5EICA

Crystal structure of the bromodomain of human crebbp in complex with ayc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Binding Motifs in the CBP Bromodomain: An Analysis of 20 Crystal Structures of Complexes with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eicA00
5LKTA 4TZ2A 4UYFB 4NUEA 1EQFA 4XUAA 4TQNA 5DLZA 5E74A 5F62A 5FB0A 5LJ1A 4Z93A 5LKUA 5LUUA 3AADA 4J3IA 4LR6A 2OUOA 3LJWA 5A5SA 2I8NA 4Q0NA 5CTLA 5CUCA 2L5EA 3AQAA 5F36A 4IOOA 5D3TA 2FSAA 2RNXA 3K2JA 5EV9A 5FH7A 5F1HA 5IIDA 4ALHA 3Q2FA 4F3IA 4CUUA 2YQDA 5IG6A 5DX4A 5HFQA 4QSWA 4YK0A 5BT4A 4NUCA 5HFRA 3TLPA 4IORA 4BW1A 4NQNA 5HQ5A 4QR5A 5DW1A 4UIZA 5E9IA 5J0DA 4UYFA 4O77A 5FB1A 5K29A 4ZQLA 4ZC9A 3U5NA 1F68A 4PY6A 3HMHA 5H1VA 4O76A 5I80A 5A5NA 4YYHA 5EPSA 2OO1A 5LVRA 5EGUA 3G0JA 3JVKA 4QC3A 4CL9A 2I7KA 4HXSA 5LKZA 5DFBA 5CQ5A 5FG6A 3UW9A 4UIWA 5EICA 4QY4A 4N4HA 5DKCA 5FE5A 3G0LA 5FBXA 4IR5A 3QZSA 5G4SA 2GRCA 4QSRA 4TT4A 4Z1QA 3O35A 5I88A 1WUMA 4MEPA 5KTWA 5CUGA 3LQIA 4NS5A 4O7EA 3I3JA 5TCMA 3FKMX 5F25A 5FE7A 5HENA 5CUBA 4N4IA 3MXFA 5EPRA 5FE3A 4A9KA 5CRZA 2DATA 4HBXA 5IGNA 4TS8A 4NR7A 4O70A 4QNSA 5BT3A 3ZYUA 5HJCA 5D3JA 5CQAA 2F6NA 3MB4A 5CGPA 4LRGA 4O74A 5AD3A 4OGIA 5F61A 4TU4A 4CFKA 4IR3A 4C66A 2DVQA 5EA1A 4E96A 4QZSA 2YW5A 4YH3A 4WHWA 5FG4A 2L85A 4TYLA 3U5MA 2E3KA 5IBNA 4YYMA 4YAXA 3D7CA 5A7CA 3LQHA 4ALGA 5L99A 4LYSA 4O72A 5EI4A 4UIVA 5FE2A 4WIVA 5D3NA 4HXLA 5CFWA 4YYDA 5ACYA 3MUKA 5ENBA 5D3LA 5FG5A 5DYCA 4CUQA 4TT6A 4YYKA 2DVSA 5HEMA 4GPJA 5LVQA 5DYXA 5I86A 4MR3A 4DONA 5C89A 4YBSA 4QUUA 4IOQA 4QR4A 5I7YA 4PKLA 5DBMA 4N3WA 5A5OA 2YEMA 4QYLA 4UYEA 3P1EA 3O33A 1X0JA 2RNWA 4IR4A 5LKXA 5DFCA 3QZVA 5AMFA 4BHWA 5EP7A 3P1CA 4QEVA 4YADA 2R0SA 3HMEA 4NRCA 5DYAA 3LQJA 4QYDA 4HXMA 4QUTA 5A5PA 4BW3A 5F63A 3P5OA 5CQ4A 4YBMA 5AMEA 5CQ6A 4OUFA 4RVRA 5C8GA 4A9MA 4WHUA 5EWHA 5I89A 4MEQA 5L8UA 3MQMA 4KCXA 4NRAA 5DYUA 3JVLA 4QSVA 2OSSA 4MR6A 5CUAA 2RFJA 3S91A 5FH6A 4HXRA 5DLXA 4TT2A 4YABA 5F5ZA 4CUTA 5I1QA 3GG3A 5F60A 5IGLA 5EWWA 5ENJA 2YEKA 5DW2A 5C7NA 4O7AA 2R10A 5E9MA 5L98A 4C67A 5A5RA 4QR3A 4BW4A 3UVWA 5CY9A 5DKDA 4YH4A 2E7NA 4YY6A 5I7XA 4OGJA 5KU3A 5HQ7A 3U5OA 1JM4B 4LZ2A 5A82A 5FE4A 4PCIA 4YATA 4NR5A 5EWVA 4UIUA 3U5JA 2DWWA 5ENGA 5D3PA 4Z6HA 3S92A 4MENA 5I40A 3SVFA 4QSPA 5ETDA 4LZRA 4CLBA 3RCWA 5II1A 4CUPA 4YY4A 4NRBA 4QSSA 5ENHA 4QSUA 1JSPB 3UV4A 4XYAA 2R0VA 3UVDA 4HXKA 5H85A 3ONIA 4BJXA 5ENIA 5E3DA 2YDWA 4QSXA 5A83A 4Q0OA 4O75A 4CUSA 2NXBA 5HRWA 5F3AA 3SVHA 4YYGA 4TTEA 4QSTA 4XY9A 4BW2A 4A9JA 4NQMA 3U5KA 4UIXA 5EM3A 5DY7A 4HXNA 5CS8A 5CUDA 5F2PA 5ENEA 3JVMA 5DKHA 5CUEA 5FDZA 5CRMA 2RNYA 5BT5A 4LYWA 4NUDA 4MR5A 4CURA 5D3SA 4UYHA 1WUGA 4O7FA 4IR6A 4MEOA 5HRXA 4J1PA 2D9EA 3O37A 5E0RA 5KTUA 5L97A 5IGKA 5HLSA 4HBWA 2RO1A 2WP2A 2WP1A 4X2IA 4A9IA 2KTBB 3U5PA 4QSQA 5FH8A 2LSPB 2YYNA 4PCEA 5EWCA 2DVVA 5CQ7A 5LJ2A 4LYIA 2DKWA 4YBTA 5FE0A 5FFVA 4UITA 5L8TA 5L96A 1ZS5A 5E9YA 5C87A 3SVGA 2E7OA 3LXJA 5II2A 5AD2A 5FFYA 2D82A 3DAIA 5FE8A 5I29A 2YELA 5D0CA 5FE9A 4UIYA 4NXJA 3QZTA 4O78A 2RI7A 5FE6A 4PS5A 3P1DA 4HBYA 4CFLA 4YYNA 4NYXA 5C4QA 4ZW1A 4LC2A 4A9LA 3MULA 5H1UA 4FLPA 4Z1SA 4TU6A 2DVRA 5CZGA 4J0RA 5HCLA 5D7XA 5DFDA 5E9VA 4YYJA 5E7DA 4UYGA 5EISA 3JVJA 3UVYA 5COIA 4UYDA 5G4RA 5E73A 3U5LA 4HXOA 5D26A 3UV5A 4QB3A 2RS9B 4LZSA 5ENFA 5D3HA 5EQ1A 5LJ0A 5EWDA 5CPEA 4O7CA 5D3RA 5A5QA 4NYVA 2MJVB 4O71A 4KV4A 5CQ3A 4NYWA 5JI8A 5HRVA 4A9OA 2F6JA 3DWYA 4XY8A 5HM0A 4QBMA 4N4GA 4LDFA 3UV2A 3Q2EA 5HELA 5KHMA 4HBVA 5A85A 5TB6A 5EU1A 5EVAA 5E9LA 5D24A 3O36A 5I83A 5EK9A 3MB3A 4QEWA 3IU5A 4O7BA 5ETBA 4QC1A 1E6IA 5CQ8A 2L84A 4YC9A 4A9HA 4YYIA 5IGMA 2H60A 3NXBA 3P1FA 5F1LA 5KO4A 4N4FA 4Y03A 2G4AA 4A9EA 4AKNA 4TZ8A 5CU8A 4NR4A 1N72A 5ENCA 5C85A 5D25A 3HMFA 4HXPA 4PTBA 2N9GA 5E9KA 5FFWA 5EPBA 5A81A 4XUBA 5E3GA 5CP5A 5CQTA 3UVXA 4KV1A 4NR6A 4NR9A 4A9FA 5FE1A 5HQ6A 4J0SA 2R0YA 4A9NA 4NR8A 3IU6A 4QEUA 5KTXA 4Z6IA 5JWMA 4MR4A 3O34A 5H1TA
