4Z1SA

Crystal structure of the first bromodomain of human brd4 with benzotriazolo-diazepine scaffold
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzotriazolo[4,3-d][1,4]diazepines as Orally Active Inhibitors of BET Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z1sA01
4Z6HA 3P5OA 3O33A 3HMHA 4LZ2A 3MUKA 3SVGA 5C4QA 5IIDA 5HEMA 4NR9A 3QZTA 5E3DA 4QC3A 4UIZA 5KTUA 2DKWA 2D9EA 5ENHA 4HXSA 4BJXA 5L99A 4ZQLA 2KTBB 5F1HA 2F6NA 4BW2A 5C89A 2E3KA 3K2JA 5CFWA 5LVQA 5FE6A 4QSRA 3JVKA 4O7BA 4LC2A 2F6JA 5D3NA 4QR5A 4N4IA 4Z1QA 5HLSA 5E9KA 4QEUA 2G4AA 4NR7A 5A5NA 4CUQA 4MEOA 2YEKA 4CL9A 5EI4A 4YBSA 5AD3A 5DY7A 5DYAA 4LDFA 2RS9B 4QYDA 4Z1SA 4O72A 5L8TA 3P1EA 4YK0A 5A5RA 5CQ4A 2L84A 4O7FA 4J0RA 4QSPA 5F25A 5CQ5A 5IGNA 5ACYA 4AKNA 4F3IA 3JVJA 3UW9A 5D0CA 3AQAA 5E9VA 1EQFA 2FSAA 3TLPA 5I40A 4HXNA 3G0JA 5FH8A 4QSSA 3Q2EA 4ZC9A 1WUMA 5LKZA 2WP2A 5EWDA 4NUEA 4MEPA 4TZ2A 5KHMA 2WP1A 5CGPA 5F1LA 4J3IA 5HJCA 3P1FA 5D3LA 4YH4A 4ALHA 4YADA 4A9NA 4LYWA 5K29A 5EWCA 5ENEA 5IGLA 5KTWA 4IR4A 5FE4A 2DWWA 4UYHA 3ONIA 4HXKA 5FBXA 3HMFA 3LQJA 5I7XA 4QUTA 5DW2A 4YYKA 5CU8A 5EPBA 4UYEA 4YYNA 4TU6A 4A9MA 2D82A 1F68A 5DLZA 2H60A 4IOOA 5EK9A 2RO1A 4IR6A 1N72A 4IR5A 4A9IA 5ETDA 5BT5A 5EISA 5DYXA 5DFCA 5D24A 2RNWA 5FE1A 5D26A 4QBMA 3GG3A 3UV5A 3MXFA 4NXJA 4MR6A 5AMEA 4PS5A 4QC1A 2R0VA 5DFBA 4TYLA 5A7CA 3QZSA 5E0RA 4UIXA 5L96A 5DFDA 5DKHA 5II2A 5CRMA 4A9HA 3UV4A 5F36A 5A83A 5ENJA 5BT3A 5DKCA 5CZGA 4PCEA 5CQAA 4XUAA 4YH3A 2YEMA 4XY8A 2LSPB 5EM3A 5EWVA 5FB1A 4ALGA 4BW3A 2I7KA 3UVWA 4QR3A 3MB4A 3JVMA 5D3SA 4RVRA 3SVHA 2R10A 2RNXA 3FKMX 5CUDA 4O7EA 1E6IA 3MQMA 4WHWA 2YW5A 2GRCA 4QB3A 4IOQA 5CQ6A 5DW1A 3SVFA 1X0JA 4A9EA 4O76A 5CRZA 5FDZA 2DATA 5KU3A 5G4RA 4Z93A 5EA1A 4YYIA 5CS8A 4TZ8A 4LYIA 5CUBA 4FLPA 4HXOA 4PTBA 5FE8A 4CFKA 5I29A 5FG4A 5G4SA 3U5PA 5A82A 3QZVA 5KTXA 5E3GA 5E7DA 3LQHA 5E9YA 5II1A 4HBYA 5IBNA 4O75A 3UVDA 3NXBA 5F62A 5CUCA 5HFRA 4QNSA 5I88A 4KCXA 4N4FA 4QR4A 5DX4A 2I8NA 4UIWA 5D3PA 3U5LA 4X2IA 4PKLA 5ENGA 4UYFB 5FB0A 3RCWA 4O71A 5A81A 4YY4A 4YATA 5E9MA 5D7XA 4TU4A 4NRBA 4HBXA 3JVLA 2YDWA 4QZSA 5F3AA 5LJ0A 2L5EA 5EICA 5I7YA 5IG6A 3UVYA 5C8GA 3UVXA 4NR4A 4YYMA 5F2PA 3I3JA 4HXMA 4LZSA 5CUGA 5FFVA 2YELA 5AMFA 5L8UA 3P1DA 5HM0A 4O78A 4YABA 4NQMA 4UIVA 4HXPA 5A5SA 4HXLA 3LXJA 5EQ1A 3U5KA 4NQNA 2DVSA 5CQTA 4NYVA 5H1TA 3LQIA 5FG5A 3D7CA 5CPEA 2DVQA 4NUDA 4QY4A 4O7CA 5IGKA 2DVRA 4XYAA 5D3HA 5D3RA 4BW4A 5E73A 1WUGA 4IR3A 4TQNA 5LKXA 1ZS5A 5HRWA 2YQDA 4XUBA 5D25A 2L85A 5C85A 4NR6A 4QUUA 4O7AA 3MULA 4OUFA 5TCMA 5E9IA 4KV1A 5ENIA 4BHWA 4BW1A 5EGUA 5E9LA 4Q0OA 5IGMA 5E74A 5EWHA 3UV2A 4YYGA 3O35A 5TB6A 3IU6A 4A9KA 