IBNA 4QEVA 4HXMA 5EU1A 5ETBA 4YBTA 4O7CA 5CTLA 4UYDA 5EWVA 5DYXA 5E9YA 5FE2A 5L96A 5D3TA 5A83A 4YYJA 4Z1SA 3MB4A 4QR5A 4CL9A 4TU6A 3ERRA 5JI8A 3LQJA 4WHUA 5ENJA 5FG5A 4LR6A 4IOQA 5ENCA 2D9EA 5HLSA 5F3AA 3O33A 2DWWA 4HXPA 5CUBA 3S92A 5C8GA 5F62A 5F25A 5EPRA 4TZ8A 3D1BA 5E73A 4A9NA 4A9HA 5ENGA 4QSWA 4NXJA 4PS5A 5HQ5A 5CFWA 4Z93A 5ENHA 4MEOA 4ALGA 4E96A 1E6IA 4LRGA 4ALHA 5A5OA 5EA1A 4O78A 4QUUA 3RCWA 3JVLA 5FBXA 3O37A 1ZKRA 5EP7A 4LZ2A 4YADA 5FFVA 2FSAA 5DX4A 5I40A 4XUBA 5A81A 4NRAA 4TYLA 5F36A 5FB0A 5F1LA 3NXBA 4HXLA 2R0VA 4PKLA 4UYFA 5A82A 5I29A 5CRZA 4PCEA 5IIDA 4NR9A 4A9JA 4YH4A 4UYFB 4YYGA 5FE4A 2R0SA 4MR4A 4OGJA 5J0DA 5ENFA 4YBSA 4DONA 5CGPA 1F68A 5EM3A 4O70A 5HQ7A 3P5OA 5DFCA 4BHWA 3VKHA 4NUDA 5D7XA 5DW2A 5I80A 5E3GA 5F5ZA 4N4IA 5F60A 3U5OA 3P1EA 5CQ6A 3UW9A 5A85A 4TT2A 4QYDA 5LKZA 4UIXA 3SVGA 5HEMA 4LYIA 5IGMA 3MULA 4YYMA 1PUOA 4QR4A 4YABA 5HCLA 2OSSA 5BT5A 5TB6A 4QSXA 3S91A 5KHMA 5DKCA 5A5PA 4A9IA 2I7KA 4QEWA 3UVYA 5FE9A 4TQNA 5A5QA 3QZTA 5H85A 4O7BA 4Q0NA 4N4FA 4F3IA 2RI7A 4BW4A 3I3JA 5ENEA 5II1A 5FE1A 4PY6A 4YYDA 5HM0A 5LJ0A 2YW5A 5EGUA 3LQHA 4UIVA 5EWCA 5EI4A 4MENA 4CLBA 5LVRA 4UYHA 2L85A 5H1VA 4NYXA 2YYNA 1WUMA 4ZQLA 4YY6A 4TT4A 4HBWA 4OGIA 4A9EA 4QSPA 3ONIA 2DVQA 4CUPA 3LXJA 3TLPA 4QY4A 2YQDA 3D7CA 4YYIA 5ACYA 5DYAA 3G0LA 5CUAA 2L5EA 5FB1A 1EQFA 5I7YA 4QSRA 2YEKA 5D3PA 5CZGA 5FE3A 4NS5A 3IU6A 4XY8A 2RS9B 5IG6A 4WHWA 5LKXA 4XUAA 4WIVA 5AD3A 4YH3A 5I1QA 4MEPA 4BJXA 4A9MA 5HRXA 2WP2A 4YK0A 3U5PA 4O76A 4ZW1A 5II2A 5FDZA 3HMEA 2DVRA 4AKHA 1X0JA 3Q2EA 3MXFA 5A5SA 5D3JA 5E9KA 5KO4A 4YAXA 5IGLA 4NUEA 4PTBA 5I86A 2KTBB 2E3KA 3UVXA 4UIWA 4IORA 5CPEA 4CUSA 5DY7A 3HMHA 4MEQA 5E9VA 5E74A 3U5LA 4O7EA 4QUTA 4O72A 2F6JA 2RO1A 2F6NA 4QZSA 5I89A 4NR6A 4CUUA 5CUCA 3AQAA 5E9LA 4UYEA 4HBVA 5DYCA 4LYWA 5E7DA 3U5KA 2OUOA 5G4RA 2N9GA 4LZRA 3UVDA 3UV4A 4UITA 2RNXA 5LKUA 5LJ1A 4O71A 4YYKA 5CY9A 2I8NA 5DLZA 3JVMA 2H60A 4O74A 5FE0A 4QYLA 4C66A 5EICA 5EWHA 5IGNA 5FH6A 4O7AA 5LJ2A 2DKWA 5HENA 5EVAA 5ETDA 1JM4B 3U5JA 5FE8A 4LC2A 5CQ3A 2GRCA 4NYVA 5CQTA 4J0RA 4TS8A 3UV2A 4NYWA 5HJCA 3UVWA 5D3LA 4Q0OA 5KTWA 2E7OA 5H1TA 3D1DA 5CQAA 5FG4A 4AI6A 4HXKA 4QR3A 3P1FA 5CUDA 1JSPB 5KU3A 5I88A 5CUEA 5FH8A 3AADA 5C4QA 4IR5A 5ENIA 5CS8A 4ZC9A 4UYGA 2RFJA 4NR8A 4QSUA 4CUTA 2D82A 4NR7A 5D25A 5C87A 4GPJA 4BW3A 4BW2A 5E9IA 5A5NA 4RVRA 4YC9A 4YYHA 5DYUA 2DVSA 5L99A 4XY9A 3O34A 5I83A 5FE5A 3QZSA 5CP5A 5JWMA 2WP1A 5KTXA 1ZS5A 4O77A 2DATA 4LZSA 5A7CA 5EWWA 4NRBA 5TCMA 4HXOA 3DAIA 4C67A 3JVKA 4AKGA 5CUGA 4LYSA 5AMFA 4QSTA 5D24A 5D3HA 4UIYA 5CRMA 4XYAA 3P1DA 5F2PA 4IOOA 5CQ5A 4QEUA 3LJWA 4YY4A 5HQ6A 3O36A 5HRWA 4AKNA 5DKHA 5FG6A 3HMFA 5EISA 3MQMA 4HXRA 5G4SA 5F63A 5L98A 3ZYUA 4A9FA 5FE7A 5DFBA 4KCXA 4PCIA 4NR5A 5D3RA 4TT6A 3QZVA 4NR4A 5EK9A 4HXSA 3U5NA 5FFWA 5COIA 5F1HA 5KTUA 3P1CA 5D26A 5EWDA 3UV5A 5DLXA 5DKDA 5DW1A 2NXBA 4X2IA 3SVFA 4MR5A 5DBMA 5K29A 5L8TA 4N3WA 4Z1QA 5AMEA 4QC1A 5HRVA 2YELA 5EV9A 4FLPA 5EPSA 4Z6IA 2DVVA 2LSPB 4J1PA 