chains in the Genus database with same CATH superfamily
5LKTA 4TZ2A 4UYFB 4NUEA 1EQFA 4XUAA 4TQNA 5DLZA 5E74A 5F62A 5FB0A 5LJ1A 4Z93A 5LKUA 5LUUA 3AADA 4AI6A 4J3IA 4LR6A 2OUOA 3LJWA 5A5SA 2I8NA 4Q0NA 5CTLA 5CUCA 2L5EA 3AQAA 5F36A 4IOOA 5D3TA 2FSAA 2RNXA 3K2JA 5EV9A 5FH7A 5F1HA 5IIDA 4ALHA 3Q2FA 4F3IA 4CUUA 2YQDA 5IG6A 5DX4A 5HFQA 4QSWA 4YK0A 3ERRA 5BT4A 4NUCA 5HFRA 3TLPA 4IORA 4BW1A 4NQNA 5HQ5A 4AKGA 4QR5A 5DW1A 4UIZA 5E9IA 5J0DA 4UYFA 4O77A 5FB1A 5K29A 4ZQLA 4ZC9A 3U5NA 1F68A 4PY6A 3HMHA 5H1VA 4O76A 5I80A 5A5NA 4YYHA 5EPSA 2OO1A 5LVRA 5EGUA 3G0JA 3JVKA 4QC3A 4CL9A 2I7KA 4HXSA 5LKZA 5DFBA 5CQ5A 5FG6A 3UW9A 4UIWA 5EICA 4QY4A 4N4HA 5DKCA 5FE5A 3G0LA 5FBXA 4IR5A 3QZSA 5G4SA 2GRCA 4QSRA 4TT4A 4Z1QA 3O35A 5I88A 1WUMA 4MEPA 5KTWA 5CUGA 3LQIA 4NS5A 4O7EA 3I3JA 5TCMA 3FKMX 5F25A 5FE7A 5HENA 5CUBA 4N4IA 3MXFA 5EPRA 5FE3A 4A9KA 5CRZA 2DATA 4HBXA 5IGNA 4TS8A 4NR7A 4O70A 4QNSA 5BT3A 3ZYUA 5HJCA 5D3JA 5CQAA 2F6NA 3MB4A 5CGPA 4LRGA 4O74A 5AD3A 4OGIA 5F61A 4TU4A 4CFKA 4IR3A 4C66A 2DVQA 5EA1A 4E96A 4QZSA 2YW5A 4YH3A 4WHWA 5FG4A 2L85A 4TYLA 3U5MA 2E3KA 5IBNA 4YYMA 4YAXA 3D7CA 5A7CA 3LQHA 4ALGA 5L99A 4LYSA 4O72A 5EI4A 4UIVA 5FE2A 4WIVA 5D3NA 4HXLA 5CFWA 4YYDA 5ACYA 3MUKA 5ENBA 5D3LA 5FG5A 5DYCA 4CUQA 4TT6A 4YYKA 2DVSA 5HEMA 4GPJA 5LVQA 5DYXA 5I86A 4MR3A 4DONA 5C89A 4YBSA 4QUUA 4IOQA 4QR4A 5I7YA 4PKLA 5DBMA 4N3WA 5A5OA 2YEMA 4QYLA 4UYEA 3P1EA 3O33A 1X0JA 2RNWA 4IR4A 5LKXA 5DFCA 3QZVA 5AMFA 4BHWA 5EP7A 3P1CA 4QEVA 4YADA 2R0SA 3HMEA 4NRCA 5DYAA 3LQJA 4QYDA 4HXMA 4QUTA 5A5PA 4BW3A 5F63A 3P5OA 5CQ4A 4YBMA 5AMEA 5CQ6A 4OUFA 4RVRA 5C8GA 4A9MA 4WHUA 5EWHA 2EJNA 5I89A 4MEQA 5L8UA 3MQMA 4KCXA 4NRAA 5DYUA 3JVLA 4QSVA 2OSSA 4MR6A 5CUAA 2RFJA 3S91A 5FH6A 4HXRA 5DLXA 4TT2A 4YABA 5F5ZA 4CUTA 5I1QA 3GG3A 5F60A 5IGLA 5EWWA 5ENJA 2YEKA 5DW2A 5C7NA 4O7AA 2R10A 5E9MA 5L98A 4C67A 5A5RA 4QR3A 4BW4A 3UVWA 5CY9A 5DKDA 4YH4A 3D1DA 2E7NA 4YY6A 5I7XA 4OGJA 5KU3A 5HQ7A 3U5OA 1JM4B 4LZ2A 5A82A 5FE4A 4PCIA 4YATA 4NR5A 5EWVA 4UIUA 3U5JA 2DWWA 5ENGA 5D3PA 4Z6HA 3S92A 4MENA 5I40A 3SVFA 4QSPA 5ETDA 4LZRA 4CLBA 3RCWA 5II1A 4CUPA 1PUOA 4YY4A 4NRBA 4QSSA 5ENHA 4QSUA 1JSPB 3UV4A 4XYAA 4AKIA 2R0VA 3UVDA 4HXKA 5H85A 4AKHA 3VKHA 3ONIA 4BJXA 5ENIA 5E3DA 2YDWA 4QSXA 5A83A 4Q0OA 4O75A 4CUSA 2NXBA 5HRWA 5F3AA 3SVHA 4YYGA 3D1BA 4TTEA 4QSTA 4XY9A 4BW2A 4A9JA 4NQMA 3U5KA 4UIXA 5EM3A 5DY7A 4HXNA 5CS8A 5CUDA 5F2PA 3VKGA 5ENEA 3JVMA 5DKHA 5CUEA 5FDZA 5CRMA 2RNYA 5BT5A 4LYWA 4NUDA 4MR5A 4CURA 5D3SA 4UYHA 1WUGA 4O7FA 4IR6A 4MEOA 5HRXA 4J1PA 2D9EA 3O37A 5E0RA 5KTUA 5L97A 5IGKA 5HLSA 4HBWA 2RO1A 2WP2A 2WP1A 4X2IA 4A9IA 2KTBB 3U5PA 4QSQA 5FH8A 2LSPB 2YYNA 4PCEA 5EWCA 2DVVA 5CQ7A 5LJ2A 4LYIA 2DKWA 4YBTA 5FE0A 5FFVA 4UITA 5L8TA 5L96A 1ZS5A 5E9YA 5C87A 3SVGA 2E7OA 3LXJA 5II2A 5AD2A 5FFYA 2D82A 3DAIA 5FE8A 5I29A 2YELA 5D0CA 5FE9A 4UIYA 4NXJA 3QZTA 4O78A 2RI7A 5FE6A 4PS5A 3P1DA 4HBYA 4CFLA 4YYNA 4NYXA 5C4QA 4ZW1A 4LC2A 4A9LA 3MULA 5H1UA 4FLPA 4Z1SA 4TU6A 2DVRA 5CZGA 4J0RA 5HCLA 5D7XA 5DFDA 5E9VA 4YYJA 5E7DA 4UYGA 5EISA 3JVJA 3UVYA 5COIA 4UYDA 5G4RA 5E73A 