2RNYA 5FE7A 5I83A 4CLBA 4QSWA 5L97A 5LUUA 4MR3A 4QSTA 5LVRA 5F60A 4N3WA 4CFLA 5EU1A 4UYDA 4E96A 5FE0A 5ENCA 4PCIA 5CQ7A 4YY6A 2DVVA 2E7OA 2R0SA 5L98A 4N4HA 4WIVA 4CUTA 2OUOA 5EWWA 4N4GA 5DBMA 4QEWA 2RI7A 4UIUA 5COIA 4HBWA 5DLXA 3ZYUA 5ENFA 4QYLA 5I80A 4NUCA 5HQ5A 4QSVA 4YYJA 5FE5A 4Q0NA 4A9JA 5LKUA 4TT6A 3O37A 4GPJA 5FFYA 5LJ2A 4MR4A 5DYCA 5I1QA 2RFJA 5H1VA 3DWYA 4YYHA 5JWMA 4OGJA 4NYXA 4C66A 5A85A 4TT4A 5F63A 3O36A 4MR5A 5EP7A 3Q2FA 5HRXA 5ETBA 2N9GA 5EPSA 3U5JA 3HMEA 4CUSA 4HBVA 5CQ3A 3LJWA 5CUAA 4UITA 5C87A 5D3TA 5D3JA 4TTEA 4YYDA 4XY9A 5F5ZA 5C7NA 4LYSA 4HXRA 4CUUA 5CQ8A 5LKTA 5FE9A 4KV4A 5FG6A 4NRCA 5AD2A 5A5OA 5H1UA 2OSSA 5FFWA 1JSPB 4TS8A 4UYGA 2NXBA 5H85A 4IORA 4O70A 4TT2A 5HCLA 5I86A 3S91A 4Y03A 4DONA 4NR5A 5ENBA 4UIYA 5CUEA 5DYUA 5EVAA 4QSUA 5FH6A 2OO1A 5CP5A 4NS5A 3IU5A 4LR6A 2MJVB 3U5MA 4YBMA 5KO4A 4Z6IA 4UYFA 5FH7A 5HQ7A 4PY6A 4O77A 5HFQA 4A9LA 2YYNA 5CTLA 4MENA 4J0SA 5A5QA 5HELA 4MEQA 3MB3A 3G0LA 3AADA 4NRAA 5BT4A 5JI8A 4CURA 5HRVA 5J0DA 5EV9A 3U5NA 3U5OA 5HENA 4A9OA 5A5PA 5DKDA 4QSQA 4LZRA 5FE3A 4ZW1A 4YAXA 4QEVA 5LJ1A 5HQ6A 2E7NA 3P1CA 4A9FA 1JM4B 4NR8A 3DAIA 4O74A 2R0YA 3O34A 4QSXA 4WHUA 4C67A 4OGIA 5I89A 4LRGA 4YC9A 4CUPA 4NYWA 5F61A 5FE2A 5CY9A 5EPRA 3S92A 4J1PA 4YBTA
chains in the Genus database with same CATH superfamily
4Z6HA 3P5OA 3O33A 3HMHA 4LZ2A 3MUKA 3SVGA 5C4QA 5IIDA 5HEMA 4NR9A 3QZTA 5E3DA 4QC3A 4UIZA 5KTUA 2DKWA 2D9EA 5ENHA 4HXSA 4BJXA 5L99A 4ZQLA 2KTBB 5F1HA 2F6NA 4BW2A 5C89A 2E3KA 3K2JA 5CFWA 5LVQA 5FE6A 4QSRA 3JVKA 4O7BA 4LC2A 2F6JA 5D3NA 4QR5A 4N4IA 4Z1QA 5HLSA 5E9KA 4QEUA 2G4AA 4NR7A 5A5NA 4CUQA 4MEOA 2YEKA 4CL9A 5EI4A 4YBSA 5AD3A 5DY7A 5DYAA 4LDFA 2RS9B 4QYDA 4Z1SA 4O72A 5L8TA 3P1EA 4YK0A 5A5RA 5CQ4A 2L84A 4O7FA 4J0RA 4QSPA 5F25A 5CQ5A 5IGNA 5ACYA 4AKNA 4F3IA 3JVJA 3UW9A 5D0CA 3AQAA 5E9VA 1EQFA 2FSAA 3TLPA 5I40A 4HXNA 3G0JA 5FH8A 4QSSA 3Q2EA 4ZC9A 1WUMA 5LKZA 2WP2A 5EWDA 4NUEA 4MEPA 4TZ2A 5KHMA 2WP1A 5CGPA 5F1LA 4J3IA 5HJCA 3P1FA 5D3LA 4AI6A 4YH4A 4ALHA 4YADA 4A9NA 4LYWA 5K29A 5EWCA 5ENEA 5IGLA 5KTWA 4IR4A 5FE4A 2DWWA 4UYHA 3ONIA 4HXKA 3D1BA 5FBXA 3HMFA 3LQJA 5I7XA 4QUTA 5DW2A 4YYKA 5CU8A 5EPBA 4AKIA 4UYEA 4YYNA 4TU6A 4A9MA 2D82A 1F68A 5DLZA 2H60A 4IOOA 5EK9A 2RO1A 4IR6A 1N72A 4IR5A 4A9IA 5ETDA 5BT5A 5EISA 5DYXA 5DFCA 5D24A 2RNWA 5FE1A 5D26A 4QBMA 3GG3A 3UV5A 3MXFA 4NXJA 4MR6A 5AMEA 4PS5A 4QC1A 2R0VA 5DFBA 4TYLA 5A7CA 3QZSA 5E0RA 4UIXA 5L96A 5DFDA 5DKHA 5II2A 5CRMA 4A9HA 3UV4A 5F36A 5A83A 5ENJA 5BT3A 5DKCA 5CZGA 4PCEA 5CQAA 4XUAA 4YH3A 2YEMA 4XY8A 2LSPB 5EM3A 5EWVA 5FB1A 4ALGA 4BW3A 2I7KA 3UVWA 4QR3A 3MB4A 3JVMA 5D3SA 1PUOA 4RVRA 3SVHA 2R10A 2RNXA 