4QNSA 5DFDA 5HELA 2MJVB 5E9MA 5FH7A 2R10A 4Y03A 4CURA 2OO1A 2L84A 5EPBA 2RNYA 3JVJA 3IU5A 4J3IA 3SVHA 3K2JA 4TTEA 4TU4A 5FE6A 4KV4A 5BT4A 4QSVA 3VKGA 3FKMX 2EJNA 2YEMA 4UIUA 5D0CA 4YBMA 4HBYA 4IR4A 4IR6A 4HBXA 4MR3A 4QC3A 4O7FA 3LQIA 5F61A 5L97A 5C89A 5I7XA 4KV1A 5D3SA 4UIZA 5LVQA 1N72A 5AD2A 2R0YA 5C85A 4CFLA 3MUKA 4NRCA 4A9KA 4A9OA 4NQNA 5E0RA 5L8UA 5D3NA 2RNWA 4YATA 5LUUA 2E7NA 4YYNA 1WUGA 5CQ4A 4IR3A 5LKTA 5A5RA 5HFQA 4LDFA 4QB3A 4QSSA 4A9LA 5H1UA 4TZ2A 5ENBA 4MR6A 3G0JA 4OUFA 4BW1A 5CU8A 5CQ7A 4N4GA 4J0SA 2G4AA 5CQ8A 5BT3A 3DWYA 4N4HA 5E3DA
chains in the Genus database with same CATH topology
3Q2FA 3O35A 4NUCA 4QBMA 4O75A 4CFKA 5EQ1A 5FFYA 3U5MA 2YDWA 5C7NA 5IGKA 3MB3A 4CUQA 4QSQA 4HXNA 4Z6HA 4NQMA 5HFRA 3GG3A 5IBNA 4QEVA 4HXMA 5EU1A 5ETBA 4YBTA 4O7CA 5CTLA 4UYDA 5EWVA 5DYXA 5E9YA 5FE2A 5L96A 5D3TA 5A83A 4YYJA 4Z1SA 3MB4A 4QR5A 4CL9A 4TU6A 5JI8A 3LQJA 4WHUA 5ENJA 5FG5A 4LR6A 4IOQA 5ENCA 2D9EA 5HLSA 5F3AA 3O33A 2DWWA 4HXPA 5CUBA 3S92A 5C8GA 5F62A 5F25A 5EPRA 4TZ8A 5E73A 4A9NA 4A9HA 5ENGA 4QSWA 4NXJA 4PS5A 5HQ5A 5CFWA 4Z93A 5ENHA 4MEOA 4ALGA 4E96A 1E6IA 4LRGA 4ALHA 5A5OA 5EA1A 4O78A 4QUUA 3RCWA 3JVLA 5FBXA 3O37A 5EP7A 4LZ2A 4YADA 5FFVA 2FSAA 5DX4A 5I40A 4XUBA 5A81A 4NRAA 4TYLA 5F36A 5FB0A 5F1LA 3NXBA 4HXLA 2R0VA 4PKLA 4UYFA 5A82A 5I29A 5CRZA 4PCEA 5IIDA 4NR9A 4A9JA 4YH4A 4UYFB 4YYGA 5FE4A 2R0SA 4MR4A 4OGJA 5J0DA 5ENFA 4YBSA 4DONA 5CGPA 1F68A 5EM3A 4O70A 5HQ7A 3P5OA 5DFCA 4BHWA 4NUDA 5D7XA 5DW2A 5I80A 5E3GA 5F5ZA 4N4IA 5F60A 3U5OA 3P1EA 5CQ6A 3UW9A 5A85A 4TT2A 4QYDA 5LKZA 4UIXA 3SVGA 5HEMA 4LYIA 5IGMA 3MULA 4YYMA 4QR4A 4YABA 5HCLA 2OSSA 5BT5A 5TB6A 4QSXA 3S91A 5KHMA 5DKCA 5A5PA 4A9IA 2I7KA 4QEWA 3UVYA 5FE9A 4TQNA 5A5QA 3QZTA 5H85A 4O7BA 4Q0NA 4N4FA 4F3IA 2RI7A 4BW4A 3I3JA 5ENEA 5II1A 5FE1A 4PY6A 4YYDA 5HM0A 5LJ0A 2YW5A 5EGUA 3LQHA 4UIVA 5EWCA 5EI4A 4MENA 4CLBA 5LVRA 4UYHA 2L85A 5H1VA 4NYXA 2YYNA 1WUMA 4ZQLA 4YY6A 4TT4A 4HBWA 4OGIA 4A9EA 4QSPA 3ONIA 2DVQA 4CUPA 3LXJA 3TLPA 4QY4A 2YQDA 3D7CA 4YYIA 5ACYA 5DYAA 3G0LA 5CUAA 2L5EA 5FB1A 1EQFA 5I7YA 4QSRA 2YEKA 5D3PA 5CZGA 5FE3A 4NS5A 3IU6A 4XY8A 2RS9B 5IG6A 4WHWA 5LKXA 4XUAA 4WIVA 5AD3A 4YH3A 5I1QA 4MEPA 4BJXA 4A9MA 5HRXA 2WP2A 4YK0A 3U5PA 4O76A 4ZW1A 5II2A 5FDZA 3HMEA 2DVRA 1X0JA 3Q2EA 3MXFA 5A5SA 5D3JA 5E9KA 5KO4A 4YAXA 5IGLA 4NUEA 4PTBA 5I86A 2KTBB 2E3KA 3UVXA 4UIWA 4IORA 5CPEA 4CUSA 5DY7A 3HMHA 4MEQA 5E9VA 5E74A 3U5LA 4O7EA 4QUTA 4O72A 2F6JA 2RO1A 2F6NA 4QZSA 5I89A 4NR6A 4CUUA 5CUCA 3AQAA 5E9LA 4UYEA 4HBVA 5DYCA 4LYWA 5E7DA 3U5KA 2OUOA 5G4RA 2N9GA 4LZRA 3UVDA 3UV4A 4UITA 2RNXA 5LKUA 5LJ1A 4O71A 4YYKA 5CY9A 2I8NA 5DLZA 3JVMA 2H60A 4O74A 5FE0A 4QYLA 4C66A 5EICA 5EWHA 5IGNA 5FH6A 4O7AA 5LJ2A 2DKWA 5HENA 5EVAA 5ETDA 1JM4B 3U5JA 5FE8A 4LC2A 5CQ3A 2GRCA 4NYVA 5CQTA 4J0RA 4TS8A 3UV2A 4NYWA 5HJCA 3UVWA 5D3LA 4Q0OA 5KTWA 2E7OA 5H1TA 5CQAA 5FG4A 4HXKA 4QR3A 3P1FA 5CUDA 1JSPB 5KU3A 5I88A 5CUEA 5FH8A 3AADA 5C4QA 4IR5A 5ENIA 5CS8A 4ZC9A 4UYGA 2RFJA 4NR8A 