3U5LA 4HXOA 5D26A 3UV5A 4QB3A 2RS9B 4LZSA 5ENFA 5D3HA 5EQ1A 5LJ0A 5EWDA 5CPEA 4O7CA 5D3RA 5A5QA 4NYVA 2MJVB 4O71A 4KV4A 5CQ3A 4NYWA 5JI8A 5HRVA 4A9OA 2F6JA 3DWYA 4XY8A 5HM0A 4QBMA 4N4GA 4LDFA 3UV2A 3Q2EA 5HELA 5KHMA 4HBVA 5A85A 5TB6A 5EU1A 5EVAA 5E9LA 5D24A 3O36A 5I83A 5EK9A 3MB3A 4QEWA 3IU5A 4O7BA 5ETBA 4QC1A 1E6IA 5CQ8A 2L84A 4YC9A 1ZKRA 4A9HA 4YYIA 5IGMA 2H60A 3NXBA 3P1FA 5F1LA 5KO4A 4N4FA 4Y03A 2G4AA 4A9EA 4AKNA 4TZ8A 5CU8A 4NR4A 1N72A 5ENCA 5C85A 5D25A 3HMFA 4HXPA 4PTBA 2N9GA 5E9KA 5FFWA 5EPBA 5A81A 4XUBA 5E3GA 5CP5A 5CQTA 3UVXA 4KV1A 4NR6A 4NR9A 4A9FA 5FE1A 5HQ6A 4J0SA 2R0YA 4A9NA 4NR8A 3IU6A 4QEUA 5KTXA 4Z6IA 5JWMA 4MR4A 3O34A 5H1TA
chains in the Genus database with same CATH topology
5LKTA 4TZ2A 4UYFB 4NUEA 1EQFA 4XUAA 4TQNA 5DLZA 5E74A 5F62A 5FB0A 5LJ1A 4Z93A 5LKUA 5LUUA 3AADA 4J3IA 4LR6A 2OUOA 3LJWA 5A5SA 2I8NA 4Q0NA 5CTLA 5CUCA 2L5EA 3AQAA 5F36A 4IOOA 5D3TA 2FSAA 2RNXA 3K2JA 5EV9A 5FH7A 5F1HA 5IIDA 4ALHA 3Q2FA 4F3IA 4CUUA 2YQDA 5IG6A 5DX4A 5HFQA 4QSWA 4YK0A 5BT4A 4NUCA 5HFRA 3TLPA 4IORA 4BW1A 4NQNA 5HQ5A 4QR5A 5DW1A 4UIZA 5E9IA 5J0DA 4UYFA 4O77A 5FB1A 5K29A 4ZQLA 4ZC9A 3U5NA 1F68A 4PY6A 3HMHA 5H1VA 4O76A 5I80A 5A5NA 4YYHA 5EPSA 2OO1A 5LVRA 5EGUA 3G0JA 3JVKA 4QC3A 4CL9A 2I7KA 4HXSA 5LKZA 5DFBA 5CQ5A 5FG6A 3UW9A 4UIWA 5EICA 4QY4A 4N4HA 5DKCA 5FE5A 3G0LA 5FBXA 4IR5A 3QZSA 5G4SA 2GRCA 4QSRA 4TT4A 4Z1QA 3O35A 5I88A 1WUMA 4MEPA 5KTWA 5CUGA 3LQIA 4NS5A 4O7EA 3I3JA 5TCMA 3FKMX 5F25A 5FE7A 5HENA 5CUBA 4N4IA 3MXFA 5EPRA 5FE3A 4A9KA 5CRZA 2DATA 4HBXA 5IGNA 4TS8A 4NR7A 4O70A 4QNSA 5BT3A 3ZYUA 5HJCA 5D3JA 5CQAA 2F6NA 3MB4A 5CGPA 4LRGA 4O74A 5AD3A 4OGIA 5F61A 4TU4A 4CFKA 4IR3A 4C66A 2DVQA 5EA1A 4E96A 4QZSA 2YW5A 4YH3A 4WHWA 5FG4A 2L85A 4TYLA 3U5MA 2E3KA 5IBNA 4YYMA 4YAXA 3D7CA 5A7CA 3LQHA 4ALGA 5L99A 4LYSA 4O72A 5EI4A 4UIVA 5FE2A 4WIVA 5D3NA 4HXLA 5CFWA 4YYDA 5ACYA 3MUKA 5ENBA 5D3LA 5FG5A 5DYCA 4CUQA 4TT6A 4YYKA 2DVSA 5HEMA 4GPJA 5LVQA 5DYXA 5I86A 4MR3A 4DONA 5C89A 4YBSA 4QUUA 4IOQA 4QR4A 5I7YA 4PKLA 5DBMA 4N3WA 5A5OA 2YEMA 4QYLA 4UYEA 3P1EA 3O33A 1X0JA 2RNWA 4IR4A 5LKXA 5DFCA 3QZVA 5AMFA 4BHWA 5EP7A 3P1CA 4QEVA 4YADA 2R0SA 3HMEA 4NRCA 5DYAA 3LQJA 4QYDA 4HXMA 4QUTA 5A5PA 4BW3A 5F63A 3P5OA 5CQ4A 4YBMA 5AMEA 5CQ6A 4OUFA 4RVRA 5C8GA 4A9MA 4WHUA 5EWHA 5I89A 4MEQA 5L8UA 3MQMA 4KCXA 4NRAA 5DYUA 3JVLA 4QSVA 2OSSA 4MR6A 5CUAA 2RFJA 3S91A 5FH6A 4HXRA 5DLXA 4TT2A 4YABA 5F5ZA 4CUTA 5I1QA 3GG3A 5F60A 5IGLA 5EWWA 5ENJA 2YEKA 5DW2A 5C7NA 4O7AA 2R10A 5E9MA 5L98A 4C67A 5A5RA 4QR3A 4BW4A 3UVWA 5CY9A 5DKDA 4YH4A 2E7NA 4YY6A 5I7XA 4OGJA 5KU3A 5HQ7A 3U5OA 1JM4B 4LZ2A 5A82A 5FE4A 4PCIA 4YATA 4NR5A 5EWVA 4UIUA 3U5JA 2DWWA 5ENGA 5D3PA 4Z6HA 3S92A 4MENA 5I40A 3SVFA 4QSPA 5ETDA 4LZRA 4CLBA 3RCWA 5II1A 4CUPA 4YY4A 4NRBA 4QSSA 5ENHA 4QSUA 1JSPB 3UV4A 4XYAA 2R0VA 3UVDA 4HXKA 5H85A 3ONIA 4BJXA 5ENIA 5E3DA 2YDWA 4QSXA 5A83A 4Q0OA 4O75A 4CUSA 2NXBA 5HRWA 5F3AA 3SVHA 4YYGA 4TTEA 4QSTA 4XY9A 4BW2A 4A9JA 4NQMA 3U5KA 4UIXA 5EM3A 5DY7A 4HXNA 5CS8A 5CUDA 5F2PA 5ENEA 3JVMA 5DKHA 5CUEA 5FDZA 5CRMA 2RNYA 5BT5A 4LYWA 4NUDA 4MR5A 4CURA 5D3SA 4UYHA 1WUGA 4O7FA 4IR6A 4MEOA 5HRXA 4J1PA 2D9EA 3O37A 5E0RA 5KTUA 5L97A 5IGKA 5HLSA 4HBWA 2RO1A 2WP2A 2WP1A 4X2IA 4A9IA 2KTBB 3U5PA 4QSQA 5FH8A 2LSPB 2YYNA 4PCEA 5EWCA 2DVVA 5CQ7A 5LJ2A 4LYIA 2DKWA 4YBTA 5FE0A 5FFVA 4UITA 5L8TA 5L96A 1ZS5A 5E9YA 5C87A 3SVGA 2E7OA 3LXJA 5II2A 5AD2A 5FFYA 2D82A 3DAIA 5FE8A 5I29A 2YELA 5D0CA 5FE9A 4UIYA 4NXJA 3QZTA 4O78A 2RI7A 5FE6A 4PS5A 3P1DA 