3FKMX 5CUDA 4O7EA 1E6IA 3MQMA 4WHWA 2YW5A 2GRCA 4QB3A 4IOQA 5CQ6A 5DW1A 3SVFA 1X0JA 4A9EA 4O76A 5CRZA 5FDZA 2DATA 5KU3A 5G4RA 4Z93A 5EA1A 4YYIA 5CS8A 4TZ8A 4LYIA 5CUBA 4FLPA 4HXOA 4PTBA 5FE8A 4CFKA 5I29A 5FG4A 5G4SA 3U5PA 5A82A 3QZVA 5KTXA 5E3GA 5E7DA 3LQHA 5E9YA 5II1A 4HBYA 5IBNA 4O75A 3UVDA 3NXBA 5F62A 5CUCA 5HFRA 4QNSA 5I88A 4KCXA 4N4FA 4QR4A 5DX4A 2I8NA 4UIWA 5D3PA 3U5LA 4X2IA 4PKLA 5ENGA 4UYFB 5FB0A 3RCWA 4O71A 5A81A 4YY4A 4YATA 5E9MA 5D7XA 4TU4A 4NRBA 4HBXA 3JVLA 2YDWA 4QZSA 5F3AA 5LJ0A 2L5EA 5EICA 5I7YA 5IG6A 3UVYA 5C8GA 3UVXA 4NR4A 4YYMA 5F2PA 3I3JA 4HXMA 4LZSA 5CUGA 5FFVA 2YELA 5AMFA 5L8UA 3P1DA 5HM0A 4O78A 4YABA 4NQMA 4UIVA 4HXPA 5A5SA 4HXLA 3LXJA 5EQ1A 3U5KA 4NQNA 2DVSA 5CQTA 4NYVA 5H1TA 3LQIA 5FG5A 3VKHA 3D7CA 5CPEA 2DVQA 4NUDA 4QY4A 4O7CA 5IGKA 2DVRA 4XYAA 5D3HA 5D3RA 4BW4A 5E73A 1WUGA 4IR3A 4TQNA 5LKXA 1ZS5A 5HRWA 2YQDA 4XUBA 5D25A 2L85A 5C85A 4NR6A 4QUUA 4O7AA 3MULA 4OUFA 3VKGA 5TCMA 5E9IA 4KV1A 5ENIA 4BHWA 4BW1A 5EGUA 5E9LA 4Q0OA 5IGMA 5E74A 5EWHA 3UV2A 4YYGA 3O35A 5TB6A 3IU6A 4A9KA 2RNYA 5FE7A 5I83A 4CLBA 4QSWA 5L97A 5LUUA 4MR3A 4QSTA 5LVRA 5F60A 4N3WA 4CFLA 5EU1A 4UYDA 4E96A 5FE0A 5ENCA 4PCIA 2EJNA 5CQ7A 4YY6A 2E7OA 2R0SA 2DVVA 5L98A 4N4HA 4WIVA 4CUTA 2OUOA 5EWWA 4N4GA 5DBMA 4QEWA 2RI7A 4UIUA 5COIA 4HBWA 5DLXA 3ZYUA 5ENFA 4QYLA 5I80A 4NUCA 5HQ5A 4QSVA 4YYJA 5FE5A 4Q0NA 4A9JA 5LKUA 4TT6A 3O37A 4GPJA 5FFYA 5LJ2A 4MR4A 5DYCA 5I1QA 4AKGA 2RFJA 5H1VA 3DWYA 4YYHA 5JWMA 4OGJA 4NYXA 4C66A 5A85A 4TT4A 5F63A 3O36A 4MR5A 5EP7A 3Q2FA 5HRXA 5ETBA 2N9GA 5EPSA 3U5JA 3HMEA 4CUSA 4HBVA 5CQ3A 3LJWA 5CUAA 4UITA 5C87A 5D3TA 5D3JA 4TTEA 4YYDA 4XY9A 5F5ZA 5C7NA 4LYSA 4HXRA 4CUUA 5CQ8A 5LKTA 5FE9A 4KV4A 5FG6A 4NRCA 5AD2A 5A5OA 5H1UA 2OSSA 5FFWA 1JSPB 4TS8A 4UYGA 2NXBA 5H85A 4IORA 4AKHA 4O70A 4TT2A 5HCLA 5I86A 3S91A 4Y03A 4DONA 4NR5A 5ENBA 4UIYA 5CUEA 5DYUA 3ERRA 5EVAA 4QSUA 5FH6A 2OO1A 5CP5A 4NS5A 3IU5A 4LR6A 2MJVB 3U5MA 4YBMA 5KO4A 4Z6IA 4UYFA 5FH7A 5HQ7A 4PY6A 4O77A 5HFQA 4A9LA 2YYNA 5CTLA 4MENA 4J0SA 3D1DA 5A5QA 5HELA 4MEQA 3MB3A 3G0LA 3AADA 4NRAA 5BT4A 5JI8A 4CURA 5HRVA 5J0DA 5EV9A 3U5NA 3U5OA 5HENA 4A9OA 5A5PA 5DKDA 4QSQA 4LZRA 5FE3A 4ZW1A 4YAXA 4QEVA 5LJ1A 5HQ6A 2E7NA 3P1CA 4A9FA 1JM4B 4NR8A 3DAIA 4O74A 2R0YA 3O34A 4QSXA 4WHUA 4C67A 4OGIA 5I89A 4LRGA 4YC9A 4CUPA 4NYWA 5F61A 5FE2A 5CY9A 5EPRA 3S92A 4J1PA 4YBTA 1ZKRA
chains in the Genus database with same CATH topology