4QSUA 4CUTA 2D82A 4NR7A 5D25A 5C87A 4GPJA 4BW3A 4BW2A 5E9IA 5A5NA 4RVRA 4YC9A 4YYHA 5DYUA 2DVSA 5L99A 4XY9A 3O34A 5I83A 5FE5A 3QZSA 5CP5A 5JWMA 2WP1A 5KTXA 1ZS5A 4O77A 2DATA 4LZSA 5A7CA 5EWWA 4NRBA 5TCMA 4HXOA 3DAIA 4C67A 3JVKA 5CUGA 4LYSA 5AMFA 4QSTA 5D24A 5D3HA 4UIYA 5CRMA 4XYAA 3P1DA 5F2PA 4IOOA 5CQ5A 4QEUA 3LJWA 4YY4A 5HQ6A 3O36A 5HRWA 4AKNA 5DKHA 5FG6A 3HMFA 5EISA 3MQMA 4HXRA 5G4SA 5F63A 5L98A 3ZYUA 4A9FA 5FE7A 5DFBA 4KCXA 4PCIA 4NR5A 5D3RA 4TT6A 3QZVA 4NR4A 5EK9A 4HXSA 3U5NA 5FFWA 5COIA 5F1HA 5KTUA 3P1CA 5D26A 5EWDA 3UV5A 5DLXA 5DKDA 5DW1A 2NXBA 4X2IA 3SVFA 4MR5A 5DBMA 5K29A 5L8TA 4N3WA 4Z1QA 5AMEA 4QC1A 5HRVA 2YELA 5EV9A 4FLPA 5EPSA 4Z6IA 2DVVA 2LSPB 4J1PA 4QNSA 5DFDA 5HELA 2MJVB 5E9MA 5FH7A 2R10A 4Y03A 4CURA 2OO1A 2L84A 5EPBA 2RNYA 3JVJA 3IU5A 4J3IA 3SVHA 3K2JA 4TTEA 4TU4A 5FE6A 4KV4A 5BT4A 4QSVA 3FKMX 2YEMA 4UIUA 5D0CA 4YBMA 4HBYA 4IR4A 4IR6A 4HBXA 4MR3A 4QC3A 4O7FA 3LQIA 5F61A 5L97A 5C89A 5I7XA 4KV1A 5D3SA 4UIZA 5LVQA 1N72A 5AD2A 2R0YA 5C85A 4CFLA 3MUKA 4NRCA 4A9KA 4A9OA 4NQNA 5E0RA 5L8UA 5D3NA 2RNWA 4YATA 5LUUA 2E7NA 4YYNA 1WUGA 5CQ4A 4IR3A 5LKTA 5A5RA 5HFQA 4LDFA 4QB3A 4QSSA 4A9LA 5H1UA 4TZ2A 5ENBA 4MR6A 3G0JA 4OUFA 4BW1A 5CU8A 5CQ7A 4N4GA 4J0SA 2G4AA 5CQ8A 5BT3A 3DWYA 4N4HA 5E3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2F A;  3O35 A;  4NUC A;  4QBM A;  4O75 A;  4CFK A;  5EQ1 A;  5FFY A;  3U5M A;  2YDW A;  5C7N A;  5IGK A;  3MB3 A;  4CUQ A;  4QSQ A;  4HXN A;  4Z6H A;  4NQM A;  5HFR A;  3GG3 A;  5IBN A;  4QEV A;  4HXM A;  5EU1 A;  5ETB A;  4YBT A;  4O7C A;  5CTL A;  4UYD A;  5EWV A;  5DYX A;  5E9Y A;  5FE2 A;  5L96 A;  5D3T A;  5A83 A;  4YYJ A;  4Z1S A;  3MB4 A;  4QR5 A;  4CL9 A;  4TU6 A;  5JI8 A;  3LQJ A;  4WHU A;  5ENJ A;  5FG5 A;  4LR6 A;  4IOQ A;  5ENC A;  2D9E A;  5HLS A;  5F3A A;  3O33 A;  2DWW A;  4HXP A;  5CUB A;  3S92 A;  5C8G A;  5F62 A;  5F25 A;  5EPR A;  4TZ8 A;  5E73 A;  4A9N A;  4A9H A;  5ENG A;  4QSW A;  4NXJ A;  4PS5 A;  5HQ5 A;  5CFW A;  4Z93 A;  5ENH A;  4MEO A;  4ALG A;  4E96 A;  1E6I A;  4LRG A;  4ALH A;  5A5O A;  5EA1 A;  4O78 A;  4QUU A;  3RCW A;  3JVL A;  5FBX A;  3O37 A;  5EP7 A;  4LZ2 A;  4YAD A;  5FFV A;  2FSA A;  5DX4 A;  5I40 A;  4XUB A;  5A81 A;  4NRA A;  4TYL A;  5F36 A;  5FB0 A;  5F1L A;  3NXB A;  4HXL A;  2R0V A;  4PKL A;  4UYF A;  5A82 A;  5I29 A;  5CRZ A;  4PCE A;  5IID A;  4NR9 A;  4A9J A;  4YH4 A;  4UYF B;  4YYG A;  5FE4 A;  2R0S A;  4MR4 A;  4OGJ A;  5J0D A;  5ENF A;  4YBS A;  4DON A;  5CGP A;  1F68 A;  5EM3 A;  4O70 A;  5HQ7 A;  3P5O A;  5DFC A;  4BHW A;  4NUD A;  5D7X A;  5DW2 A;  5I80 A;  5E3G A;  5F5Z A;  4N4I A;  5F60 A;  3U5O A;  3P1E A;  5CQ6 A;  3UW9 A;  5A85 A;  4TT2 A;  4QYD A;  5LKZ A;  4UIX A;  3SVG A;  5HEM A;  4LYI A;  5IGM A;  3MUL A;  4YYM A;  4QR4 A;  4YAB A;  5HCL A;  2OSS A;  5BT5 A;  5TB6 A;  4QSX A;  3S91 A;  5KHM A;  5DKC A;  5A5P A;  4A9I A;  2I7K A;  4QEW A;  3UVY A;  5FE9 A;  4TQN A;  5A5Q A;  3QZT A;  5H85 