4Z1SA

Crystal structure of the first bromodomain of human brd4 with benzotriazolo-diazepine scaffold
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzotriazolo[4,3-d][1,4]diazepines as Orally Active Inhibitors of BET Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z1sA01
5DLZA 4YYMA 4UIYA 4GPJA 4LDFA 5FE3A 2OO1A 5COIA 4UYFB 3O35A 4HXLA 4TZ8A 5DYUA 4HXMA 5EA1A 5HRVA 4CLBA 5DFCA 5HLSA 5C89A 3O33A 5I7XA 1JSPB 5C4QA 5KTXA 4NR9A 4O7AA 4IORA 4YBSA 4Q0OA 4CUTA 5F1HA 5FG5A 3U5OA 5FH8A 4MEQA 5FB0A 4YYIA 5CRMA 5BT3A 4DONA 3U5NA 4X2IA 4J0SA 4QSXA 5DKHA 4YYHA 4A9LA 3UV5A 4O7EA 4C66A 3QZSA 4BW2A 2I7KA 5L98A 3UVXA 2R10A 3MUKA 4LR6A 2RNXA 5D24A 5HJCA 4YYNA 4QUTA 5EI4A 5FB1A 4QSSA 3O36A 5F61A 5I89A 5L8TA 5CFWA 5D3LA 5L97A 2WP1A 3SVFA 5HCLA 4XY8A 3U5KA 5CQTA 4BW3A 4UIXA 2D9EA 4LRGA 5E7DA 4QSUA 4CL9A 2F6JA 5FE6A 4O76A 4MR6A 4O78A 4UIUA 5DKCA 2DVQA 5D0CA 3K2JA 3P5OA 4MEPA 5IGNA 5LVRA 5AD2A 5D7XA 2RNYA 4NUEA 3UW9A 5I29A 5K29A 5FFYA 3MXFA 2RFJA 5EWWA 4YK0A 5CP5A 4CURA 4KV4A 4PS5A 5F2PA 5F3AA 4O75A 2RI7A 4XY9A 4PKLA 5CQAA 4YH4A 5F62A 2I8NA 4HBWA 5L8UA 4O7CA 5HEMA 5EK9A 4UYDA 3FKMX 4QR5A 4YATA 4LC2A 5D3SA 4O77A 3JVKA 4OUFA 5KU3A 5FH7A 3LXJA 4IR6A 4IR3A 4WHWA 3UV4A 4MENA 4BW1A 4NYVA 4Z6IA 4C67A 2NXBA 5HQ5A 2WP2A 4A9OA 2YELA 5A5RA 5EPBA 5EQ1A 3LJWA 4A9NA 5EWVA 4PCIA 4N4GA 5H1TA 2DWWA 4Z1SA 2MJVB 3U5JA 4QC3A 4YAXA 4A9FA 3I3JA 4YABA 5AD3A 4ALGA 3GG3A 5A85A 2KTBB 4QSRA 3JVLA 4LZ2A 5LKZA 4HXOA 4N4IA 2YQDA 4HXPA 4UYGA 3QZVA 5A82A 4O7BA 3AQAA 4YY4A 5A5PA 4YBMA 4YBTA 5ENBA 5CQ3A 4CUSA 4ZQLA 5EU1A 3U5PA 5EP7A 4LZSA 5CUBA 2L84A 5LKXA 4LYWA 5ACYA 4HBVA 5EGUA 4HXRA 5LVQA 5DFBA 5KTWA 5A5SA 5II2A 4QUUA 2D82A 5FE0A 5FE4A 2OSSA 4TYLA 3HMFA 3P1DA 5IBNA 4Z93A 5D26A 5D3TA 4CFLA 4QSTA 4TQNA 4A9EA 5G4RA 5HENA 4Z1QA 2YEMA 3Q2FA 4NRBA 3O37A 5FFVA 3RCWA 5E0RA 5A5NA 5I83A 4UYFA 5E3DA 5CGPA 1E6IA 4MR4A 5ENEA 3DWYA 4QR4A 4QB3A 5ENJA 1WUGA 5ETDA 5ENGA 2F6NA 3TLPA 5H1VA 4OGIA 4YADA 5F1LA 5A7CA 5ENIA 5FE1A 5IG6A 4QSPA 4YYDA 5CQ4A 3P1EA 3MB3A 5CPEA 3LQJA 3Q2EA 5LUUA 4AKNA 2YEKA 4O74A 4N4FA 4WIVA 5D3NA 4NR6A 5E9LA 4RVRA 5HQ7A 5L96A 3O34A 4NR5A 5CQ7A 5A5QA 1JM4B 5DYAA 5II1A 5I86A 3IU5A 2DATA 4XUAA 5A81A 3P1CA 4E96A 4O7FA 4QYLA 5CZGA 5BT4A 4Q0NA 5F63A 5ETBA 4ZC9A 5AMEA 5KTUA 4Z6HA 4A9KA 4PY6A 3D7CA 4IR5A 4QSWA 5FDZA 2N9GA 5IGLA 5CUGA 2E7NA 1N72A 5TCMA 5C8GA 5TB6A 4O72A 4J3IA 4NR4A 4XYAA 4A9IA 5FE5A 2OUOA 5CTLA 5F25A 5BT5A 5I7YA 3SVHA 5FFWA 4MR5A 5LJ2A 4QEWA 5EWCA 5LJ0A 4A9HA 4MR3A 2RNWA 4NRAA 4Y03A 3G0JA 3JVMA 4LYSA 5E9IA 3UVWA 4QEUA 5A83A 4NR7A 4HBXA 5CY9A 2DVVA 4NYXA 5DBMA 5FE7A 5EPSA 4UITA 5D3JA 4IOQA 5E74A 5FG6A 5KHMA 2GRCA 3AADA 4HXKA 4J0RA 4QSVA 5ENCA 5HFRA 4YC9A 5HM0A 4QR3A 5H1UA 4TT2A 2RS9B 2R0VA 5F36A 4BW4A 2YYNA 2L5EA 2E3KA 3ONIA 4NUCA 4A9MA 5AMFA 5EV9A 4ZW1A 3SVGA 4PCEA 4QSQA 4N4HA 5HRXA 5FE2A 4QEVA 4QC1A 1F68A 5G4SA 4NQNA 1X0JA 4TU4A 3P1FA 3S92A 4NUDA 4PTBA 1WUMA 4QNSA 4BHWA 5FBXA 3LQIA 3NXBA 5I88A 4CUPA 5E3GA 5I1QA 5DYXA 5F60A 3U5LA 2DKWA 4CUQA 4QZSA 4LYIA 4OGJA 5LKTA 4BJXA 5ENFA 5EWHA 4IR4A 5F5ZA 2YW5A 4UYEA 5E73A 2FSAA 5EICA 2R0SA 2RO1A 3MULA 4HXNA 4TU6A 5CUDA 1ZS5A 5CUAA 4YYKA 5DY7A 2G4AA 5EWDA 3IU6A 3S91A 2R0YA 4HXSA 5CQ6A 4TZ2A 5IIDA 5JI8A 3UVDA 4O70A 4HBYA 5CS8A 4FLPA 2DVRA 4NYWA 4F3IA 4TT6A 5J0DA 4N3WA 2LSPB 5FE8A 4XUBA 4UYHA 4IOOA 3JVJA 4LZRA 5E9VA 5ENHA 4KCXA 5JWMA 4UIWA 2H60A 3MQMA 1EQFA 4QYDA 4UIVA 4YH3A 3ZYUA 5HELA 5DKDA 5DFDA 3LQHA 4CFKA 5D3HA 4UIZA 5CU8A 5FG4A 5D3PA 5KO4A 4KV1A 4ALHA 5HQ6A 5IGMA 3QZTA 3U5MA 3UV2A 5EVAA 5DLXA 5DW2A 4NRCA 5EPRA 3UVYA 5DX4A 2L85A 4A9JA 4TS8A 4YYJA 4J1PA 5CUCA 3MB4A 4NXJA 4NQMA 5EISA 5C7NA 5E9MA 4O71A 4TTEA 4QY4A 5D25A 5E9YA 5C85A 5DW1A 5DYCA 4YYGA 5IGKA 4NS5A 5A5OA 5FE9A 5D3RA 4QBMA 2YDWA 4MEOA 4CUUA 2E7OA 5CQ5A 4NR8A 2DVSA 3DAIA 5LKUA 5H85A 5FH6A 3G0LA 5CRZA 4TT4A 5HRWA 3HMEA 5E9KA 5I40A 5C87A 5LJ1A 4WHUA 5L99A 5EM3A 3HMHA 5HFQA 5I80A 5CQ8A 4YY6A 5CUEA