4Z6HA 3P5OA 3O33A 3HMHA 4LZ2A 3MUKA 3SVGA 5C4QA 5IIDA 5HEMA 4NR9A 3QZTA 5E3DA 4QC3A 4UIZA 5KTUA 2DKWA 2D9EA 5ENHA 4HXSA 4BJXA 5L99A 4ZQLA 2KTBB 5F1HA 2F6NA 4BW2A 5C89A 2E3KA 3K2JA 5CFWA 5LVQA 5FE6A 4QSRA 3JVKA 4O7BA 4LC2A 2F6JA 5D3NA 4QR5A 4N4IA 4Z1QA 5HLSA 5E9KA 4QEUA 2G4AA 4NR7A 5A5NA 4CUQA 4MEOA 2YEKA 4CL9A 5EI4A 4YBSA 5AD3A 5DY7A 5DYAA 4LDFA 2RS9B 4QYDA 4Z1SA 4O72A 5L8TA 3P1EA 4YK0A 5A5RA 5CQ4A 2L84A 4O7FA 4J0RA 4QSPA 5F25A 5CQ5A 5IGNA 5ACYA 4AKNA 4F3IA 3JVJA 3UW9A 5D0CA 3AQAA 5E9VA 1EQFA 2FSAA 3TLPA 5I40A 4HXNA 3G0JA 5FH8A 4QSSA 3Q2EA 4ZC9A 1WUMA 5LKZA 2WP2A 5EWDA 4NUEA 4MEPA 4TZ2A 5KHMA 2WP1A 5CGPA 5F1LA 4J3IA 5HJCA 3P1FA 5D3LA 4YH4A 4ALHA 4YADA 4A9NA 4LYWA 5K29A 5EWCA 5ENEA 5IGLA 5KTWA 4IR4A 5FE4A 2DWWA 4UYHA 3ONIA 4HXKA 5FBXA 3HMFA 3LQJA 5I7XA 4QUTA 5DW2A 4YYKA 5CU8A 5EPBA 4UYEA 4YYNA 4TU6A 4A9MA 2D82A 1F68A 5DLZA 2H60A 4IOOA 5EK9A 2RO1A 4IR6A 1N72A 4IR5A 4A9IA 5ETDA 5BT5A 5EISA 5DYXA 5DFCA 5D24A 2RNWA 5FE1A 5D26A 4QBMA 3GG3A 3UV5A 3MXFA 4NXJA 4MR6A 5AMEA 4PS5A 4QC1A 2R0VA 5DFBA 4TYLA 5A7CA 3QZSA 5E0RA 4UIXA 5L96A 5DFDA 5DKHA 5II2A 5CRMA 4A9HA 3UV4A 5F36A 5A83A 5ENJA 5BT3A 5DKCA 5CZGA 4PCEA 5CQAA 4XUAA 4YH3A 2YEMA 4XY8A 2LSPB 5EM3A 5EWVA 5FB1A 4ALGA 4BW3A 2I7KA 3UVWA 4QR3A 3MB4A 3JVMA 5D3SA 4RVRA 3SVHA 2R10A 2RNXA 3FKMX 5CUDA 4O7EA 1E6IA 3MQMA 4WHWA 2YW5A 2GRCA 4QB3A 4IOQA 5CQ6A 5DW1A 3SVFA 1X0JA 4A9EA 4O76A 5CRZA 5FDZA 2DATA 5KU3A 5G4RA 4Z93A 5EA1A 4YYIA 5CS8A 4TZ8A 4LYIA 5CUBA 4FLPA 4HXOA 4PTBA 5FE8A 4CFKA 5I29A 5FG4A 5G4SA 3U5PA 5A82A 3QZVA 5KTXA 5E3GA 5E7DA 3LQHA 5E9YA 5II1A 4HBYA 5IBNA 4O75A 3UVDA 3NXBA 5F62A 5CUCA 5HFRA 4QNSA 5I88A 4KCXA 4N4FA 4QR4A 5DX4A 2I8NA 4UIWA 5D3PA 3U5LA 4X2IA 4PKLA 5ENGA 4UYFB 5FB0A 3RCWA 4O71A 5A81A 4YY4A 4YATA 5E9MA 5D7XA 4TU4A 4NRBA 4HBXA 3JVLA 2YDWA 4QZSA 5F3AA 5LJ0A 2L5EA 5EICA 5I7YA 5IG6A 3UVYA 5C8GA 3UVXA 4NR4A 4YYMA 5F2PA 3I3JA 4HXMA 4LZSA 5CUGA 5FFVA 2YELA 5AMFA 5L8UA 3P1DA 5HM0A 4O78A 4YABA 4NQMA 4UIVA 4HXPA 5A5SA 4HXLA 3LXJA 5EQ1A 3U5KA 4NQNA 2DVSA 5CQTA 4NYVA 5H1TA 3LQIA 5FG5A 3D7CA 5CPEA 2DVQA 4NUDA 4QY4A 4O7CA 5IGKA 2DVRA 4XYAA 5D3HA 5D3RA 4BW4A 5E73A 1WUGA 4IR3A 4TQNA 5LKXA 1ZS5A 5HRWA 2YQDA 4XUBA 5D25A 2L85A 5C85A 4NR6A 4QUUA 4O7AA 3MULA 4OUFA 5TCMA 5E9IA 4KV1A 5ENIA 4BHWA 4BW1A 5EGUA 5E9LA 4Q0OA 5IGMA 5E74A 5EWHA 3UV2A 4YYGA 3O35A 5TB6A 3IU6A 4A9KA 2RNYA 5FE7A 5I83A 4CLBA 4QSWA 5L97A 5LUUA 4MR3A 4QSTA 5LVRA 5F60A 4N3WA 4CFLA 5EU1A 4UYDA 4E96A 5FE0A 5ENCA 4PCIA 5CQ7A 4YY6A 2DVVA 2E7OA 2R0SA 5L98A 4N4HA 4WIVA 4CUTA 2OUOA 5EWWA 4N4GA 5DBMA 4QEWA 2RI7A 4UIUA 5COIA 4HBWA 5DLXA 3ZYUA 5ENFA 4QYLA 5I80A 4NUCA 5HQ5A 4QSVA 4YYJA 5FE5A 4Q0NA 4A9JA 5LKUA 4TT6A 3O37A 4GPJA 5FFYA 5LJ2A 4MR4A 5DYCA 5I1QA 2RFJA 5H1VA 3DWYA 4YYHA 5JWMA 4OGJA 4NYXA 4C66A 5A85A 4TT4A 5F63A 3O36A 4MR5A 5EP7A 3Q2FA 5HRXA 5ETBA 2N9GA 5EPSA 3U5JA 3HMEA 4CUSA 4HBVA 5CQ3A 3LJWA 5CUAA 