A;  4O7B A;  4Q0N A;  4N4F A;  4F3I A;  2RI7 A;  4BW4 A;  3I3J A;  5ENE A;  5II1 A;  5FE1 A;  4PY6 A;  4YYD A;  5HM0 A;  5LJ0 A;  2YW5 A;  5EGU A;  3LQH A;  4UIV A;  5EWC A;  5EI4 A;  4MEN A;  4CLB A;  5LVR A;  4UYH A;  2L85 A;  5H1V A;  4NYX A;  2YYN A;  1WUM A;  4ZQL A;  4YY6 A;  4TT4 A;  4HBW A;  4OGI A;  4A9E A;  4QSP A;  3ONI A;  2DVQ A;  4CUP A;  3LXJ A;  3TLP A;  4QY4 A;  2YQD A;  3D7C A;  4YYI A;  5ACY A;  5DYA A;  3G0L A;  5CUA A;  2L5E A;  5FB1 A;  1EQF A;  5I7Y A;  4QSR A;  2YEK A;  5D3P A;  5CZG A;  5FE3 A;  4NS5 A;  3IU6 A;  4XY8 A;  2RS9 B;  5IG6 A;  4WHW A;  5LKX A;  4XUA A;  4WIV A;  5AD3 A;  4YH3 A;  5I1Q A;  4MEP A;  4BJX A;  4A9M A;  5HRX A;  2WP2 A;  4YK0 A;  3U5P A;  4O76 A;  4ZW1 A;  5II2 A;  5FDZ A;  3HME A;  2DVR A;  1X0J A;  3Q2E A;  3MXF A;  5A5S A;  5D3J A;  5E9K A;  5KO4 A;  4YAX A;  5IGL A;  4NUE A;  4PTB A;  5I86 A;  2KTB B;  2E3K A;  3UVX A;  4UIW A;  4IOR A;  5CPE A;  4CUS A;  5DY7 A;  3HMH A;  4MEQ A;  5E9V A;  5E74 A;  3U5L A;  4O7E A;  4QUT A;  4O72 A;  2F6J A;  2RO1 A;  2F6N A;  4QZS A;  5I89 A;  4NR6 A;  4CUU A;  5CUC A;  3AQA A;  5E9L A;  4UYE A;  4HBV A;  5DYC A;  4LYW A;  5E7D A;  3U5K A;  2OUO A;  5G4R A;  2N9G A;  4LZR A;  3UVD A;  3UV4 A;  4UIT A;  2RNX A;  5LKU A;  5LJ1 A;  4O71 A;  4YYK A;  5CY9 A;  2I8N A;  5DLZ A;  3JVM A;  2H60 A;  4O74 A;  5FE0 A;  4QYL A;  4C66 A;  5EIC A;  5EWH A;  5IGN A;  5FH6 A;  4O7A A;  5LJ2 A;  2DKW A;  5HEN A;  5EVA A;  5ETD A;  1JM4 B;  3U5J A;  5FE8 A;  4LC2 A;  5CQ3 A;  2GRC A;  4NYV A;  5CQT A;  4J0R A;  4TS8 A;  3UV2 A;  4NYW A;  5HJC A;  3UVW A;  5D3L A;  4Q0O A;  5KTW A;  2E7O A;  5H1T A;  5CQA A;  5FG4 A;  4HXK A;  4QR3 A;  3P1F A;  5CUD A;  1JSP B;  5KU3 A;  5I88 A;  5CUE A;  5FH8 A;  3AAD A;  5C4Q A;  4IR5 A;  5ENI A;  5CS8 A;  4ZC9 A;  4UYG A;  2RFJ A;  4NR8 A;  4QSU A;  4CUT A;  2D82 A;  4NR7 A;  5D25 A;  5C87 A;  4GPJ A;  4BW3 A;  4BW2 A;  5E9I A;  5A5N A;  4RVR A;  4YC9 A;  4YYH A;  5DYU A;  2DVS A;  5L99 A;  4XY9 A;  3O34 A;  5I83 A;  5FE5 A;  3QZS A;  5CP5 A;  5JWM A;  2WP1 A;  5KTX A;  1ZS5 A;  4O77 A;  2DAT A;  4LZS A;  5A7C A;  5EWW A;  4NRB A;  5TCM A;  4HXO A;  3DAI A;  4C67 A;  3JVK A;  5CUG A;  4LYS A;  5AMF A;  4QST A;  5D24 A;  5D3H A;  4UIY A;  5CRM A;  4XYA A;  3P1D A;  5F2P A;  4IOO A;  5CQ5 A;  4QEU A;  3LJW A;  4YY4 A;  5HQ6 A;  3O36 A;  5HRW A;  4AKN A;  5DKH A;  5FG6 A;  3HMF A;  5EIS A;  3MQM A;  4HXR A;  5G4S A;  5F63 A;  5L98 A;  3ZYU A;  4A9F A;  5FE7 A;  5DFB A;  4KCX A;  4PCI A;  4NR5 A;  5D3R A;  4TT6 A;  3QZV A;  4NR4 A;  5EK9 A;  4HXS A;  3U5N A;  5FFW A;  5COI A;  5F1H A;  5KTU A;  3P1C A;  5D26 A;  5EWD A;  3UV5 A;  5DLX A;  5DKD A;  5DW1 A;  2NXB A;  4X2I A;  3SVF A;  4MR5 A;  5DBM A;  5K29 A;  5L8T A;  4N3W A;  4Z1Q A;  5AME A;  4QC1 A;  5HRV A;  2YEL A;  5EV9 A;  4FLP A;  5EPS A;  4Z6I A;  2DVV A;  2LSP B;  4J1P A;  4QNS A;  5DFD A;  5HEL A;  2MJV B;  5E9M A;  5FH7 A;  2R10 