chains in the Genus database with same CATH superfamily
5DLZA 4YYMA 4UIYA 4GPJA 4LDFA 5FE3A 2OO1A 5COIA 4UYFB 3O35A 4HXLA 4TZ8A 5DYUA 4AKHA 4HXMA 5EA1A 5HRVA 4CLBA 5DFCA 5HLSA 2EJNA 5C89A 3O33A 5I7XA 1JSPB 5C4QA 5KTXA 4NR9A 4O7AA 4IORA 4YBSA 4Q0OA 4CUTA 5F1HA 5FG5A 3U5OA 5FH8A 4MEQA 5FB0A 4YYIA 5CRMA 5BT3A 4DONA 3U5NA 4X2IA 4J0SA 4QSXA 5DKHA 4YYHA 4A9LA 3UV5A 4O7EA 4C66A 3QZSA 4BW2A 2I7KA 5L98A 3UVXA 2R10A 3MUKA 4LR6A 2RNXA 5D24A 5HJCA 4YYNA 4QUTA 5EI4A 5FB1A 4QSSA 3O36A 5F61A 5I89A 5L8TA 5CFWA 5D3LA 5L97A 2WP1A 3SVFA 5HCLA 4XY8A 3U5KA 5CQTA 4BW3A 4UIXA 2D9EA 4LRGA 5E7DA 4QSUA 4CL9A 2F6JA 5FE6A 4O76A 4MR6A 4O78A 4UIUA 5DKCA 2DVQA 5D0CA 3K2JA 3P5OA 4MEPA 5IGNA 5LVRA 5AD2A 5D7XA 2RNYA 4NUEA 3UW9A 5I29A 5K29A 5FFYA 3MXFA 2RFJA 5EWWA 4YK0A 5CP5A 4CURA 4KV4A 4PS5A 5F2PA 5F3AA 4O75A 2RI7A 4XY9A 4PKLA 5CQAA 4YH4A 5F62A 2I8NA 3D1BA 4HBWA 5L8UA 4O7CA 5HEMA 5EK9A 4UYDA 3FKMX 4QR5A 4YATA 4LC2A 5D3SA 4O77A 3JVKA 4OUFA 5KU3A 3D1DA 5FH7A 3LXJA 4IR6A 4IR3A 4WHWA 3UV4A 4MENA 4BW1A 4NYVA 4Z6IA 4C67A 2NXBA 5HQ5A 2WP2A 4A9OA 2YELA 5A5RA 5EPBA 5EQ1A 3LJWA 4A9NA 5EWVA 4PCIA 4N4GA 5H1TA 2DWWA 4Z1SA 2MJVB 3U5JA 4QC3A 4YAXA 4A9FA 3I3JA 4YABA 5AD3A 4ALGA 3GG3A 5A85A 2KTBB 4QSRA 3JVLA 4LZ2A 5LKZA 4HXOA 4N4IA 2YQDA 4HXPA 4UYGA 3QZVA 5A82A 4O7BA 3AQAA 4YY4A 5A5PA 4YBMA 4YBTA 5ENBA 5CQ3A 4CUSA 4ZQLA 5EU1A 3U5PA 5EP7A 4LZSA 5CUBA 2L84A 5LKXA 4LYWA 5ACYA 4AKIA 4HBVA 5EGUA 4HXRA 5LVQA 5DFBA 5KTWA 5A5SA 5II2A 4QUUA 2D82A 5FE0A 5FE4A 2OSSA 4TYLA 3HMFA 3P1DA 5IBNA 4Z93A 5D26A 5D3TA 4CFLA 4QSTA 4TQNA 4A9EA 5G4RA 5HENA 4Z1QA 2YEMA 3Q2FA 4NRBA 3O37A 5FFVA 3RCWA 5E0RA 5A5NA 5I83A 4UYFA 5E3DA 5CGPA 1E6IA 4MR4A 5ENEA 3DWYA 4QR4A 4QB3A 5ENJA 1WUGA 5ETDA 4AKGA 5ENGA 2F6NA 3TLPA 5H1VA 4OGIA 4YADA 5F1LA 5A7CA 5ENIA 5FE1A 5IG6A 4QSPA 4YYDA 5CQ4A 3P1EA 3MB3A 5CPEA 3LQJA 3Q2EA 5LUUA 4AKNA 2YEKA 4O74A 4N4FA 4WIVA 5D3NA 4NR6A 5E9LA 4RVRA 5HQ7A 5L96A 3O34A 4NR5A 3VKHA 5CQ7A 5A5QA 1JM4B 5DYAA 5II1A 5I86A 3IU5A 2DATA 4XUAA 5A81A 3P1CA 4E96A 4O7FA 4QYLA 5CZGA 5BT4A 4Q0NA 5F63A 5ETBA 4ZC9A 5AMEA 5KTUA 4Z6HA 4A9KA 4PY6A 3D7CA 4IR5A 4QSWA 5FDZA 2N9GA 5IGLA 5CUGA 2E7NA 1N72A 5TCMA 5C8GA 5TB6A 4O72A 4J3IA 4NR4A 4XYAA 4A9IA 5FE5A 2OUOA 5CTLA 5F25A 5BT5A 5I7YA 3SVHA 5FFWA 4MR5A 5LJ2A 4QEWA 5EWCA 5LJ0A 4A9HA 4MR3A 2RNWA 4NRAA 4Y03A 3G0JA 3JVMA 4LYSA 5E9IA 3UVWA 4QEUA 5A83A 4NR7A 4HBXA 5CY9A 2DVVA 4NYXA 5DBMA 5FE7A 5EPSA 4UITA 5D3JA 4IOQA 5E74A 5FG6A 5KHMA 2GRCA 3AADA 4HXKA 4J0RA 4QSVA 5ENCA 5HFRA 4YC9A 5HM0A 4QR3A 5H1UA 4TT2A 2RS9B 2R0VA 5F36A 4BW4A 2YYNA 2L5EA 2E3KA 3ONIA 4NUCA 4A9MA 5AMFA 5EV9A 1ZKRA 4ZW1A 3SVGA 4PCEA 4QSQA 4N4HA 5HRXA 5FE2A 4QEVA 4QC1A 1F68A 5G4SA 4NQNA 1X0JA 4TU4A 3P1FA 3S92A 4NUDA 4PTBA 1WUMA 4QNSA 4BHWA 5FBXA 3LQIA 3NXBA 5I88A 4CUPA 5E3GA 5I1QA 5DYXA 5F60A 3U5LA 2DKWA 4CUQA 4QZSA 4LYIA 4OGJA 5LKTA 4BJXA 5ENFA 5EWHA 4IR4A 5F5ZA 2YW5A 4UYEA 5E73A 1PUOA 2FSAA 5EICA 2R0SA 2RO1A 3MULA 4HXNA 4TU6A 5CUDA 1ZS5A 5CUAA 4YYKA 5DY7A 2G4AA 5EWDA 3IU6A 3S91A 2R0YA 4HXSA 5CQ6A 4TZ2A 5IIDA 5JI8A 3UVDA 4O70A 4HBYA 5CS8A 4FLPA 2DVRA 