4HBYA 4CFLA 4YYNA 4NYXA 5C4QA 4ZW1A 4LC2A 4A9LA 3MULA 5H1UA 4FLPA 4Z1SA 4TU6A 2DVRA 5CZGA 4J0RA 5HCLA 5D7XA 5DFDA 5E9VA 4YYJA 5E7DA 4UYGA 5EISA 3JVJA 3UVYA 5COIA 4UYDA 5G4RA 5E73A 3U5LA 4HXOA 5D26A 3UV5A 4QB3A 2RS9B 4LZSA 5ENFA 5D3HA 5EQ1A 5LJ0A 5EWDA 5CPEA 4O7CA 5D3RA 5A5QA 4NYVA 2MJVB 4O71A 4KV4A 5CQ3A 4NYWA 5JI8A 5HRVA 4A9OA 2F6JA 3DWYA 4XY8A 5HM0A 4QBMA 4N4GA 4LDFA 3UV2A 3Q2EA 5HELA 5KHMA 4HBVA 5A85A 5TB6A 5EU1A 5EVAA 5E9LA 5D24A 3O36A 5I83A 5EK9A 3MB3A 4QEWA 3IU5A 4O7BA 5ETBA 4QC1A 1E6IA 5CQ8A 2L84A 4YC9A 4A9HA 4YYIA 5IGMA 2H60A 3NXBA 3P1FA 5F1LA 5KO4A 4N4FA 4Y03A 2G4AA 4A9EA 4AKNA 4TZ8A 5CU8A 4NR4A 1N72A 5ENCA 5C85A 5D25A 3HMFA 4HXPA 4PTBA 2N9GA 5E9KA 5FFWA 5EPBA 5A81A 4XUBA 5E3GA 5CP5A 5CQTA 3UVXA 4KV1A 4NR6A 4NR9A 4A9FA 5FE1A 5HQ6A 4J0SA 2R0YA 4A9NA 4NR8A 3IU6A 4QEUA 5KTXA 4Z6IA 5JWMA 4MR4A 3O34A 5H1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKT A;  4TZ2 A;  4UYF B;  4NUE A;  1EQF A;  4XUA A;  4TQN A;  5DLZ A;  5E74 A;  5F62 A;  5FB0 A;  5LJ1 A;  4Z93 A;  5LKU A;  5LUU A;  3AAD A;  4J3I A;  4LR6 A;  2OUO A;  3LJW A;  5A5S A;  2I8N A;  4Q0N A;  5CTL A;  5CUC A;  2L5E A;  3AQA A;  5F36 A;  4IOO A;  5D3T A;  2FSA A;  2RNX A;  3K2J A;  5EV9 A;  5FH7 A;  5F1H A;  5IID A;  4ALH A;  3Q2F A;  4F3I A;  4CUU A;  2YQD A;  5IG6 A;  5DX4 A;  5HFQ A;  4QSW A;  4YK0 A;  5BT4 A;  4NUC A;  5HFR A;  3TLP A;  4IOR A;  4BW1 A;  4NQN A;  5HQ5 A;  4QR5 A;  5DW1 A;  4UIZ A;  5E9I A;  5J0D A;  4UYF A;  4O77 A;  5FB1 A;  5K29 A;  4ZQL A;  4ZC9 A;  3U5N A;  1F68 A;  4PY6 A;  3HMH A;  5H1V A;  4O76 A;  5I80 A;  5A5N A;  4YYH A;  5EPS A;  2OO1 A;  5LVR A;  5EGU A;  3G0J A;  3JVK A;  4QC3 A;  4CL9 A;  2I7K A;  4HXS A;  5LKZ A;  5DFB A;  5CQ5 A;  5FG6 A;  3UW9 A;  4UIW A;  5EIC A;  4QY4 A;  4N4H A;  5DKC A;  5FE5 A;  3G0L A;  5FBX A;  4IR5 A;  3QZS A;  5G4S A;  2GRC A;  4QSR A;  4TT4 A;  4Z1Q A;  3O35 A;  5I88 A;  1WUM A;  4MEP A;  5KTW A;  5CUG A;  3LQI A;  4NS5 A;  4O7E A;  3I3J A;  5TCM A;  3FKM X;  5F25 A;  5FE7 A;  5HEN A;  5CUB A;  4N4I A;  3MXF A;  5EPR A;  5FE3 A;  4A9K A;  5CRZ A;  2DAT A;  4HBX A;  5IGN A;  4TS8 A;  4NR7 A;  4O70 A;  4QNS A;  5BT3 A;  3ZYU A;  5HJC A;  5D3J A;  5CQA A;  2F6N A;  3MB4 A;  5CGP A;  4LRG A;  4O74 A;  5AD3 A;  4OGI A;  5F61 A;  4TU4 A;  4CFK A;  4IR3 A;  4C66 A;  2DVQ A;  5EA1 A;  4E96 A;  4QZS A;  2YW5 A;  4YH3 A;  4WHW A;  5FG4 A;  2L85 A;  4TYL A;  3U5M A;  2E3K A;  5IBN A;  4YYM A;  4YAX A;  3D7C A;  5A7C A;  3LQH A;  4ALG A;  5L99 A;  4LYS A;  4O72 A;  5EI4 A;  4UIV A;  5FE2 A;  4WIV A;  5D3N A;  4HXL A;  5CFW A;  4YYD A;  5ACY A;  3MUK A;  5ENB A;  5D3L A;  5FG5 A;  5DYC A;  4CUQ A;  4TT6 A;  4YYK A;  2DVS A;  5HEM A;  4GPJ A;  5LVQ A;  5DYX A;  5I86 A;  4MR3 A;  4DON A;  5C89 A;  4YBS A;  4QUU A;  4IOQ A;  4QR4 A;  5I7Y A;  4PKL A;  5DBM A;  4N3W A;  5A5O A;  2YEM A;  4QYL A;  4UYE A;  3P1E A;  3O33 A;  1X0J A;  2RNW A;  4IR4 A;  5LKX A;  5DFC A;  3QZV A;  5AMF A;  4BHW A;  5EP7 A;  3P1C A;  4QEV A;  4YAD A;  2R0S A;  3HME A;  4NRC A;  5DYA A;  3LQJ A;  4QYD A;  4HXM A;  4QUT A;  5A5P A;  4BW3 A;  5F63 A;  3P5O A;  5CQ4 A;  4YBM A;  5AME A;  5CQ6 A;  4OUF A;  4RVR A;  5C8G A;  4A9M A;  4WHU A;  5EWH A;  5I89 A;  4MEQ A;  5L8U A;  3MQM A;  4KCX A;  4NRA A;  5DYU A;  3JVL A;  4QSV A;  2OSS A;  4MR6 A;  5CUA A;  2RFJ A;  3S91 A;  5FH6 A;  4HXR A;  5DLX A;  4TT2 A;  4YAB A;  5F5Z A;  4CUT A;  5I1Q A;  3GG3 A;  5F60 A;  5IGL A;  5EWW A;  5ENJ A;  