A;  4Y03 A;  4CUR A;  2OO1 A;  2L84 A;  5EPB A;  2RNY A;  3JVJ A;  3IU5 A;  4J3I A;  3SVH A;  3K2J A;  4TTE A;  4TU4 A;  5FE6 A;  4KV4 A;  5BT4 A;  4QSV A;  3FKM X;  2YEM A;  4UIU A;  5D0C A;  4YBM A;  4HBY A;  4IR4 A;  4IR6 A;  4HBX A;  4MR3 A;  4QC3 A;  4O7F A;  3LQI A;  5F61 A;  5L97 A;  5C89 A;  5I7X A;  4KV1 A;  5D3S A;  4UIZ A;  5LVQ A;  1N72 A;  5AD2 A;  2R0Y A;  5C85 A;  4CFL A;  3MUK A;  4NRC A;  4A9K A;  4A9O A;  4NQN A;  5E0R A;  5L8U A;  5D3N A;  2RNW A;  4YAT A;  5LUU A;  2E7N A;  4YYN A;  1WUG A;  5CQ4 A;  4IR3 A;  5LKT A;  5A5R A;  5HFQ A;  4LDF A;  4QB3 A;  4QSS A;  4A9L A;  5H1U A;  4TZ2 A;  5ENB A;  4MR6 A;  3G0J A;  4OUF A;  4BW1 A;  5CU8 A;  5CQ7 A;  4N4G A;  4J0S A;  2G4A A;  5CQ8 A;  5BT3 A;  3DWY A;  4N4H A;  5E3D A; 
#chains in the Genus database with same CATH topology
 3Q2F A;  3O35 A;  4NUC A;  4AKI A;  4QBM A;  4O75 A;  4CFK A;  5EQ1 A;  5FFY A;  3U5M A;  2YDW A;  5C7N A;  5IGK A;  3MB3 A;  4CUQ A;  4QSQ A;  4HXN A;  4Z6H A;  4NQM A;  5HFR A;  3GG3 A;  5IBN A;  4QEV A;  4HXM A;  5EU1 A;  5ETB A;  4YBT A;  4O7C A;  5CTL A;  4UYD A;  5EWV A;  5DYX A;  5E9Y A;  5FE2 A;  5L96 A;  5D3T A;  5A83 A;  4YYJ A;  4Z1S A;  3MB4 A;  4QR5 A;  4CL9 A;  4TU6 A;  3ERR A;  5JI8 A;  3LQJ A;  4WHU A;  5ENJ A;  5FG5 A;  4LR6 A;  4IOQ A;  5ENC A;  2D9E A;  5HLS A;  5F3A A;  3O33 A;  2DWW A;  4HXP A;  5CUB A;  3S92 A;  5C8G A;  5F62 A;  5F25 A;  5EPR A;  4TZ8 A;  3D1B A;  5E73 A;  4A9N A;  4A9H A;  5ENG A;  4QSW A;  4NXJ A;  4PS5 A;  5HQ5 A;  5CFW A;  4Z93 A;  5ENH A;  4MEO A;  4ALG A;  4E96 A;  1E6I A;  4LRG A;  4ALH A;  5A5O A;  5EA1 A;  4O78 A;  4QUU A;  3RCW A;  3JVL A;  5FBX A;  3O37 A;  1ZKR A;  5EP7 A;  4LZ2 A;  4YAD A;  5FFV A;  2FSA A;  5DX4 A;  5I40 A;  4XUB A;  5A81 A;  4NRA A;  4TYL A;  5F36 A;  5FB0 A;  5F1L A;  3NXB A;  4HXL A;  2R0V A;  4PKL A;  4UYF A;  5A82 A;  5I29 A;  5CRZ A;  4PCE A;  5IID A;  4NR9 A;  4A9J A;  4YH4 A;  4UYF B;  4YYG A;  5FE4 A;  2R0S A;  4MR4 A;  4OGJ A;  5J0D A;  5ENF A;  4YBS A;  4DON A;  5CGP A;  1F68 A;  5EM3 A;  4O70 A;  5HQ7 A;  3P5O A;  5DFC A;  4BHW A;  3VKH A;  4NUD A;  5D7X A;  5DW2 A;  5I80 A;  5E3G A;  5F5Z A;  4N4I A;  5F60 A;  3U5O A;  3P1E A;  5CQ6 A;  3UW9 A;  5A85 A;  4TT2 A;  4QYD A;  5LKZ A;  4UIX A;  3SVG A;  5HEM A;  4LYI A;  5IGM A;  3MUL A;  4YYM A;  1PUO A;  4QR4 A;  4YAB A;  5HCL A;  2OSS A;  5BT5 A;  5TB6 A;  4QSX A;  3S91 A;  5KHM A;  5DKC A;  5A5P A;  4A9I A;  2I7K A;  4QEW A;  3UVY A;  5FE9 A;  4TQN A;  5A5Q A;  3QZT A;  5H85 A;  4O7B A;  4Q0N A;  4N4F A;  4F3I A;  2RI7 A;  4BW4 A;  3I3J A;  5ENE A;  5II1 A;  5FE1 A;  4PY6 A;  4YYD A;  5HM0 A;  5LJ0 A;  2YW5 A;  5EGU A;  3LQH A;  4UIV A;  5EWC A;  5EI4 A;  4MEN A;  4CLB A;  5LVR A;  4UYH A;  2L85 A;  5H1V A;  4NYX A;  2YYN A;  1WUM A;  4ZQL A;  4YY6 A;  4TT4 A;  4HBW A;  4OGI A;  4A9E A;  4QSP A;  3ONI A;  2DVQ A;  4CUP A;  3LXJ A;  3TLP A;  4QY4 A;  2YQD A;  3D7C A;  