3VKGA 4NYWA 4F3IA 4TT6A 5J0DA 4N3WA 2LSPB 5FE8A 4XUBA 4UYHA 4IOOA 3JVJA 4LZRA 5E9VA 5ENHA 4KCXA 5JWMA 4UIWA 2H60A 3MQMA 1EQFA 4QYDA 4UIVA 4YH3A 3ZYUA 5HELA 5DKDA 5DFDA 3LQHA 4CFKA 5D3HA 4UIZA 5CU8A 5FG4A 5D3PA 5KO4A 4KV1A 4ALHA 5HQ6A 5IGMA 3QZTA 3U5MA 3UV2A 5EVAA 3ERRA 5DLXA 5DW2A 4NRCA 5EPRA 3UVYA 5DX4A 2L85A 4A9JA 4TS8A 4YYJA 4J1PA 5CUCA 3MB4A 4NXJA 4NQMA 5EISA 5C7NA 5E9MA 4O71A 4TTEA 4QY4A 5D25A 5E9YA 5C85A 5DW1A 5DYCA 4YYGA 5IGKA 4NS5A 5A5OA 5FE9A 5D3RA 4QBMA 2YDWA 4MEOA 4CUUA 2E7OA 5CQ5A 4NR8A 2DVSA 3DAIA 5LKUA 5H85A 5FH6A 3G0LA 5CRZA 4TT4A 5HRWA 3HMEA 5E9KA 5I40A 5C87A 5LJ1A 4WHUA 5L99A 5EM3A 3HMHA 5HFQA 5I80A 5CQ8A 4YY6A 4AI6A 5CUEA
chains in the Genus database with same CATH topology
5DLZA 4YYMA 4UIYA 4GPJA 4LDFA 5FE3A 2OO1A 5COIA 4UYFB 3O35A 4HXLA 4TZ8A 5DYUA 4HXMA 5EA1A 5HRVA 4CLBA 5DFCA 5HLSA 5C89A 3O33A 5I7XA 1JSPB 5C4QA 5KTXA 4NR9A 4O7AA 4IORA 4YBSA 4Q0OA 4CUTA 5F1HA 5FG5A 3U5OA 5FH8A 4MEQA 5FB0A 4YYIA 5CRMA 5BT3A 4DONA 3U5NA 4X2IA 4J0SA 4QSXA 5DKHA 4YYHA 4A9LA 3UV5A 4O7EA 4C66A 3QZSA 4BW2A 2I7KA 5L98A 3UVXA 2R10A 3MUKA 4LR6A 2RNXA 5D24A 5HJCA 4YYNA 4QUTA 5EI4A 5FB1A 4QSSA 3O36A 5F61A 5I89A 5L8TA 5CFWA 5D3LA 5L97A 2WP1A 3SVFA 5HCLA 4XY8A 3U5KA 5CQTA 4BW3A 4UIXA 2D9EA 4LRGA 5E7DA 4QSUA 4CL9A 2F6JA 5FE6A 4O76A 4MR6A 4O78A 4UIUA 5DKCA 2DVQA 5D0CA 3K2JA 3P5OA 4MEPA 5IGNA 5LVRA 5AD2A 5D7XA 2RNYA 4NUEA 3UW9A 5I29A 5K29A 5FFYA 3MXFA 2RFJA 5EWWA 4YK0A 5CP5A 4CURA 4KV4A 4PS5A 5F2PA 5F3AA 4O75A 2RI7A 4XY9A 4PKLA 5CQAA 4YH4A 5F62A 2I8NA 4HBWA 5L8UA 4O7CA 5HEMA 5EK9A 4UYDA 3FKMX 4QR5A 4YATA 4LC2A 5D3SA 4O77A 3JVKA 4OUFA 5KU3A 5FH7A 3LXJA 4IR6A 4IR3A 4WHWA 3UV4A 4MENA 4BW1A 4NYVA 4Z6IA 4C67A 2NXBA 5HQ5A 2WP2A 4A9OA 2YELA 5A5RA 5EPBA 5EQ1A 3LJWA 4A9NA 5EWVA 4PCIA 4N4GA 5H1TA 2DWWA 4Z1SA 2MJVB 3U5JA 4QC3A 4YAXA 4A9FA 3I3JA 4YABA 5AD3A 4ALGA 3GG3A 5A85A 2KTBB 4QSRA 3JVLA 4LZ2A 5LKZA 4HXOA 4N4IA 2YQDA 4HXPA 4UYGA 3QZVA 5A82A 4O7BA 3AQAA 4YY4A 5A5PA 4YBMA 4YBTA 5ENBA 5CQ3A 4CUSA 4ZQLA 5EU1A 3U5PA 5EP7A 4LZSA 5CUBA 2L84A 5LKXA 4LYWA 5ACYA 4HBVA 5EGUA 4HXRA 5LVQA 5DFBA 5KTWA 5A5SA 5II2A 4QUUA 2D82A 5FE0A 5FE4A 2OSSA 4TYLA 3HMFA 3P1DA 5IBNA 4Z93A 5D26A 5D3TA 4CFLA 4QSTA 4TQNA 4A9EA 5G4RA 5HENA 4Z1QA 2YEMA 3Q2FA 4NRBA 3O37A 5FFVA 3RCWA 5E0RA 5A5NA 5I83A 4UYFA 5E3DA 5CGPA 1E6IA 4MR4A 5ENEA 3DWYA 4QR4A 4QB3A 5ENJA 1WUGA 5ETDA 5ENGA 2F6NA 3TLPA 5H1VA 4OGIA 4YADA 5F1LA 5A7CA 5ENIA 5FE1A 5IG6A 4QSPA 4YYDA 5CQ4A 3P1EA 3MB3A 5CPEA 3LQJA 3Q2EA 5LUUA 4AKNA 2YEKA 4O74A 4N4FA 4WIVA 5D3NA 4NR6A 5E9LA 4RVRA 5HQ7A 5L96A 3O34A 4NR5A 5CQ7A 5A5QA 1JM4B 5DYAA 5II1A 5I86A 3IU5A 2DATA 4XUAA 5A81A 3P1CA 4E96A 4O7FA 4QYLA 5CZGA 5BT4A 4Q0NA 5F63A 5ETBA 4ZC9A 5AMEA 5KTUA 4Z6HA 4A9KA 4PY6A 3D7CA 4IR5A 4QSWA 5FDZA 2N9GA 5IGLA 5CUGA 2E7NA 1N72A 5TCMA 5C8GA 5TB6A 4O72A 4J3IA 4NR4A 4XYAA 4A9IA 5FE5A 2OUOA 5CTLA 5F25A 5BT5A 5I7YA 3SVHA 5FFWA 4MR5A 5LJ2A 4QEWA 5EWCA 5LJ0A 4A9HA 4MR3A 2RNWA 4NRAA 4Y03A 3G0JA 3JVMA 4LYSA 5E9IA 3UVWA 4QEUA 5A83A 4NR7A 4HBXA 5CY9A 2DVVA 4NYXA 5DBMA 5FE7A 5EPSA 4UITA 5D3JA 4IOQA 5E74A 5FG6A 5KHMA 2GRCA 3AADA 4HXKA 4J0RA 4QSVA 5ENCA 5HFRA 4YC9A 5HM0A 4QR3A 5H1UA 4TT2A 2RS9B 2R0VA 5F36A 4BW4A 2YYNA 2L5EA 2E3KA 3ONIA 4NUCA 4A9MA 5AMFA 5EV9A 4ZW1A 3SVGA 4PCEA 4QSQA 4N4HA 5HRXA 5FE2A 4QEVA 4QC1A 1F68A 5G4SA 4NQNA 1X0JA 4TU4A 3P1FA 3S92A 4NUDA 4PTBA 1WUMA 4QNSA 4BHWA 5FBXA 3LQIA 3NXBA 5I88A 4CUPA 5E3GA 5I1QA 5DYXA 5F60A 3U5LA 2DKWA 4CUQA 4QZSA 4LYIA 4OGJA 5LKTA 4BJXA 5ENFA 5EWHA 4IR4A 5F5ZA 