4UITA 5C87A 5D3TA 5D3JA 4TTEA 4YYDA 4XY9A 5F5ZA 5C7NA 4LYSA 4HXRA 4CUUA 5CQ8A 5LKTA 5FE9A 4KV4A 5FG6A 4NRCA 5AD2A 5A5OA 5H1UA 2OSSA 5FFWA 1JSPB 4TS8A 4UYGA 2NXBA 5H85A 4IORA 4O70A 4TT2A 5HCLA 5I86A 3S91A 4Y03A 4DONA 4NR5A 5ENBA 4UIYA 5CUEA 5DYUA 5EVAA 4QSUA 5FH6A 2OO1A 5CP5A 4NS5A 3IU5A 4LR6A 2MJVB 3U5MA 4YBMA 5KO4A 4Z6IA 4UYFA 5FH7A 5HQ7A 4PY6A 4O77A 5HFQA 4A9LA 2YYNA 5CTLA 4MENA 4J0SA 5A5QA 5HELA 4MEQA 3MB3A 3G0LA 3AADA 4NRAA 5BT4A 5JI8A 4CURA 5HRVA 5J0DA 5EV9A 3U5NA 3U5OA 5HENA 4A9OA 5A5PA 5DKDA 4QSQA 4LZRA 5FE3A 4ZW1A 4YAXA 4QEVA 5LJ1A 5HQ6A 2E7NA 3P1CA 4A9FA 1JM4B 4NR8A 3DAIA 4O74A 2R0YA 3O34A 4QSXA 4WHUA 4C67A 4OGIA 5I89A 4LRGA 4YC9A 4CUPA 4NYWA 5F61A 5FE2A 5CY9A 5EPRA 3S92A 4J1PA 4YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6H A;  3P5O A;  3O33 A;  3HMH A;  4LZ2 A;  3MUK A;  3SVG A;  5C4Q A;  5IID A;  5HEM A;  4NR9 A;  3QZT A;  5E3D A;  4QC3 A;  4UIZ A;  5KTU A;  2DKW A;  2D9E A;  5ENH A;  4HXS A;  4BJX A;  5L99 A;  4ZQL A;  2KTB B;  5F1H A;  2F6N A;  4BW2 A;  5C89 A;  2E3K A;  3K2J A;  5CFW A;  5LVQ A;  5FE6 A;  4QSR A;  3JVK A;  4O7B A;  4LC2 A;  2F6J A;  5D3N A;  4QR5 A;  4N4I A;  4Z1Q A;  5HLS A;  5E9K A;  4QEU A;  2G4A A;  4NR7 A;  5A5N A;  4CUQ A;  4MEO A;  2YEK A;  4CL9 A;  5EI4 A;  4YBS A;  5AD3 A;  5DY7 A;  5DYA A;  4LDF A;  2RS9 B;  4QYD A;  4Z1S A;  4O72 A;  5L8T A;  3P1E A;  4YK0 A;  5A5R A;  5CQ4 A;  2L84 A;  4O7F A;  4J0R A;  4QSP A;  5F25 A;  5CQ5 A;  5IGN A;  5ACY A;  4AKN A;  4F3I A;  3JVJ A;  3UW9 A;  5D0C A;  3AQA A;  5E9V A;  1EQF A;  2FSA A;  3TLP A;  5I40 A;  4HXN A;  3G0J A;  5FH8 A;  4QSS A;  3Q2E A;  4ZC9 A;  1WUM A;  5LKZ A;  2WP2 A;  5EWD A;  4NUE A;  4MEP A;  4TZ2 A;  5KHM A;  2WP1 A;  5CGP A;  5F1L A;  4J3I A;  5HJC A;  3P1F A;  5D3L A;  4YH4 A;  4ALH A;  4YAD A;  4A9N A;  4LYW A;  5K29 A;  5EWC A;  5ENE A;  5IGL A;  5KTW A;  4IR4 A;  5FE4 A;  2DWW A;  4UYH A;  3ONI A;  4HXK A;  5FBX A;  3HMF A;  3LQJ A;  5I7X A;  4QUT A;  5DW2 A;  4YYK A;  5CU8 A;  5EPB A;  4UYE A;  4YYN A;  4TU6 A;  4A9M A;  2D82 A;  1F68 A;  5DLZ A;  2H60 A;  4IOO A;  5EK9 A;  2RO1 A;  4IR6 A;  1N72 A;  4IR5 A;  4A9I A;  5ETD A;  5BT5 A;  5EIS A;  5DYX A;  5DFC A;  5D24 A;  2RNW A;  5FE1 A;  5D26 A;  4QBM A;  3GG3 A;  3UV5 A;  3MXF A;  4NXJ A;  4MR6 A;  5AME A;  4PS5 A;  4QC1 A;  2R0V A;  5DFB A;  4TYL A;  5A7C A;  3QZS A;  5E0R A;  4UIX A;  5L96 A;  5DFD A;  5DKH A;  5II2 A;  5CRM A;  4A9H A;  3UV4 A;  5F36 A;  5A83 A;  5ENJ A;  5BT3 A;  5DKC A;  5CZG A;  4PCE A;  5CQA A;  4XUA A;  4YH3 A;  2YEM A;  4XY8 A;  2LSP B;  5EM3 A;  5EWV A;  5FB1 A;  4ALG A;  4BW3 A;  2I7K A;  