4YYI A;  5ACY A;  5DYA A;  3G0L A;  5CUA A;  2L5E A;  5FB1 A;  1EQF A;  5I7Y A;  4QSR A;  2YEK A;  5D3P A;  5CZG A;  5FE3 A;  4NS5 A;  3IU6 A;  4XY8 A;  2RS9 B;  5IG6 A;  4WHW A;  5LKX A;  4XUA A;  4WIV A;  5AD3 A;  4YH3 A;  5I1Q A;  4MEP A;  4BJX A;  4A9M A;  5HRX A;  2WP2 A;  4YK0 A;  3U5P A;  4O76 A;  4ZW1 A;  5II2 A;  5FDZ A;  3HME A;  2DVR A;  4AKH A;  1X0J A;  3Q2E A;  3MXF A;  5A5S A;  5D3J A;  5E9K A;  5KO4 A;  4YAX A;  5IGL A;  4NUE A;  4PTB A;  5I86 A;  2KTB B;  2E3K A;  3UVX A;  4UIW A;  4IOR A;  5CPE A;  4CUS A;  5DY7 A;  3HMH A;  4MEQ A;  5E9V A;  5E74 A;  3U5L A;  4O7E A;  4QUT A;  4O72 A;  2F6J A;  2RO1 A;  2F6N A;  4QZS A;  5I89 A;  4NR6 A;  4CUU A;  5CUC A;  3AQA A;  5E9L A;  4UYE A;  4HBV A;  5DYC A;  4LYW A;  5E7D A;  3U5K A;  2OUO A;  5G4R A;  2N9G A;  4LZR A;  3UVD A;  3UV4 A;  4UIT A;  2RNX A;  5LKU A;  5LJ1 A;  4O71 A;  4YYK A;  5CY9 A;  2I8N A;  5DLZ A;  3JVM A;  2H60 A;  4O74 A;  5FE0 A;  4QYL A;  4C66 A;  5EIC A;  5EWH A;  5IGN A;  5FH6 A;  4O7A A;  5LJ2 A;  2DKW A;  5HEN A;  5EVA A;  5ETD A;  1JM4 B;  3U5J A;  5FE8 A;  4LC2 A;  5CQ3 A;  2GRC A;  4NYV A;  5CQT A;  4J0R A;  4TS8 A;  3UV2 A;  4NYW A;  5HJC A;  3UVW A;  5D3L A;  4Q0O A;  5KTW A;  2E7O A;  5H1T A;  3D1D A;  5CQA A;  5FG4 A;  4AI6 A;  4HXK A;  4QR3 A;  3P1F A;  5CUD A;  1JSP B;  5KU3 A;  5I88 A;  5CUE A;  5FH8 A;  3AAD A;  5C4Q A;  4IR5 A;  5ENI A;  5CS8 A;  4ZC9 A;  4UYG A;  2RFJ A;  4NR8 A;  4QSU A;  4CUT A;  2D82 A;  4NR7 A;  5D25 A;  5C87 A;  4GPJ A;  4BW3 A;  4BW2 A;  5E9I A;  5A5N A;  4RVR A;  4YC9 A;  4YYH A;  5DYU A;  2DVS A;  5L99 A;  4XY9 A;  3O34 A;  5I83 A;  5FE5 A;  3QZS A;  5CP5 A;  5JWM A;  2WP1 A;  5KTX A;  1ZS5 A;  4O77 A;  2DAT A;  4LZS A;  5A7C A;  5EWW A;  4NRB A;  5TCM A;  4HXO A;  3DAI A;  4C67 A;  3JVK A;  4AKG A;  5CUG A;  4LYS A;  5AMF A;  4QST A;  5D24 A;  5D3H A;  4UIY A;  5CRM A;  4XYA A;  3P1D A;  5F2P A;  4IOO A;  5CQ5 A;  4QEU A;  3LJW A;  4YY4 A;  5HQ6 A;  3O36 A;  5HRW A;  4AKN A;  5DKH A;  5FG6 A;  3HMF A;  5EIS A;  3MQM A;  4HXR A;  5G4S A;  5F63 A;  5L98 A;  3ZYU A;  4A9F A;  5FE7 A;  5DFB A;  4KCX A;  4PCI A;  4NR5 A;  5D3R A;  4TT6 A;  3QZV A;  4NR4 A;  5EK9 A;  4HXS A;  3U5N A;  5FFW A;  5COI A;  5F1H A;  5KTU A;  3P1C A;  5D26 A;  5EWD A;  3UV5 A;  5DLX A;  5DKD A;  5DW1 A;  2NXB A;  4X2I A;  3SVF A;  4MR5 A;  5DBM A;  5K29 A;  5L8T A;  4N3W A;  4Z1Q A;  5AME A;  4QC1 A;  5HRV A;  2YEL A;  5EV9 A;  4FLP A;  5EPS A;  4Z6I A;  2DVV A;  2LSP B;  4J1P A;  4QNS A;  5DFD A;  5HEL A;  2MJV B;  5E9M A;  5FH7 A;  2R10 A;  4Y03 A;  4CUR A;  2OO1 A;  2L84 A;  5EPB A;  2RNY A;  3JVJ A;  3IU5 A;  4J3I A;  3SVH A;  3K2J A;  4TTE A;  4TU4 A;  5FE6 A;  4KV4 A;  5BT4 A;  4QSV A;  3VKG A;  3FKM X;  2EJN A;  2YEM A;  4UIU A;  5D0C A;  4YBM A;  4HBY A;  4IR4 A;  4IR6 A;  4HBX A;  4MR3 A;  4QC3 A;  4O7F A;  3LQI A;  5F61 A;  5L97 A;  5C89 A;  5I7X A;  4KV1 A;  5D3S A;  4UIZ A;  5LVQ A;  1N72 A;  5AD2 A;  2R0Y A;  5C85 A;  4CFL A;  3MUK A;  4NRC A;  4A9K A;  4A9O A;  4NQN A;  5E0R A;  5L8U A;  5D3N A;  2RNW A;  4YAT A;  5LUU A;  2E7N A;  4YYN A;  1WUG A;  5CQ4 A;  4IR3 A;  5LKT A;  5A5R A;  5HFQ A;  4LDF A;  4QB3 A;  4QSS A;  4A9L A;  5H1U A;  4TZ2 A;  5ENB A;  4MR6 A;  3G0J A;  4OUF A;  4BW1 A;  5CU8 A;  5CQ7 A;  4N4G A;  4J0S A;  2G4A A;  5CQ8 A;  5BT3 A;  3DWY A;  4N4H A;  5E3D A; 