2YW5A 4UYEA 5E73A 2FSAA 5EICA 2R0SA 2RO1A 3MULA 4HXNA 4TU6A 5CUDA 1ZS5A 5CUAA 4YYKA 5DY7A 2G4AA 5EWDA 3IU6A 3S91A 2R0YA 4HXSA 5CQ6A 4TZ2A 5IIDA 5JI8A 3UVDA 4O70A 4HBYA 5CS8A 4FLPA 2DVRA 4NYWA 4F3IA 4TT6A 5J0DA 4N3WA 2LSPB 5FE8A 4XUBA 4UYHA 4IOOA 3JVJA 4LZRA 5E9VA 5ENHA 4KCXA 5JWMA 4UIWA 2H60A 3MQMA 1EQFA 4QYDA 4UIVA 4YH3A 3ZYUA 5HELA 5DKDA 5DFDA 3LQHA 4CFKA 5D3HA 4UIZA 5CU8A 5FG4A 5D3PA 5KO4A 4KV1A 4ALHA 5HQ6A 5IGMA 3QZTA 3U5MA 3UV2A 5EVAA 5DLXA 5DW2A 4NRCA 5EPRA 3UVYA 5DX4A 2L85A 4A9JA 4TS8A 4YYJA 4J1PA 5CUCA 3MB4A 4NXJA 4NQMA 5EISA 5C7NA 5E9MA 4O71A 4TTEA 4QY4A 5D25A 5E9YA 5C85A 5DW1A 5DYCA 4YYGA 5IGKA 4NS5A 5A5OA 5FE9A 5D3RA 4QBMA 2YDWA 4MEOA 4CUUA 2E7OA 5CQ5A 4NR8A 2DVSA 3DAIA 5LKUA 5H85A 5FH6A 3G0LA 5CRZA 4TT4A 5HRWA 3HMEA 5E9KA 5I40A 5C87A 5LJ1A 4WHUA 5L99A 5EM3A 3HMHA 5HFQA 5I80A 5CQ8A 4YY6A 5CUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLZ A;  4YYM A;  4UIY A;  4GPJ A;  4LDF A;  5FE3 A;  2OO1 A;  5COI A;  4UYF B;  3O35 A;  4HXL A;  4TZ8 A;  5DYU A;  4HXM A;  5EA1 A;  5HRV A;  4CLB A;  5DFC A;  5HLS A;  5C89 A;  3O33 A;  5I7X A;  1JSP B;  5C4Q A;  5KTX A;  4NR9 A;  4O7A A;  4IOR A;  4YBS A;  4Q0O A;  4CUT A;  5F1H A;  5FG5 A;  3U5O A;  5FH8 A;  4MEQ A;  5FB0 A;  4YYI A;  5CRM A;  5BT3 A;  4DON A;  3U5N A;  4X2I A;  4J0S A;  4QSX A;  5DKH A;  4YYH A;  4A9L A;  3UV5 A;  4O7E A;  4C66 A;  3QZS A;  4BW2 A;  2I7K A;  5L98 A;  3UVX A;  2R10 A;  3MUK A;  4LR6 A;  2RNX A;  5D24 A;  5HJC A;  4YYN A;  4QUT A;  5EI4 A;  5FB1 A;  4QSS A;  3O36 A;  5F61 A;  5I89 A;  5L8T A;  5CFW A;  5D3L A;  5L97 A;  2WP1 A;  3SVF A;  5HCL A;  4XY8 A;  3U5K A;  5CQT A;  4BW3 A;  4UIX A;  2D9E A;  4LRG A;  5E7D A;  4QSU A;  4CL9 A;  2F6J A;  5FE6 A;  4O76 A;  4MR6 A;  4O78 A;  4UIU A;  5DKC A;  2DVQ A;  5D0C A;  3K2J A;  3P5O A;  4MEP A;  5IGN A;  5LVR A;  5AD2 A;  5D7X A;  2RNY A;  4NUE A;  3UW9 A;  5I29 A;  5K29 A;  5FFY A;  3MXF A;  2RFJ A;  5EWW A;  4YK0 A;  5CP5 A;  4CUR A;  4KV4 A;  4PS5 A;  5F2P A;  5F3A A;  4O75 A;  2RI7 A;  4XY9 A;  4PKL A;  5CQA A;  4YH4 A;  5F62 A;  2I8N A;  4HBW A;  5L8U A;  4O7C A;  5HEM A;  5EK9 A;  4UYD A;  3FKM X;  4QR5 A;  4YAT A;  4LC2 A;  5D3S A;  4O77 A;  3JVK A;  4OUF A;  5KU3 A;  5FH7 A;  3LXJ A;  4IR6 A;  4IR3 A;  4WHW A;  3UV4 A;  4MEN A;  4BW1 A;  4NYV A;  4Z6I A;  4C67 A;  2NXB A;  5HQ5 A;  2WP2 A;  4A9O A;  2YEL A;  5A5R A;  5EPB A;  5EQ1 A;  3LJW A;  4A9N A;  5EWV A;  4PCI A;  4N4G A;  5H1T A;  2DWW A;  4Z1S A;  2MJV B;  3U5J A;  4QC3 A;  4YAX A;  4A9F A;  3I3J A;  4YAB A;  5AD3 A;  4ALG A;  3GG3 A;  5A85 A;  2KTB B;  4QSR A;  3JVL A;  4LZ2 A;  5LKZ A;  4HXO A;  4N4I A;  2YQD A;  4HXP A;  4UYG A;  3QZV A;  5A82 A;  4O7B A;  3AQA A;  4YY4 A;  5A5P A;  4YBM A;  4YBT A;  5ENB A;  5CQ3 A;  4CUS A;  4ZQL A;  5EU1 A;  3U5P A;  5EP7 A;  4LZS A;  5CUB A;  2L84 A;  5LKX A;  4LYW A;  5ACY A;  4HBV A;  5EGU A;  4HXR A;  5LVQ A;  5DFB A;  5KTW A;  5A5S A;  5II2 A;  4QUU A;  2D82 A;  5FE0 A;  5FE4 A;  2OSS A;  4TYL A;  3HMF A;  3P1D A;  5IBN A;  4Z93 A;  5D26 A;  5D3T A;  4CFL A;  4QST A;  4TQN A;  4A9E A;  5G4R A;  5HEN A;  4Z1Q A;  2YEM A;  3Q2F A;  4NRB A;  3O37 A;  5FFV A;  3RCW A;  5E0R A;  5A5N A;  5I83 A;  4UYF A;  5E3D A;  5CGP A;  1E6I A;  4MR4 A;  5ENE A;  3DWY A;  4QR4 A;  4QB3 A;  5ENJ A;  1WUG A;  5ETD A;  5ENG A;  2F6N A;  3TLP A;  5H1V A;  4OGI A;  4YAD A;  5F1L A;  5A7C A;  5ENI A;  5FE1 A;  5IG6 A;  4QSP A;  4YYD A;  5CQ4 A;  3P1E A;  