3UVW A;  4QR3 A;  3MB4 A;  3JVM A;  5D3S A;  4RVR A;  3SVH A;  2R10 A;  2RNX A;  3FKM X;  5CUD A;  4O7E A;  1E6I A;  3MQM A;  4WHW A;  2YW5 A;  2GRC A;  4QB3 A;  4IOQ A;  5CQ6 A;  5DW1 A;  3SVF A;  1X0J A;  4A9E A;  4O76 A;  5CRZ A;  5FDZ A;  2DAT A;  5KU3 A;  5G4R A;  4Z93 A;  5EA1 A;  4YYI A;  5CS8 A;  4TZ8 A;  4LYI A;  5CUB A;  4FLP A;  4HXO A;  4PTB A;  5FE8 A;  4CFK A;  5I29 A;  5FG4 A;  5G4S A;  3U5P A;  5A82 A;  3QZV A;  5KTX A;  5E3G A;  5E7D A;  3LQH A;  5E9Y A;  5II1 A;  4HBY A;  5IBN A;  4O75 A;  3UVD A;  3NXB A;  5F62 A;  5CUC A;  5HFR A;  4QNS A;  5I88 A;  4KCX A;  4N4F A;  4QR4 A;  5DX4 A;  2I8N A;  4UIW A;  5D3P A;  3U5L A;  4X2I A;  4PKL A;  5ENG A;  4UYF B;  5FB0 A;  3RCW A;  4O71 A;  5A81 A;  4YY4 A;  4YAT A;  5E9M A;  5D7X A;  4TU4 A;  4NRB A;  4HBX A;  3JVL A;  2YDW A;  4QZS A;  5F3A A;  5LJ0 A;  2L5E A;  5EIC A;  5I7Y A;  5IG6 A;  3UVY A;  5C8G A;  3UVX A;  4NR4 A;  4YYM A;  5F2P A;  3I3J A;  4HXM A;  4LZS A;  5CUG A;  5FFV A;  2YEL A;  5AMF A;  5L8U A;  3P1D A;  5HM0 A;  4O78 A;  4YAB A;  4NQM A;  4UIV A;  4HXP A;  5A5S A;  4HXL A;  3LXJ A;  5EQ1 A;  3U5K A;  4NQN A;  2DVS A;  5CQT A;  4NYV A;  5H1T A;  3LQI A;  5FG5 A;  3D7C A;  5CPE A;  2DVQ A;  4NUD A;  4QY4 A;  4O7C A;  5IGK A;  2DVR A;  4XYA A;  5D3H A;  5D3R A;  4BW4 A;  5E73 A;  1WUG A;  4IR3 A;  4TQN A;  5LKX A;  1ZS5 A;  5HRW A;  2YQD A;  4XUB A;  5D25 A;  2L85 A;  5C85 A;  4NR6 A;  4QUU A;  4O7A A;  3MUL A;  4OUF A;  5TCM A;  5E9I A;  4KV1 A;  5ENI A;  4BHW A;  4BW1 A;  5EGU A;  5E9L A;  4Q0O A;  5IGM A;  5E74 A;  5EWH A;  3UV2 A;  4YYG A;  3O35 A;  5TB6 A;  3IU6 A;  4A9K A;  2RNY A;  5FE7 A;  5I83 A;  4CLB A;  4QSW A;  5L97 A;  5LUU A;  4MR3 A;  4QST A;  5LVR A;  5F60 A;  4N3W A;  4CFL A;  5EU1 A;  4UYD A;  4E96 A;  5FE0 A;  5ENC A;  4PCI A;  5CQ7 A;  4YY6 A;  2DVV A;  2E7O A;  2R0S A;  5L98 A;  4N4H A;  4WIV A;  4CUT A;  2OUO A;  5EWW A;  4N4G A;  5DBM A;  4QEW A;  2RI7 A;  4UIU A;  5COI A;  4HBW A;  5DLX A;  3ZYU A;  5ENF A;  4QYL A;  5I80 A;  4NUC A;  5HQ5 A;  4QSV A;  4YYJ A;  5FE5 A;  4Q0N A;  4A9J A;  5LKU A;  4TT6 A;  3O37 A;  4GPJ A;  5FFY A;  5LJ2 A;  4MR4 A;  5DYC A;  5I1Q A;  2RFJ A;  5H1V A;  3DWY A;  4YYH A;  5JWM A;  4OGJ A;  4NYX A;  4C66 A;  5A85 A;  4TT4 A;  5F63 A;  3O36 A;  4MR5 A;  5EP7 A;  3Q2F A;  5HRX A;  5ETB A;  2N9G A;  5EPS A;  3U5J A;  3HME A;  4CUS A;  4HBV A;  5CQ3 A;  3LJW A;  5CUA A;  4UIT A;  5C87 A;  5D3T A;  5D3J A;  4TTE A;  4YYD A;  4XY9 A;  5F5Z A;  5C7N A;  4LYS A;  4HXR A;  4CUU A;  5CQ8 A;  5LKT A;  5FE9 A;  4KV4 A;  5FG6 A;  4NRC A;  5AD2 A;  5A5O A;  5H1U A;  