#chains in the Genus database with same CATH homology
 3Q2F A;  3O35 A;  4NUC A;  4QBM A;  4O75 A;  4CFK A;  5EQ1 A;  5FFY A;  3U5M A;  2YDW A;  5C7N A;  5IGK A;  3MB3 A;  4CUQ A;  4QSQ A;  4HXN A;  4Z6H A;  4NQM A;  5HFR A;  3GG3 A;  5IBN A;  4QEV A;  4HXM A;  5EU1 A;  5ETB A;  4YBT A;  4O7C A;  5CTL A;  4UYD A;  5EWV A;  5DYX A;  5E9Y A;  5FE2 A;  5L96 A;  5D3T A;  5A83 A;  4YYJ A;  4Z1S A;  3MB4 A;  4QR5 A;  4CL9 A;  4TU6 A;  5JI8 A;  3LQJ A;  4WHU A;  5ENJ A;  5FG5 A;  4LR6 A;  4IOQ A;  5ENC A;  2D9E A;  5HLS A;  5F3A A;  3O33 A;  2DWW A;  4HXP A;  5CUB A;  3S92 A;  5C8G A;  5F62 A;  5F25 A;  5EPR A;  4TZ8 A;  5E73 A;  4A9N A;  4A9H A;  5ENG A;  4QSW A;  4NXJ A;  4PS5 A;  5HQ5 A;  5CFW A;  4Z93 A;  5ENH A;  4MEO A;  4ALG A;  4E96 A;  1E6I A;  4LRG A;  4ALH A;  5A5O A;  5EA1 A;  4O78 A;  4QUU A;  3RCW A;  3JVL A;  5FBX A;  3O37 A;  5EP7 A;  4LZ2 A;  4YAD A;  5FFV A;  2FSA A;  5DX4 A;  5I40 A;  4XUB A;  5A81 A;  4NRA A;  4TYL A;  5F36 A;  5FB0 A;  5F1L A;  3NXB A;  4HXL A;  2R0V A;  4PKL A;  4UYF A;  5A82 A;  5I29 A;  5CRZ A;  4PCE A;  5IID A;  4NR9 A;  4A9J A;  4YH4 A;  4UYF B;  4YYG A;  5FE4 A;  2R0S A;  4MR4 A;  4OGJ A;  5J0D A;  5ENF A;  4YBS A;  4DON A;  5CGP A;  1F68 A;  5EM3 A;  4O70 A;  5HQ7 A;  3P5O A;  5DFC A;  4BHW A;  4NUD A;  5D7X A;  5DW2 A;  5I80 A;  5E3G A;  5F5Z A;  4N4I A;  5F60 A;  3U5O A;  3P1E A;  5CQ6 A;  3UW9 A;  5A85 A;  4TT2 A;  4QYD A;  5LKZ A;  4UIX A;  3SVG A;  5HEM A;  4LYI A;  5IGM A;  3MUL A;  4YYM A;  4QR4 A;  4YAB A;  5HCL A;  2OSS A;  5BT5 A;  5TB6 A;  4QSX A;  3S91 A;  5KHM A;  5DKC A;  5A5P A;  4A9I A;  2I7K A;  4QEW A;  3UVY A;  5FE9 A;  4TQN A;  5A5Q A;  3QZT A;  5H85 A;  4O7B A;  4Q0N A;  4N4F A;  4F3I A;  2RI7 A;  4BW4 A;  3I3J A;  5ENE A;  5II1 A;  5FE1 A;  4PY6 A;  4YYD A;  5HM0 A;  5LJ0 A;  2YW5 A;  5EGU A;  3LQH A;  4UIV A;  5EWC A;  5EI4 A;  4MEN A;  4CLB A;  5LVR A;  4UYH A;  2L85 A;  5H1V A;  4NYX A;  2YYN A;  1WUM A;  4ZQL A;  4YY6 A;  4TT4 A;  4HBW A;  4OGI A;  4A9E A;  4QSP A;  3ONI A;  2DVQ A;  4CUP A;  3LXJ A;  3TLP A;  4QY4 A;  2YQD A;  3D7C A;  4YYI A;  5ACY A;  5DYA A;  3G0L A;  5CUA A;  2L5E A;  5FB1 A;  1EQF A;  5I7Y A;  4QSR A;  2YEK A;  5D3P A;  5CZG A;  5FE3 A;  4NS5 A;  3IU6 A;  4XY8 A;  2RS9 B;  5IG6 A;  4WHW A;  5LKX A;  4XUA A;  4WIV A;  5AD3 A;  4YH3 A;  5I1Q A;  4MEP A;  4BJX A;  4A9M A;  5HRX A;  2WP2 A;  4YK0 A;  3U5P A;  4O76 A;  4ZW1 A;  5II2 A;  5FDZ A;  3HME A;  2DVR A;  1X0J A;  3Q2E A;  3MXF A;  5A5S A;  5D3J A;  5E9K