2YEK A;  5DW2 A;  5C7N A;  4O7A A;  2R10 A;  5E9M A;  5L98 A;  4C67 A;  5A5R A;  4QR3 A;  4BW4 A;  3UVW A;  5CY9 A;  5DKD A;  4YH4 A;  2E7N A;  4YY6 A;  5I7X A;  4OGJ A;  5KU3 A;  5HQ7 A;  3U5O A;  1JM4 B;  4LZ2 A;  5A82 A;  5FE4 A;  4PCI A;  4YAT A;  4NR5 A;  5EWV A;  4UIU A;  3U5J A;  2DWW A;  5ENG A;  5D3P A;  4Z6H A;  3S92 A;  4MEN A;  5I40 A;  3SVF A;  4QSP A;  5ETD A;  4LZR A;  4CLB A;  3RCW A;  5II1 A;  4CUP A;  4YY4 A;  4NRB A;  4QSS A;  5ENH A;  4QSU A;  1JSP B;  3UV4 A;  4XYA A;  2R0V A;  3UVD A;  4HXK A;  5H85 A;  3ONI A;  4BJX A;  5ENI A;  5E3D A;  2YDW A;  4QSX A;  5A83 A;  4Q0O A;  4O75 A;  4CUS A;  2NXB A;  5HRW A;  5F3A A;  3SVH A;  4YYG A;  4TTE A;  4QST A;  4XY9 A;  4BW2 A;  4A9J A;  4NQM A;  3U5K A;  4UIX A;  5EM3 A;  5DY7 A;  4HXN A;  5CS8 A;  5CUD A;  5F2P A;  5ENE A;  3JVM A;  5DKH A;  5CUE A;  5FDZ A;  5CRM A;  2RNY A;  5BT5 A;  4LYW A;  4NUD A;  4MR5 A;  4CUR A;  5D3S A;  4UYH A;  1WUG A;  4O7F A;  4IR6 A;  4MEO A;  5HRX A;  4J1P A;  2D9E A;  3O37 A;  5E0R A;  5KTU A;  5L97 A;  5IGK A;  5HLS A;  4HBW A;  2RO1 A;  2WP2 A;  2WP1 A;  4X2I A;  4A9I A;  2KTB B;  3U5P A;  4QSQ A;  5FH8 A;  2LSP B;  2YYN A;  4PCE A;  5EWC A;  2DVV A;  5CQ7 A;  5LJ2 A;  4LYI A;  2DKW A;  4YBT A;  5FE0 A;  5FFV A;  4UIT A;  5L8T A;  5L96 A;  1ZS5 A;  5E9Y A;  5C87 A;  3SVG A;  2E7O A;  3LXJ A;  5II2 A;  5AD2 A;  5FFY A;  2D82 A;  3DAI A;  5FE8 A;  5I29 A;  2YEL A;  5D0C A;  5FE9 A;  4UIY A;  4NXJ A;  3QZT A;  4O78 A;  2RI7 A;  5FE6 A;  4PS5 A;  3P1D A;  4HBY A;  4CFL A;  4YYN A;  4NYX A;  5C4Q A;  4ZW1 A;  4LC2 A;  4A9L A;  3MUL A;  5H1U A;  4FLP A;  4Z1S A;  4TU6 A;  2DVR A;  5CZG A;  4J0R A;  5HCL A;  5D7X A;  5DFD A;  5E9V A;  4YYJ A;  5E7D A;  4UYG A;  5EIS A;  3JVJ A;  3UVY A;  5COI A;  4UYD A;  5G4R A;  5E73 A;  3U5L A;  4HXO A;  5D26 A;  3UV5 A;  4QB3 A;  2RS9 B;  4LZS A;  5ENF A;  5D3H A;  5EQ1 A;  5LJ0 A;  5EWD A;  5CPE A;  4O7C A;  5D3R A;  5A5Q A;  4NYV A;  2MJV B;  4O71 A;  4KV4 A;  5CQ3 A;  4NYW A;  5JI8 A;  5HRV A;  4A9O A;  2F6J A;  3DWY A;  4XY8 A;  5HM0 A;  4QBM A;  4N4G A;  4LDF A;  3UV2 A;  3Q2E A;  5HEL A;  5KHM A;  4HBV A;  5A85 A;  5TB6 A;  5EU1 A;  5EVA A;  5E9L A;  5D24 A;  3O36 A;  5I83 A;  5EK9 A;  3MB3 A;  4QEW A;  3IU5 A;  4O7B A;  5ETB A;  4QC1 A;  1E6I A;  5CQ8 A;  2L84 A;  4YC9 A;  4A9H A;  4YYI A;  5IGM A;  2H60 A;  3NXB A;  3P1F A;  5F1L A;  5KO4 A;  4N4F A;  4Y03 A;  2G4A A;  4A9E A;  4AKN A;  4TZ8 A;  5CU8 A;  4NR4 A;  1N72 A;  5ENC A;  5C85 A;  5D25 A;  3HMF A;  4HXP A;  4PTB A;  2N9G A;  5E9K A;  5FFW A;  5EPB A;  5A81 A;  4XUB A;  5E3G A;  5CP5 A;  5CQT A;  3UVX A;  4KV1 A;  4NR6 A;  4NR9 A;  4A9F A;  5FE1 A;  5HQ6 A;  4J0S A;  2R0Y A;  4A9N A;  4NR8 A;  3IU6 A;  4QEU A;  5KTX A;  4Z6I A;  5JWM A;  4MR4 A;  3O34 A;  5H1T A; 
#chains in the Genus database with same CATH topology
 5LKT A;  4TZ2 A;  4UYF B;  4NUE A;  1EQF A;  4XUA A;  4TQN A;  5DLZ A;  5E74 A;  5F62 A;  5FB0 A;  5LJ1 A;  4Z93 A;  5LKU A;  5LUU A;  3AAD A;  4AI6 A;  4J3I A;  4LR6 A;  2OUO A;  3LJW A;  5A5S A;  2I8N A;  4Q0N A;  5CTL A;  5CUC A;  2L5E A;  3AQA A;  5F36 A;  4IOO A;  5D3T A;  2FSA A;  2RNX A;  3K2J A;  5EV9 A;  5FH7 A;  5F1H A;  5IID A;  4ALH A;  3Q2F A;  4F3I A;  4CUU A;  2YQD A;  5IG6 A;  5DX4 A;  5HFQ A;  4QSW A;  4YK0 A;  3ERR A;  5BT4 A;  4NUC A;  5HFR A;  3TLP A;  4IOR A;  4BW1 A;  4NQN A;  5HQ5 A;  4AKG A;  4QR5 A;  5DW1 A;  4UIZ A;  5E9I A;  5J0D A;  