3MB3 A;  5CPE A;  3LQJ A;  3Q2E A;  5LUU A;  4AKN A;  2YEK A;  4O74 A;  4N4F A;  4WIV A;  5D3N A;  4NR6 A;  5E9L A;  4RVR A;  5HQ7 A;  5L96 A;  3O34 A;  4NR5 A;  5CQ7 A;  5A5Q A;  1JM4 B;  5DYA A;  5II1 A;  5I86 A;  3IU5 A;  2DAT A;  4XUA A;  5A81 A;  3P1C A;  4E96 A;  4O7F A;  4QYL A;  5CZG A;  5BT4 A;  4Q0N A;  5F63 A;  5ETB A;  4ZC9 A;  5AME A;  5KTU A;  4Z6H A;  4A9K A;  4PY6 A;  3D7C A;  4IR5 A;  4QSW A;  5FDZ A;  2N9G A;  5IGL A;  5CUG A;  2E7N A;  1N72 A;  5TCM A;  5C8G A;  5TB6 A;  4O72 A;  4J3I A;  4NR4 A;  4XYA A;  4A9I A;  5FE5 A;  2OUO A;  5CTL A;  5F25 A;  5BT5 A;  5I7Y A;  3SVH A;  5FFW A;  4MR5 A;  5LJ2 A;  4QEW A;  5EWC A;  5LJ0 A;  4A9H A;  4MR3 A;  2RNW A;  4NRA A;  4Y03 A;  3G0J A;  3JVM A;  4LYS A;  5E9I A;  3UVW A;  4QEU A;  5A83 A;  4NR7 A;  4HBX A;  5CY9 A;  2DVV A;  4NYX A;  5DBM A;  5FE7 A;  5EPS A;  4UIT A;  5D3J A;  4IOQ A;  5E74 A;  5FG6 A;  5KHM A;  2GRC A;  3AAD A;  4HXK A;  4J0R A;  4QSV A;  5ENC A;  5HFR A;  4YC9 A;  5HM0 A;  4QR3 A;  5H1U A;  4TT2 A;  2RS9 B;  2R0V A;  5F36 A;  4BW4 A;  2YYN A;  2L5E A;  2E3K A;  3ONI A;  4NUC A;  4A9M A;  5AMF A;  5EV9 A;  4ZW1 A;  3SVG A;  4PCE A;  4QSQ A;  4N4H A;  5HRX A;  5FE2 A;  4QEV A;  4QC1 A;  1F68 A;  5G4S A;  4NQN A;  1X0J A;  4TU4 A;  3P1F A;  3S92 A;  4NUD A;  4PTB A;  1WUM A;  4QNS A;  4BHW A;  5FBX A;  3LQI A;  3NXB A;  5I88 A;  4CUP A;  5E3G A;  5I1Q A;  5DYX A;  5F60 A;  3U5L A;  2DKW A;  4CUQ A;  4QZS A;  4LYI A;  4OGJ A;  5LKT A;  4BJX A;  5ENF A;  5EWH A;  4IR4 A;  5F5Z A;  2YW5 A;  4UYE A;  5E73 A;  2FSA A;  5EIC A;  2R0S A;  2RO1 A;  3MUL A;  4HXN A;  4TU6 A;  5CUD A;  1ZS5 A;  5CUA A;  4YYK A;  5DY7 A;  2G4A A;  5EWD A;  3IU6 A;  3S91 A;  2R0Y A;  4HXS A;  5CQ6 A;  4TZ2 A;  5IID A;  5JI8 A;  3UVD A;  4O70 A;  4HBY A;  5CS8 A;  4FLP A;  2DVR A;  4NYW A;  4F3I A;  4TT6 A;  5J0D A;  4N3W A;  2LSP B;  5FE8 A;  4XUB A;  4UYH A;  4IOO A;  3JVJ A;  4LZR A;  5E9V A;  5ENH A;  4KCX A;  5JWM A;  4UIW A;  2H60 A;  3MQM A;  1EQF A;  4QYD A;  4UIV A;  4YH3 A;  3ZYU A;  5HEL A;  5DKD A;  5DFD A;  3LQH A;  4CFK A;  5D3H A;  4UIZ A;  5CU8 A;  5FG4 A;  5D3P A;  5KO4 A;  4KV1 A;  4ALH A;  5HQ6 A;  5IGM A;  3QZT A;  3U5M A;  3UV2 A;  5EVA A;  5DLX A;  5DW2 A;  4NRC A;  5EPR A;  3UVY A;  5DX4 A;  2L85 A;  4A9J A;  4TS8 A;  4YYJ A;  4J1P A;  5CUC A;  3MB4 A;  4NXJ A;  4NQM A;  5EIS A;  5C7N A;  5E9M A;  4O71 A;  4TTE A;  4QY4 A;  5D25 A;  5E9Y A;  5C85 A;  5DW1 A;  5DYC A;  4YYG A;  5IGK A;  4NS5 A;  5A5O A;  5FE9 A;  5D3R A;  4QBM A;  2YDW A;  4MEO A;  4CUU A;  2E7O A;  5CQ5 A;  4NR8 A;  2DVS A;  3DAI A;  5LKU A;  5H85 A;  5FH6 A;  3G0L A;  5CRZ A;  4TT4 A;  5HRW A;  3HME A;  5E9K A;  5I40 A;  5C87 A;  5LJ1 A;  4WHU A;  5L99 A;  5EM3 A;  3HMH A;  5HFQ A;  5I80 A;  5CQ8 A;  4YY6 A;  5CUE A; 
#chains in the Genus database with same CATH topology
 5DLZ A;  4YYM A;  4UIY A;  4GPJ A;  4LDF A;  5FE3 A;  2OO1 A;  5COI A;  4UYF B;  3O35 A;  4HXL A;  4TZ8 A;  5DYU A;  4AKH A;  4HXM A;  5EA1 A;  5HRV A;  4CLB A;  5DFC A;  5HLS A;  2EJN A;  5C89 A;  3O33 A;  5I7X A;  1JSP B;  5C4Q A;  5KTX A;  4NR9 A;  4O7A A;  4IOR A;  4YBS A;  4Q0O A;  4CUT A;  5F1H A;  5FG5 A;  3U5O A;  5FH8 A;  4MEQ A;  5FB0 A;  4YYI A;  5CRM A;  5BT3 A;  4DON A;  3U5N A;  4X2I A;  4J0S A;  4QSX A;  5DKH A;  4YYH A;  4A9L A;  3UV5 A;  4O7E A;  4C66 A;  3QZS A;  4BW2 A;  2I7K A;  5L98 A;  3UVX A;  2R10 A;  3MUK A;  4LR6 A;  2RNX A;  5D24 A;  