A;  5KO4 A;  4YAX A;  5IGL A;  4NUE A;  4PTB A;  5I86 A;  2KTB B;  2E3K A;  3UVX A;  4UIW A;  4IOR A;  5CPE A;  4CUS A;  5DY7 A;  3HMH A;  4MEQ A;  5E9V A;  5E74 A;  3U5L A;  4O7E A;  4QUT A;  4O72 A;  2F6J A;  2RO1 A;  2F6N A;  4QZS A;  5I89 A;  4NR6 A;  4CUU A;  5CUC A;  3AQA A;  5E9L A;  4UYE A;  4HBV A;  5DYC A;  4LYW A;  5E7D A;  3U5K A;  2OUO A;  5G4R A;  2N9G A;  4LZR A;  3UVD A;  3UV4 A;  4UIT A;  2RNX A;  5LKU A;  5LJ1 A;  4O71 A;  4YYK A;  5CY9 A;  2I8N A;  5DLZ A;  3JVM A;  2H60 A;  4O74 A;  5FE0 A;  4QYL A;  4C66 A;  5EIC A;  5EWH A;  5IGN A;  5FH6 A;  4O7A A;  5LJ2 A;  2DKW A;  5HEN A;  5EVA A;  5ETD A;  1JM4 B;  3U5J A;  5FE8 A;  4LC2 A;  5CQ3 A;  2GRC A;  4NYV A;  5CQT A;  4J0R A;  4TS8 A;  3UV2 A;  4NYW A;  5HJC A;  3UVW A;  5D3L A;  4Q0O A;  5KTW A;  2E7O A;  5H1T A;  5CQA A;  5FG4 A;  4HXK A;  4QR3 A;  3P1F A;  5CUD A;  1JSP B;  5KU3 A;  5I88 A;  5CUE A;  5FH8 A;  3AAD A;  5C4Q A;  4IR5 A;  5ENI A;  5CS8 A;  4ZC9 A;  4UYG A;  2RFJ A;  4NR8 A;  4QSU A;  4CUT A;  2D82 A;  4NR7 A;  5D25 A;  5C87 A;  4GPJ A;  4BW3 A;  4BW2 A;  5E9I A;  5A5N A;  4RVR A;  4YC9 A;  4YYH A;  5DYU A;  2DVS A;  5L99 A;  4XY9 A;  3O34 A;  5I83 A;  5FE5 A;  3QZS A;  5CP5 A;  5JWM A;  2WP1 A;  5KTX A;  1ZS5 A;  4O77 A;  2DAT A;  4LZS A;  5A7C A;  5EWW A;  4NRB A;  5TCM A;  4HXO A;  3DAI A;  4C67 A;  3JVK A;  5CUG A;  4LYS A;  5AMF A;  4QST A;  5D24 A;  5D3H A;  4UIY A;  5CRM A;  4XYA A;  3P1D A;  5F2P A;  4IOO A;  5CQ5 A;  4QEU A;  3LJW A;  4YY4 A;  5HQ6 A;  3O36 A;  5HRW A;  4AKN A;  5DKH A;  5FG6 A;  3HMF A;  5EIS A;  3MQM A;  4HXR A;  5G4S A;  5F63 A;  5L98 A;  3ZYU A;  4A9F A;  5FE7 A;  5DFB A;  4KCX A;  4PCI A;  4NR5 A;  5D3R A;  4TT6 A;  3QZV A;  4NR4 A;  5EK9 A;  4HXS A;  3U5N A;  5FFW A;  5COI A;  5F1H A;  5KTU A;  3P1C A;  5D26 A;  5EWD A;  3UV5 A;  5DLX A;  5DKD A;  5DW1 A;  2NXB A;  4X2I A;  3SVF A;  4MR5 A;  5DBM A;  5K29 A;  5L8T A;  4N3W A;  4Z1Q A;  5AME A;  4QC1 A;  5HRV A;  2YEL A;  5EV9 A;  4FLP A;  5EPS A;  4Z6I A;  2DVV A;  2LSP B;  4J1P A;  4QNS A;  5DFD A;  5HEL A;  2MJV B;  5E9M A;  5FH7 A;  2R10 A;  4Y03 A;  4CUR A;  2OO1 A;  2L84 A;  5EPB A;  2RNY A;  3JVJ A;  3IU5 A;  4J3I A;  3SVH A;  3K2J A;  4TTE A;  4TU4 A;  5FE6 A;  4KV4 A;  5BT4 A;  4QSV A;  3FKM X;  2YEM A;  4UIU A;  5D0C A;  4YBM A;  4HBY A;  4IR4 A;  4IR6 A;  4HBX A;  4MR3 A;  4QC3 A;  4O7F A;  3LQI A;  5F61 A;  5L97 A;  5C89 A;  5I7X A;  4KV1 A;  5D3S A;  4UIZ A;  5LVQ A;  1N72 A;  5AD2 A;  2R0Y A;  5C85 A;  4CFL A;  3MUK A;  4NRC A;  4A9K A;  4A9O A;  4NQN A;  5E0R A;  5L8U A;  5D3N A;  2RNW A;  4YAT A;  5LUU A;  2E7N A;  4YYN A;  1WUG A;  5CQ4 A;  4IR3 A;  5LKT A;  5A5R A;  5HFQ A;  4LDF A;  4QB3 A;  4QSS A;  4A9L A;  5H1U A;  4TZ2 A;  5ENB A;  4MR6 A;  3G0J A;  4OUF A;  4BW1 A;  5CU8 A;  5CQ7 A;  4N4G A;  4J0S A;  2G4A A;  5CQ8 A;  5BT3 A;  3DWY A;  4N4H A;  5E3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...