4UYF A;  4O77 A;  5FB1 A;  5K29 A;  4ZQL A;  4ZC9 A;  3U5N A;  1F68 A;  4PY6 A;  3HMH A;  5H1V A;  4O76 A;  5I80 A;  5A5N A;  4YYH A;  5EPS A;  2OO1 A;  5LVR A;  5EGU A;  3G0J A;  3JVK A;  4QC3 A;  4CL9 A;  2I7K A;  4HXS A;  5LKZ A;  5DFB A;  5CQ5 A;  5FG6 A;  3UW9 A;  4UIW A;  5EIC A;  4QY4 A;  4N4H A;  5DKC A;  5FE5 A;  3G0L A;  5FBX A;  4IR5 A;  3QZS A;  5G4S A;  2GRC A;  4QSR A;  4TT4 A;  4Z1Q A;  3O35 A;  5I88 A;  1WUM A;  4MEP A;  5KTW A;  5CUG A;  3LQI A;  4NS5 A;  4O7E A;  3I3J A;  5TCM A;  3FKM X;  5F25 A;  5FE7 A;  5HEN A;  5CUB A;  4N4I A;  3MXF A;  5EPR A;  5FE3 A;  4A9K A;  5CRZ A;  2DAT A;  4HBX A;  5IGN A;  4TS8 A;  4NR7 A;  4O70 A;  4QNS A;  5BT3 A;  3ZYU A;  5HJC A;  5D3J A;  5CQA A;  2F6N A;  3MB4 A;  5CGP A;  4LRG A;  4O74 A;  5AD3 A;  4OGI A;  5F61 A;  4TU4 A;  4CFK A;  4IR3 A;  4C66 A;  2DVQ A;  5EA1 A;  4E96 A;  4QZS A;  2YW5 A;  4YH3 A;  4WHW A;  5FG4 A;  2L85 A;  4TYL A;  3U5M A;  2E3K A;  5IBN A;  4YYM A;  4YAX A;  3D7C A;  5A7C A;  3LQH A;  4ALG A;  5L99 A;  4LYS A;  4O72 A;  5EI4 A;  4UIV A;  5FE2 A;  4WIV A;  5D3N A;  4HXL A;  5CFW A;  4YYD A;  5ACY A;  3MUK A;  5ENB A;  5D3L A;  5FG5 A;  5DYC A;  4CUQ A;  4TT6 A;  4YYK A;  2DVS A;  5HEM A;  4GPJ A;  5LVQ A;  5DYX A;  5I86 A;  4MR3 A;  4DON A;  5C89 A;  4YBS A;  4QUU A;  4IOQ A;  4QR4 A;  5I7Y A;  4PKL A;  5DBM A;  4N3W A;  5A5O A;  2YEM A;  4QYL A;  4UYE A;  3P1E A;  3O33 A;  1X0J A;  2RNW A;  4IR4 A;  5LKX A;  5DFC A;  3QZV A;  5AMF A;  4BHW A;  5EP7 A;  3P1C A;  4QEV A;  4YAD A;  2R0S A;  3HME A;  4NRC A;  5DYA A;  3LQJ A;  4QYD A;  4HXM A;  4QUT A;  5A5P A;  4BW3 A;  5F63 A;  3P5O A;  5CQ4 A;  4YBM A;  5AME A;  5CQ6 A;  4OUF A;  4RVR A;  5C8G A;  4A9M A;  4WHU A;  5EWH A;  2EJN A;  5I89 A;  4MEQ A;  5L8U A;  3MQM A;  4KCX A;  4NRA A;  5DYU A;  3JVL A;  4QSV A;  2OSS A;  4MR6 A;  5CUA A;  2RFJ A;  3S91 A;  5FH6 A;  4HXR A;  5DLX A;  4TT2 A;  4YAB A;  5F5Z A;  4CUT A;  5I1Q A;  3GG3 A;  5F60 A;  5IGL A;  5EWW A;  5ENJ A;  2YEK A;  5DW2 A;  5C7N A;  4O7A A;  2R10 A;  5E9M A;  5L98 A;  4C67 A;  5A5R A;  4QR3 A;  4BW4 A;  3UVW A;  5CY9 A;  5DKD A;  4YH4 A;  3D1D A;  2E7N A;  4YY6 A;  5I7X A;  4OGJ A;  5KU3 A;  5HQ7 A;  3U5O A;  1JM4 B;  4LZ2 A;  5A82 A;  5FE4 A;  4PCI A;  4YAT A;  4NR5 A;  5EWV A;  4UIU A;  3U5J A;  2DWW A;  5ENG A;  5D3P A;  4Z6H A;  3S92 A;  4MEN A;  5I40 A;  3SVF A;  4QSP A;  5ETD A;  4LZR A;  4CLB A;  3RCW A;  5II1 A;  4CUP A;  1PUO A;  4YY4 A;  4NRB A;  4QSS A;  5ENH A;  4QSU A;  1JSP B;  3UV4 A;  4XYA A;  4AKI A;  2R0V A;  3UVD A;  4HXK A;  5H85 A;  4AKH A;  3VKH A;  3ONI A;  4BJX A;  5ENI A;  5E3D A;  2YDW A;  4QSX A;  5A83 A;  4Q0O A;  4O75 A;  4CUS A;  2NXB A;  5HRW A;  5F3A A;  3SVH A;  4YYG A;  3D1B A;  4TTE A;  4QST A;  4XY9 A;  4BW2 A;  4A9J A;  4NQM A;  3U5K A;  4UIX A;  5EM3 A;  5DY7 A;  4HXN A;  5CS8 A;  5CUD A;  5F2P A;  3VKG A;  5ENE A;  3JVM A;  5DKH A;  5CUE A;  5FDZ A;  5CRM A;  2RNY A;  5BT5 A;  4LYW A;  4NUD A;  4MR5 A;  4CUR A;  5D3S A;  4UYH A;  1WUG A;  4O7F A;  4IR6 A;  4MEO A;  5HRX A;  4J1P A;  2D9E A;  3O37 A;  5E0R A;  5KTU A;  5L97 A;  5IGK A;  5HLS A;  4HBW A;  2RO1 A;  2WP2 A;  2WP1 A;  4X2I A;  4A9I A;  2KTB B;  3U5P A;  4QSQ A;  5FH8 A;  2LSP B;  2YYN A;  4PCE A;  5EWC A;  2DVV A;  5CQ7 A;  5LJ2 A;  4LYI A;  2DKW A;  4YBT A;  5FE0 A;  5FFV A;  4UIT A;  5L8T A;  5L96 A;  1ZS5 A;  5E9Y A;  5C87 A;  3SVG A;  2E7O A;  3LXJ A;  5II2 A;  5AD2 A;  