5HJC A;  4YYN A;  4QUT A;  5EI4 A;  5FB1 A;  4QSS A;  3O36 A;  5F61 A;  5I89 A;  5L8T A;  5CFW A;  5D3L A;  5L97 A;  2WP1 A;  3SVF A;  5HCL A;  4XY8 A;  3U5K A;  5CQT A;  4BW3 A;  4UIX A;  2D9E A;  4LRG A;  5E7D A;  4QSU A;  4CL9 A;  2F6J A;  5FE6 A;  4O76 A;  4MR6 A;  4O78 A;  4UIU A;  5DKC A;  2DVQ A;  5D0C A;  3K2J A;  3P5O A;  4MEP A;  5IGN A;  5LVR A;  5AD2 A;  5D7X A;  2RNY A;  4NUE A;  3UW9 A;  5I29 A;  5K29 A;  5FFY A;  3MXF A;  2RFJ A;  5EWW A;  4YK0 A;  5CP5 A;  4CUR A;  4KV4 A;  4PS5 A;  5F2P A;  5F3A A;  4O75 A;  2RI7 A;  4XY9 A;  4PKL A;  5CQA A;  4YH4 A;  5F62 A;  2I8N A;  3D1B A;  4HBW A;  5L8U A;  4O7C A;  5HEM A;  5EK9 A;  4UYD A;  3FKM X;  4QR5 A;  4YAT A;  4LC2 A;  5D3S A;  4O77 A;  3JVK A;  4OUF A;  5KU3 A;  3D1D A;  5FH7 A;  3LXJ A;  4IR6 A;  4IR3 A;  4WHW A;  3UV4 A;  4MEN A;  4BW1 A;  4NYV A;  4Z6I A;  4C67 A;  2NXB A;  5HQ5 A;  2WP2 A;  4A9O A;  2YEL A;  5A5R A;  5EPB A;  5EQ1 A;  3LJW A;  4A9N A;  5EWV A;  4PCI A;  4N4G A;  5H1T A;  2DWW A;  4Z1S A;  2MJV B;  3U5J A;  4QC3 A;  4YAX A;  4A9F A;  3I3J A;  4YAB A;  5AD3 A;  4ALG A;  3GG3 A;  5A85 A;  2KTB B;  4QSR A;  3JVL A;  4LZ2 A;  5LKZ A;  4HXO A;  4N4I A;  2YQD A;  4HXP A;  4UYG A;  3QZV A;  5A82 A;  4O7B A;  3AQA A;  4YY4 A;  5A5P A;  4YBM A;  4YBT A;  5ENB A;  5CQ3 A;  4CUS A;  4ZQL A;  5EU1 A;  3U5P A;  5EP7 A;  4LZS A;  5CUB A;  2L84 A;  5LKX A;  4LYW A;  5ACY A;  4AKI A;  4HBV A;  5EGU A;  4HXR A;  5LVQ A;  5DFB A;  5KTW A;  5A5S A;  5II2 A;  4QUU A;  2D82 A;  5FE0 A;  5FE4 A;  2OSS A;  4TYL A;  3HMF A;  3P1D A;  5IBN A;  4Z93 A;  5D26 A;  5D3T A;  4CFL A;  4QST A;  4TQN A;  4A9E A;  5G4R A;  5HEN A;  4Z1Q A;  2YEM A;  3Q2F A;  4NRB A;  3O37 A;  5FFV A;  3RCW A;  5E0R A;  5A5N A;  5I83 A;  4UYF A;  5E3D A;  5CGP A;  1E6I A;  4MR4 A;  5ENE A;  3DWY A;  4QR4 A;  4QB3 A;  5ENJ A;  1WUG A;  5ETD A;  4AKG A;  5ENG A;  2F6N A;  3TLP A;  5H1V A;  4OGI A;  4YAD A;  5F1L A;  5A7C A;  5ENI A;  5FE1 A;  5IG6 A;  4QSP A;  4YYD A;  5CQ4 A;  3P1E A;  3MB3 A;  5CPE A;  3LQJ A;  3Q2E A;  5LUU A;  4AKN A;  2YEK A;  4O74 A;  4N4F A;  4WIV A;  5D3N A;  4NR6 A;  5E9L A;  4RVR A;  5HQ7 A;  5L96 A;  3O34 A;  4NR5 A;  3VKH A;  5CQ7 A;  5A5Q A;  1JM4 B;  5DYA A;  5II1 A;  5I86 A;  3IU5 A;  2DAT A;  4XUA A;  5A81 A;  3P1C A;  4E96 A;  4O7F A;  4QYL A;  5CZG A;  5BT4 A;  4Q0N A;  5F63 A;  5ETB A;  4ZC9 A;  5AME A;  5KTU A;  4Z6H A;  4A9K A;  4PY6 A;  3D7C A;  4IR5 A;  4QSW A;  5FDZ A;  2N9G A;  5IGL A;  5CUG A;  2E7N A;  1N72 A;  5TCM A;  5C8G A;  5TB6 A;  4O72 A;  4J3I A;  4NR4 A;  4XYA A;  4A9I A;  5FE5 A;  2OUO A;  5CTL A;  5F25 A;  5BT5 A;  5I7Y A;  3SVH A;  5FFW A;  4MR5 A;  5LJ2 A;  4QEW A;  5EWC A;  5LJ0 A;  4A9H A;  4MR3 A;  2RNW A;  4NRA A;  4Y03 A;  3G0J A;  3JVM A;  4LYS A;  5E9I A;  3UVW A;  4QEU A;  5A83 A;  4NR7 A;  4HBX A;  5CY9 A;  2DVV A;  4NYX A;  5DBM A;  5FE7 A;  5EPS A;  4UIT A;  5D3J A;  4IOQ A;  5E74 A;  5FG6 A;  5KHM A;  2GRC A;  3AAD A;  4HXK A;  4J0R A;  4QSV A;  5ENC A;  5HFR A;  4YC9 A;  5HM0 A;  4QR3 A;  5H1U A;  4TT2 A;  2RS9 B;  2R0V A;  5F36 A;  4BW4 A;  2YYN A;  2L5E A;  2E3K A;  3ONI A;  4NUC A;  4A9M A;  5AMF A;  5EV9 A;  1ZKR A;  4ZW1 A;  3SVG A;  4PCE A;  4QSQ A;  4N4H A;  5HRX A;  5FE2 A;  4QEV A;  4QC1 A;  1F68 A;  5G4S A;  4NQN A;  1X0J A;  4TU4 A;  3P1F A;  3S92 A;  4NUD A;  4PTB A;  1WUM A;  4QNS A;  4BHW A;  5FBX A;  3LQI A;  3NXB A;  5I88 A;  4CUP A;  5E3G A;  5I1Q A;  