2OSS A;  5FFW A;  1JSP B;  4TS8 A;  4UYG A;  2NXB A;  5H85 A;  4IOR A;  4O70 A;  4TT2 A;  5HCL A;  5I86 A;  3S91 A;  4Y03 A;  4DON A;  4NR5 A;  5ENB A;  4UIY A;  5CUE A;  5DYU A;  5EVA A;  4QSU A;  5FH6 A;  2OO1 A;  5CP5 A;  4NS5 A;  3IU5 A;  4LR6 A;  2MJV B;  3U5M A;  4YBM A;  5KO4 A;  4Z6I A;  4UYF A;  5FH7 A;  5HQ7 A;  4PY6 A;  4O77 A;  5HFQ A;  4A9L A;  2YYN A;  5CTL A;  4MEN A;  4J0S A;  5A5Q A;  5HEL A;  4MEQ A;  3MB3 A;  3G0L A;  3AAD A;  4NRA A;  5BT4 A;  5JI8 A;  4CUR A;  5HRV A;  5J0D A;  5EV9 A;  3U5N A;  3U5O A;  5HEN A;  4A9O A;  5A5P A;  5DKD A;  4QSQ A;  4LZR A;  5FE3 A;  4ZW1 A;  4YAX A;  4QEV A;  5LJ1 A;  5HQ6 A;  2E7N A;  3P1C A;  4A9F A;  1JM4 B;  4NR8 A;  3DAI A;  4O74 A;  2R0Y A;  3O34 A;  4QSX A;  4WHU A;  4C67 A;  4OGI A;  5I89 A;  4LRG A;  4YC9 A;  4CUP A;  4NYW A;  5F61 A;  5FE2 A;  5CY9 A;  5EPR A;  3S92 A;  4J1P A;  4YBT A; 
#chains in the Genus database with same CATH topology
 4Z6H A;  3P5O A;  3O33 A;  3HMH A;  4LZ2 A;  3MUK A;  3SVG A;  5C4Q A;  5IID A;  5HEM A;  4NR9 A;  3QZT A;  5E3D A;  4QC3 A;  4UIZ A;  5KTU A;  2DKW A;  2D9E A;  5ENH A;  4HXS A;  4BJX A;  5L99 A;  4ZQL A;  2KTB B;  5F1H A;  2F6N A;  4BW2 A;  5C89 A;  2E3K A;  3K2J A;  5CFW A;  5LVQ A;  5FE6 A;  4QSR A;  3JVK A;  4O7B A;  4LC2 A;  2F6J A;  5D3N A;  4QR5 A;  4N4I A;  4Z1Q A;  5HLS A;  5E9K A;  4QEU A;  2G4A A;  4NR7 A;  5A5N A;  4CUQ A;  4MEO A;  2YEK A;  4CL9 A;  5EI4 A;  4YBS A;  5AD3 A;  5DY7 A;  5DYA A;  4LDF A;  2RS9 B;  4QYD A;  4Z1S A;  4O72 A;  5L8T A;  3P1E A;  4YK0 A;  5A5R A;  5CQ4 A;  2L84 A;  4O7F A;  4J0R A;  4QSP A;  5F25 A;  5CQ5 A;  5IGN A;  5ACY A;  4AKN A;  4F3I A;  3JVJ A;  3UW9 A;  5D0C A;  3AQA A;  5E9V A;  1EQF A;  2FSA A;  3TLP A;  5I40 A;  4HXN A;  3G0J A;  5FH8 A;  4QSS A;  3Q2E A;  4ZC9 A;  1WUM A;  5LKZ A;  2WP2 A;  5EWD A;  4NUE A;  4MEP A;  4TZ2 A;  5KHM A;  2WP1 A;  5CGP A;  5F1L A;  4J3I A;  5HJC A;  3P1F A;  5D3L A;  4AI6 A;  4YH4 A;  4ALH A;  4YAD A;  4A9N A;  4LYW A;  5K29 A;  5EWC A;  5ENE A;  5IGL A;  5KTW A;  4IR4 A;  5FE4 A;  2DWW A;  4UYH A;  3ONI A;  4HXK A;  3D1B A;  5FBX A;  3HMF A;  3LQJ A;  5I7X A;  4QUT A;  5DW2 A;  4YYK A;  5CU8 A;  5EPB A;  4AKI A;  4UYE A;  4YYN A;  4TU6 A;  4A9M A;  2D82 A;  1F68 A;  5DLZ A;  2H60 A;  4IOO A;  5EK9 A;  2RO1 A;  4IR6 A;  1N72 A;  4IR5 A;  4A9I A;  5ETD A;  5BT5 A;  5EIS A;  5DYX A;  5DFC A;  5D24 A;  2RNW A;  5FE1 A;  5D26 A;  4QBM A;  3GG3 A;  3UV5 A;  3MXF A;  4NXJ A;  4MR6 A;  5AME A;  4PS5 A;  4QC1 A;  2R0V A;  5DFB A;  4TYL A;  5A7C A;  3QZS A;  5E0R A;  4UIX A;  5L96 A;  5DFD A;  5DKH A;  5II2 A;  