5FFY A;  2D82 A;  3DAI A;  5FE8 A;  5I29 A;  2YEL A;  5D0C A;  5FE9 A;  4UIY A;  4NXJ A;  3QZT A;  4O78 A;  2RI7 A;  5FE6 A;  4PS5 A;  3P1D A;  4HBY A;  4CFL A;  4YYN A;  4NYX A;  5C4Q A;  4ZW1 A;  4LC2 A;  4A9L A;  3MUL A;  5H1U A;  4FLP A;  4Z1S A;  4TU6 A;  2DVR A;  5CZG A;  4J0R A;  5HCL A;  5D7X A;  5DFD A;  5E9V A;  4YYJ A;  5E7D A;  4UYG A;  5EIS A;  3JVJ A;  3UVY A;  5COI A;  4UYD A;  5G4R A;  5E73 A;  3U5L A;  4HXO A;  5D26 A;  3UV5 A;  4QB3 A;  2RS9 B;  4LZS A;  5ENF A;  5D3H A;  5EQ1 A;  5LJ0 A;  5EWD A;  5CPE A;  4O7C A;  5D3R A;  5A5Q A;  4NYV A;  2MJV B;  4O71 A;  4KV4 A;  5CQ3 A;  4NYW A;  5JI8 A;  5HRV A;  4A9O A;  2F6J A;  3DWY A;  4XY8 A;  5HM0 A;  4QBM A;  4N4G A;  4LDF A;  3UV2 A;  3Q2E A;  5HEL A;  5KHM A;  4HBV A;  5A85 A;  5TB6 A;  5EU1 A;  5EVA A;  5E9L A;  5D24 A;  3O36 A;  5I83 A;  5EK9 A;  3MB3 A;  4QEW A;  3IU5 A;  4O7B A;  5ETB A;  4QC1 A;  1E6I A;  5CQ8 A;  2L84 A;  4YC9 A;  1ZKR A;  4A9H A;  4YYI A;  5IGM A;  2H60 A;  3NXB A;  3P1F A;  5F1L A;  5KO4 A;  4N4F A;  4Y03 A;  2G4A A;  4A9E A;  4AKN A;  4TZ8 A;  5CU8 A;  4NR4 A;  1N72 A;  5ENC A;  5C85 A;  5D25 A;  3HMF A;  4HXP A;  4PTB A;  2N9G A;  5E9K A;  5FFW A;  5EPB A;  5A81 A;  4XUB A;  5E3G A;  5CP5 A;  5CQT A;  3UVX A;  4KV1 A;  4NR6 A;  4NR9 A;  4A9F A;  5FE1 A;  5HQ6 A;  4J0S A;  2R0Y A;  4A9N A;  4NR8 A;  3IU6 A;  4QEU A;  5KTX A;  4Z6I A;  5JWM A;  4MR4 A;  3O34 A;  5H1T A; 
#chains in the Genus database with same CATH homology
 5LKT A;  4TZ2 A;  4UYF B;  4NUE A;  1EQF A;  4XUA A;  4TQN A;  5DLZ A;  5E74 A;  5F62 A;  5FB0 A;  5LJ1 A;  4Z93 A;  5LKU A;  5LUU A;  3AAD A;  4J3I A;  4LR6 A;  2OUO A;  3LJW A;  5A5S A;  2I8N A;  4Q0N A;  5CTL A;  5CUC A;  2L5E A;  3AQA A;  5F36 A;  4IOO A;  5D3T A;  2FSA A;  2RNX A;  3K2J A;  5EV9 A;  5FH7 A;  5F1H A;  5IID A;  4ALH A;  3Q2F A;  4F3I A;  4CUU A;  2YQD A;  5IG6 A;  5DX4 A;  5HFQ A;  4QSW A;  4YK0 A;  5BT4 A;  4NUC A;  5HFR A;  3TLP A;  4IOR A;  4BW1 A;  4NQN A;  5HQ5 A;  4QR5 A;  5DW1 A;  4UIZ A;  5E9I A;  5J0D A;  4UYF A;  4O77 A;  5FB1 A;  5K29 A;  4ZQL A;  4ZC9 A;  3U5N A;  1F68 A;  4PY6 A;  3HMH A;  5H1V A;  4O76 A;  5I80 A;  5A5N A;  4YYH A;  5EPS A;  2OO1 A;  5LVR A;  5EGU A;  3G0J A;  3JVK A;  4QC3 A;  4CL9 A;  2I7K A;  4HXS A;  5LKZ A;  5DFB A;  5CQ5 A;  5FG6 A;  3UW9 A;  4UIW A;  5EIC A;  4QY4 A;  4N4H A;  5DKC A;  5FE5 A;  3G0L A;  5FBX A;  4IR5 A;  3QZS A;  5G4S A;  2GRC A;  4QSR A;  4TT4 A;  4Z1Q A;  3O35 A;  5I88 A;  1WUM A;  4MEP A;  5KTW A;  5CUG A;  3LQI A;  4NS5 A;  4O7E A;  3I3J A;  5TCM A;  3FKM X;  5F25 A;  5FE7 A;  5HEN A;  5CUB A;  4N4I A;  3MXF A;  5EPR A;  5FE3 A;  4A9K A;  5CRZ A;  2DAT A;  4HBX A;  5IGN A;  4TS8 A;  4NR7 A;  4O70 A;  4QNS A;  5BT3 A;  3ZYU A;  5HJC A;  5D3J A;  5CQA A;  2F6N A;  3MB4 A;  5CGP A;  4LRG A;  4O74 A;  5AD3 A;  4OGI A;  5F61 A;  4TU4 A;  4CFK A;  4IR3 A;  4C66 A;  2DVQ A;  5EA1 A;  4E96 A;  4QZS A;  2YW5 A;  4YH3 A;  4WHW A;  5FG4 A;  2L85 A;  4TYL A;  3U5M A;  2E3K A;  5IBN A;  4YYM A;  4YAX A;  3D7C A;  5A7C A;  3LQH A;  4ALG A;  5L99 A;  4LYS A;  4O72 A;  5EI4 A;  4UIV A;  5FE2 A;  4WIV A;  5D3N A;  4HXL A;  5CFW A;  4YYD A;  5ACY A;  3MUK A;  5ENB A;  5D3L A;  5FG5 A;  5DYC A;  4CUQ A;  4TT6 A;  4YYK A;  2DVS A;  5HEM A;  4GPJ A;  5LVQ A;  5DYX A;  5I86 A;  4MR3 A;  4DON A;  5C89 A;  4YBS A;  4QUU A;  4IOQ A;  4QR4 A;  5I7Y A;  4PKL A;  5DBM A;  4N3W A;  5A5O A;  2YEM A;  4QYL A;  4UYE