5DYX A;  5F60 A;  3U5L A;  2DKW A;  4CUQ A;  4QZS A;  4LYI A;  4OGJ A;  5LKT A;  4BJX A;  5ENF A;  5EWH A;  4IR4 A;  5F5Z A;  2YW5 A;  4UYE A;  5E73 A;  1PUO A;  2FSA A;  5EIC A;  2R0S A;  2RO1 A;  3MUL A;  4HXN A;  4TU6 A;  5CUD A;  1ZS5 A;  5CUA A;  4YYK A;  5DY7 A;  2G4A A;  5EWD A;  3IU6 A;  3S91 A;  2R0Y A;  4HXS A;  5CQ6 A;  4TZ2 A;  5IID A;  5JI8 A;  3UVD A;  4O70 A;  4HBY A;  5CS8 A;  4FLP A;  2DVR A;  3VKG A;  4NYW A;  4F3I A;  4TT6 A;  5J0D A;  4N3W A;  2LSP B;  5FE8 A;  4XUB A;  4UYH A;  4IOO A;  3JVJ A;  4LZR A;  5E9V A;  5ENH A;  4KCX A;  5JWM A;  4UIW A;  2H60 A;  3MQM A;  1EQF A;  4QYD A;  4UIV A;  4YH3 A;  3ZYU A;  5HEL A;  5DKD A;  5DFD A;  3LQH A;  4CFK A;  5D3H A;  4UIZ A;  5CU8 A;  5FG4 A;  5D3P A;  5KO4 A;  4KV1 A;  4ALH A;  5HQ6 A;  5IGM A;  3QZT A;  3U5M A;  3UV2 A;  5EVA A;  3ERR A;  5DLX A;  5DW2 A;  4NRC A;  5EPR A;  3UVY A;  5DX4 A;  2L85 A;  4A9J A;  4TS8 A;  4YYJ A;  4J1P A;  5CUC A;  3MB4 A;  4NXJ A;  4NQM A;  5EIS A;  5C7N A;  5E9M A;  4O71 A;  4TTE A;  4QY4 A;  5D25 A;  5E9Y A;  5C85 A;  5DW1 A;  5DYC A;  4YYG A;  5IGK A;  4NS5 A;  5A5O A;  5FE9 A;  5D3R A;  4QBM A;  2YDW A;  4MEO A;  4CUU A;  2E7O A;  5CQ5 A;  4NR8 A;  2DVS A;  3DAI A;  5LKU A;  5H85 A;  5FH6 A;  3G0L A;  5CRZ A;  4TT4 A;  5HRW A;  3HME A;  5E9K A;  5I40 A;  5C87 A;  5LJ1 A;  4WHU A;  5L99 A;  5EM3 A;  3HMH A;  5HFQ A;  5I80 A;  5CQ8 A;  4YY6 A;  4AI6 A;  5CUE A; 
#chains in the Genus database with same CATH homology
 5DLZ A;  4YYM A;  4UIY A;  4GPJ A;  4LDF A;  5FE3 A;  2OO1 A;  5COI A;  4UYF B;  3O35 A;  4HXL A;  4TZ8 A;  5DYU A;  4HXM A;  5EA1 A;  5HRV A;  4CLB A;  5DFC A;  5HLS A;  5C89 A;  3O33 A;  5I7X A;  1JSP B;  5C4Q A;  5KTX A;  4NR9 A;  4O7A A;  4IOR A;  4YBS A;  4Q0O A;  4CUT A;  5F1H A;  5FG5 A;  3U5O A;  5FH8 A;  4MEQ A;  5FB0 A;  4YYI A;  5CRM A;  5BT3 A;  4DON A;  3U5N A;  4X2I A;  4J0S A;  4QSX A;  5DKH A;  4YYH A;  4A9L A;  3UV5 A;  4O7E A;  4C66 A;  3QZS A;  4BW2 A;  2I7K A;  5L98 A;  3UVX A;  2R10 A;  3MUK A;  4LR6 A;  2RNX A;  5D24 A;  5HJC A;  4YYN A;  4QUT A;  5EI4 A;  5FB1 A;  4QSS A;  3O36 A;  5F61 A;  5I89 A;  5L8T A;  5CFW A;  5D3L A;  5L97 A;  2WP1 A;  3SVF A;  5HCL A;  4XY8 A;  3U5K A;  5CQT A;  4BW3 A;  4UIX A;  2D9E A;  4LRG A;  5E7D A;  4QSU A;  4CL9 A;  2F6J A;  5FE6 A;  4O76 A;  4MR6 A;  4O78 A;  4UIU A;  5DKC A;  2DVQ A;  5D0C A;  3K2J A;  3P5O A;  4MEP A;  5IGN A;  5LVR A;  5AD2 A;  5D7X A;  2RNY A;  4NUE A;  3UW9 A;  5I29 A;  5K29 A;  5FFY A;  3MXF A;  2RFJ A;  5EWW A;  4YK0 A;  5CP5 A;  4CUR A;  4KV4 A;  4PS5 A;  5F2P A;  5F3A A;  4O75 A;  2RI7 A;  4XY9 A;  4PKL A;  5CQA A;  4YH4 A;  5F62 A;  2I8N A;  4HBW A;  5L8U A;  4O7C A;  5HEM A;  5EK9 A;  4UYD A;  3FKM X;  4QR5 A;  4YAT A;  4LC2 A;  5D3S A;  4O77 A;  3JVK A;  4OUF A;  5KU3 A;  5FH7 A;  3LXJ A;  4IR6 A;  4IR3 A;  4WHW A;  3UV4 A;  4MEN A;  4BW1 A;  4NYV A;  4Z6I A;  4C67 A;  2NXB A;  5HQ5 A;  2WP2 A;  4A9O A;  2YEL A;  5A5R A;  5EPB A;  5EQ1 A;  3LJW A;  4A9N A;  5EWV A;  4PCI A;  4N4G A;  5H1T A;  2DWW A;  4Z1S A;  2MJV B;  3U5J A;  4QC3 A;  4YAX A;  4A9F A;  3I3J A;  4YAB A;  5AD3 A;  4ALG A;  3GG3 A;  5A85 A;  2KTB B;  4QSR A;  3JVL A;  4LZ2 A;  5LKZ A;  4HXO A;  4N4I A;  2YQD A;  4HXP A;  4UYG A;  3QZV A;  5A82 A;  4O7B A;  3AQA A;  4YY4 A;  5A5P A;  4YBM A;  4YBT A;  5ENB A;  5CQ3 A;  4CUS A;  4ZQL A;  5EU1 A;  3U5P A;  5EP7 A;  4LZS A;  5CUB A;  2L84 A;  5LKX A;  4LYW A;  5ACY