A;  3P1E A;  3O33 A;  1X0J A;  2RNW A;  4IR4 A;  5LKX A;  5DFC A;  3QZV A;  5AMF A;  4BHW A;  5EP7 A;  3P1C A;  4QEV A;  4YAD A;  2R0S A;  3HME A;  4NRC A;  5DYA A;  3LQJ A;  4QYD A;  4HXM A;  4QUT A;  5A5P A;  4BW3 A;  5F63 A;  3P5O A;  5CQ4 A;  4YBM A;  5AME A;  5CQ6 A;  4OUF A;  4RVR A;  5C8G A;  4A9M A;  4WHU A;  5EWH A;  5I89 A;  4MEQ A;  5L8U A;  3MQM A;  4KCX A;  4NRA A;  5DYU A;  3JVL A;  4QSV A;  2OSS A;  4MR6 A;  5CUA A;  2RFJ A;  3S91 A;  5FH6 A;  4HXR A;  5DLX A;  4TT2 A;  4YAB A;  5F5Z A;  4CUT A;  5I1Q A;  3GG3 A;  5F60 A;  5IGL A;  5EWW A;  5ENJ A;  2YEK A;  5DW2 A;  5C7N A;  4O7A A;  2R10 A;  5E9M A;  5L98 A;  4C67 A;  5A5R A;  4QR3 A;  4BW4 A;  3UVW A;  5CY9 A;  5DKD A;  4YH4 A;  2E7N A;  4YY6 A;  5I7X A;  4OGJ A;  5KU3 A;  5HQ7 A;  3U5O A;  1JM4 B;  4LZ2 A;  5A82 A;  5FE4 A;  4PCI A;  4YAT A;  4NR5 A;  5EWV A;  4UIU A;  3U5J A;  2DWW A;  5ENG A;  5D3P A;  4Z6H A;  3S92 A;  4MEN A;  5I40 A;  3SVF A;  4QSP A;  5ETD A;  4LZR A;  4CLB A;  3RCW A;  5II1 A;  4CUP A;  4YY4 A;  4NRB A;  4QSS A;  5ENH A;  4QSU A;  1JSP B;  3UV4 A;  4XYA A;  2R0V A;  3UVD A;  4HXK A;  5H85 A;  3ONI A;  4BJX A;  5ENI A;  5E3D A;  2YDW A;  4QSX A;  5A83 A;  4Q0O A;  4O75 A;  4CUS A;  2NXB A;  5HRW A;  5F3A A;  3SVH A;  4YYG A;  4TTE A;  4QST A;  4XY9 A;  4BW2 A;  4A9J A;  4NQM A;  3U5K A;  4UIX A;  5EM3 A;  5DY7 A;  4HXN A;  5CS8 A;  5CUD A;  5F2P A;  5ENE A;  3JVM A;  5DKH A;  5CUE A;  5FDZ A;  5CRM A;  2RNY A;  5BT5 A;  4LYW A;  4NUD A;  4MR5 A;  4CUR A;  5D3S A;  4UYH A;  1WUG A;  4O7F A;  4IR6 A;  4MEO A;  5HRX A;  4J1P A;  2D9E A;  3O37 A;  5E0R A;  5KTU A;  5L97 A;  5IGK A;  5HLS A;  4HBW A;  2RO1 A;  2WP2 A;  2WP1 A;  4X2I A;  4A9I A;  2KTB B;  3U5P A;  4QSQ A;  5FH8 A;  2LSP B;  2YYN A;  4PCE A;  5EWC A;  2DVV A;  5CQ7 A;  5LJ2 A;  4LYI A;  2DKW A;  4YBT A;  5FE0 A;  5FFV A;  4UIT A;  5L8T A;  5L96 A;  1ZS5 A;  5E9Y A;  5C87 A;  3SVG A;  2E7O A;  3LXJ A;  5II2 A;  5AD2 A;  5FFY A;  2D82 A;  3DAI A;  5FE8 A;  5I29 A;  2YEL A;  5D0C A;  5FE9 A;  4UIY A;  4NXJ A;  3QZT A;  4O78 A;  2RI7 A;  5FE6 A;  4PS5 A;  3P1D A;  4HBY A;  4CFL A;  4YYN A;  4NYX A;  5C4Q A;  4ZW1 A;  4LC2 A;  4A9L A;  3MUL A;  5H1U A;  4FLP A;  4Z1S A;  4TU6 A;  2DVR A;  5CZG A;  4J0R A;  5HCL A;  5D7X A;  5DFD A;  5E9V A;  4YYJ A;  5E7D A;  4UYG A;  5EIS A;  3JVJ A;  3UVY A;  5COI A;  4UYD A;  5G4R A;  5E73 A;  3U5L A;  4HXO A;  5D26 A;  3UV5 A;  4QB3 A;  2RS9 B;  4LZS A;  5ENF A;  5D3H A;  5EQ1 A;  5LJ0 A;  5EWD A;  5CPE A;  4O7C A;  5D3R A;  5A5Q A;  4NYV A;  2MJV B;  4O71 A;  4KV4 A;  5CQ3 A;  4NYW A;  5JI8 A;  5HRV A;  4A9O A;  2F6J A;  3DWY A;  4XY8 A;  5HM0 A;  4QBM A;  4N4G A;  4LDF A;  3UV2 A;  3Q2E A;  5HEL A;  5KHM A;  4HBV A;  5A85 A;  5TB6 A;  5EU1 A;  5EVA A;  5E9L A;  5D24 A;  3O36 A;  5I83 A;  5EK9 A;  3MB3 A;  4QEW A;  3IU5 A;  4O7B A;  5ETB A;  4QC1 A;  1E6I A;  5CQ8 A;  2L84 A;  4YC9 A;  4A9H A;  4YYI A;  5IGM A;  2H60 A;  3NXB A;  3P1F A;  5F1L A;  5KO4 A;  4N4F A;  4Y03 A;  2G4A A;  4A9E A;  4AKN A;  4TZ8 A;  5CU8 A;  4NR4 A;  1N72 A;  5ENC A;  5C85 A;  5D25 A;  3HMF A;  4HXP A;  4PTB A;  2N9G A;  5E9K A;  5FFW A;  5EPB A;  5A81 A;  4XUB A;  5E3G A;  5CP5 A;  5CQT A;  3UVX A;  4KV1 A;  4NR6 A;  4NR9 A;  4A9F A;  5FE1 A;  5HQ6 A;  4J0S A;  2R0Y A;  4A9N A;  4NR8 A;  3IU6 A;  4QEU A;  5KTX A;  4Z6I A;  5JWM A;  4MR4 A;  3O34 A;  5H1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...