A;  4HBV A;  5EGU A;  4HXR A;  5LVQ A;  5DFB A;  5KTW A;  5A5S A;  5II2 A;  4QUU A;  2D82 A;  5FE0 A;  5FE4 A;  2OSS A;  4TYL A;  3HMF A;  3P1D A;  5IBN A;  4Z93 A;  5D26 A;  5D3T A;  4CFL A;  4QST A;  4TQN A;  4A9E A;  5G4R A;  5HEN A;  4Z1Q A;  2YEM A;  3Q2F A;  4NRB A;  3O37 A;  5FFV A;  3RCW A;  5E0R A;  5A5N A;  5I83 A;  4UYF A;  5E3D A;  5CGP A;  1E6I A;  4MR4 A;  5ENE A;  3DWY A;  4QR4 A;  4QB3 A;  5ENJ A;  1WUG A;  5ETD A;  5ENG A;  2F6N A;  3TLP A;  5H1V A;  4OGI A;  4YAD A;  5F1L A;  5A7C A;  5ENI A;  5FE1 A;  5IG6 A;  4QSP A;  4YYD A;  5CQ4 A;  3P1E A;  3MB3 A;  5CPE A;  3LQJ A;  3Q2E A;  5LUU A;  4AKN A;  2YEK A;  4O74 A;  4N4F A;  4WIV A;  5D3N A;  4NR6 A;  5E9L A;  4RVR A;  5HQ7 A;  5L96 A;  3O34 A;  4NR5 A;  5CQ7 A;  5A5Q A;  1JM4 B;  5DYA A;  5II1 A;  5I86 A;  3IU5 A;  2DAT A;  4XUA A;  5A81 A;  3P1C A;  4E96 A;  4O7F A;  4QYL A;  5CZG A;  5BT4 A;  4Q0N A;  5F63 A;  5ETB A;  4ZC9 A;  5AME A;  5KTU A;  4Z6H A;  4A9K A;  4PY6 A;  3D7C A;  4IR5 A;  4QSW A;  5FDZ A;  2N9G A;  5IGL A;  5CUG A;  2E7N A;  1N72 A;  5TCM A;  5C8G A;  5TB6 A;  4O72 A;  4J3I A;  4NR4 A;  4XYA A;  4A9I A;  5FE5 A;  2OUO A;  5CTL A;  5F25 A;  5BT5 A;  5I7Y A;  3SVH A;  5FFW A;  4MR5 A;  5LJ2 A;  4QEW A;  5EWC A;  5LJ0 A;  4A9H A;  4MR3 A;  2RNW A;  4NRA A;  4Y03 A;  3G0J A;  3JVM A;  4LYS A;  5E9I A;  3UVW A;  4QEU A;  5A83 A;  4NR7 A;  4HBX A;  5CY9 A;  2DVV A;  4NYX A;  5DBM A;  5FE7 A;  5EPS A;  4UIT A;  5D3J A;  4IOQ A;  5E74 A;  5FG6 A;  5KHM A;  2GRC A;  3AAD A;  4HXK A;  4J0R A;  4QSV A;  5ENC A;  5HFR A;  4YC9 A;  5HM0 A;  4QR3 A;  5H1U A;  4TT2 A;  2RS9 B;  2R0V A;  5F36 A;  4BW4 A;  2YYN A;  2L5E A;  2E3K A;  3ONI A;  4NUC A;  4A9M A;  5AMF A;  5EV9 A;  4ZW1 A;  3SVG A;  4PCE A;  4QSQ A;  4N4H A;  5HRX A;  5FE2 A;  4QEV A;  4QC1 A;  1F68 A;  5G4S A;  4NQN A;  1X0J A;  4TU4 A;  3P1F A;  3S92 A;  4NUD A;  4PTB A;  1WUM A;  4QNS A;  4BHW A;  5FBX A;  3LQI A;  3NXB A;  5I88 A;  4CUP A;  5E3G A;  5I1Q A;  5DYX A;  5F60 A;  3U5L A;  2DKW A;  4CUQ A;  4QZS A;  4LYI A;  4OGJ A;  5LKT A;  4BJX A;  5ENF A;  5EWH A;  4IR4 A;  5F5Z A;  2YW5 A;  4UYE A;  5E73 A;  2FSA A;  5EIC A;  2R0S A;  2RO1 A;  3MUL A;  4HXN A;  4TU6 A;  5CUD A;  1ZS5 A;  5CUA A;  4YYK A;  5DY7 A;  2G4A A;  5EWD A;  3IU6 A;  3S91 A;  2R0Y A;  4HXS A;  5CQ6 A;  4TZ2 A;  5IID A;  5JI8 A;  3UVD A;  4O70 A;  4HBY A;  5CS8 A;  4FLP A;  2DVR A;  4NYW A;  4F3I A;  4TT6 A;  5J0D A;  4N3W A;  2LSP B;  5FE8 A;  4XUB A;  4UYH A;  4IOO A;  3JVJ A;  4LZR A;  5E9V A;  5ENH A;  4KCX A;  5JWM A;  4UIW A;  2H60 A;  3MQM A;  1EQF A;  4QYD A;  4UIV A;  4YH3 A;  3ZYU A;  5HEL A;  5DKD A;  5DFD A;  3LQH A;  4CFK A;  5D3H A;  4UIZ A;  5CU8 A;  5FG4 A;  5D3P A;  5KO4 A;  4KV1 A;  4ALH A;  5HQ6 A;  5IGM A;  3QZT A;  3U5M A;  3UV2 A;  5EVA A;  5DLX A;  5DW2 A;  4NRC A;  5EPR A;  3UVY A;  5DX4 A;  2L85 A;  4A9J A;  4TS8 A;  4YYJ A;  4J1P A;  5CUC A;  3MB4 A;  4NXJ A;  4NQM A;  5EIS A;  5C7N A;  5E9M A;  4O71 A;  4TTE A;  4QY4 A;  5D25 A;  5E9Y A;  5C85 A;  5DW1 A;  5DYC A;  4YYG A;  5IGK A;  4NS5 A;  5A5O A;  5FE9 A;  5D3R A;  4QBM A;  2YDW A;  4MEO A;  4CUU A;  2E7O A;  5CQ5 A;  4NR8 A;  2DVS A;  3DAI A;  5LKU A;  5H85 A;  5FH6 A;  3G0L A;  5CRZ A;  4TT4 A;  5HRW A;  3HME A;  5E9K A;  5I40 A;  5C87 A;  5LJ1 A;  4WHU A;  5L99 A;  5EM3 A;  3HMH A;  5HFQ A;  5I80 A;  5CQ8 A;  4YY6 A;  5CUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...