5CRM A;  4A9H A;  3UV4 A;  5F36 A;  5A83 A;  5ENJ A;  5BT3 A;  5DKC A;  5CZG A;  4PCE A;  5CQA A;  4XUA A;  4YH3 A;  2YEM A;  4XY8 A;  2LSP B;  5EM3 A;  5EWV A;  5FB1 A;  4ALG A;  4BW3 A;  2I7K A;  3UVW A;  4QR3 A;  3MB4 A;  3JVM A;  5D3S A;  1PUO A;  4RVR A;  3SVH A;  2R10 A;  2RNX A;  3FKM X;  5CUD A;  4O7E A;  1E6I A;  3MQM A;  4WHW A;  2YW5 A;  2GRC A;  4QB3 A;  4IOQ A;  5CQ6 A;  5DW1 A;  3SVF A;  1X0J A;  4A9E A;  4O76 A;  5CRZ A;  5FDZ A;  2DAT A;  5KU3 A;  5G4R A;  4Z93 A;  5EA1 A;  4YYI A;  5CS8 A;  4TZ8 A;  4LYI A;  5CUB A;  4FLP A;  4HXO A;  4PTB A;  5FE8 A;  4CFK A;  5I29 A;  5FG4 A;  5G4S A;  3U5P A;  5A82 A;  3QZV A;  5KTX A;  5E3G A;  5E7D A;  3LQH A;  5E9Y A;  5II1 A;  4HBY A;  5IBN A;  4O75 A;  3UVD A;  3NXB A;  5F62 A;  5CUC A;  5HFR A;  4QNS A;  5I88 A;  4KCX A;  4N4F A;  4QR4 A;  5DX4 A;  2I8N A;  4UIW A;  5D3P A;  3U5L A;  4X2I A;  4PKL A;  5ENG A;  4UYF B;  5FB0 A;  3RCW A;  4O71 A;  5A81 A;  4YY4 A;  4YAT A;  5E9M A;  5D7X A;  4TU4 A;  4NRB A;  4HBX A;  3JVL A;  2YDW A;  4QZS A;  5F3A A;  5LJ0 A;  2L5E A;  5EIC A;  5I7Y A;  5IG6 A;  3UVY A;  5C8G A;  3UVX A;  4NR4 A;  4YYM A;  5F2P A;  3I3J A;  4HXM A;  4LZS A;  5CUG A;  5FFV A;  2YEL A;  5AMF A;  5L8U A;  3P1D A;  5HM0 A;  4O78 A;  4YAB A;  4NQM A;  4UIV A;  4HXP A;  5A5S A;  4HXL A;  3LXJ A;  5EQ1 A;  3U5K A;  4NQN A;  2DVS A;  5CQT A;  4NYV A;  5H1T A;  3LQI A;  5FG5 A;  3VKH A;  3D7C A;  5CPE A;  2DVQ A;  4NUD A;  4QY4 A;  4O7C A;  5IGK A;  2DVR A;  4XYA A;  5D3H A;  5D3R A;  4BW4 A;  5E73 A;  1WUG A;  4IR3 A;  4TQN A;  5LKX A;  1ZS5 A;  5HRW A;  2YQD A;  4XUB A;  5D25 A;  2L85 A;  5C85 A;  4NR6 A;  4QUU A;  4O7A A;  3MUL A;  4OUF A;  3VKG A;  5TCM A;  5E9I A;  4KV1 A;  5ENI A;  4BHW A;  4BW1 A;  5EGU A;  5E9L A;  4Q0O A;  5IGM A;  5E74 A;  5EWH A;  3UV2 A;  4YYG A;  3O35 A;  5TB6 A;  3IU6 A;  4A9K A;  2RNY A;  5FE7 A;  5I83 A;  4CLB A;  4QSW A;  5L97 A;  5LUU A;  4MR3 A;  4QST A;  5LVR A;  5F60 A;  4N3W A;  4CFL A;  5EU1 A;  4UYD A;  4E96 A;  5FE0 A;  5ENC A;  4PCI A;  2EJN A;  5CQ7 A;  4YY6 A;  2E7O A;  2R0S A;  2DVV A;  5L98 A;  4N4H A;  4WIV A;  4CUT A;  2OUO A;  5EWW A;  4N4G A;  5DBM A;  4QEW A;  2RI7 A;  4UIU A;  5COI A;  4HBW A;  5DLX A;  3ZYU A;  5ENF A;  4QYL A;  5I80 A;  4NUC A;  5HQ5 A;  4QSV A;  4YYJ A;  5FE5 A;  4Q0N A;  4A9J A;  5LKU A;  4TT6 A;  3O37 A;  4GPJ A;  5FFY A;  5LJ2 A;  4MR4 A;  5DYC A;  5I1Q A;  4AKG A;  2RFJ A;  5H1V A;  3DWY A;  4YYH A;  5JWM A;  4OGJ A;  4NYX A;  4C66 A;  5A85 A;  4TT4 A;  5F63 A;  3O36 A;  4MR5 A;  5EP7 A;  3Q2F A;  5HRX A;  5ETB A;  2N9G A;  5EPS A;  3U5J A;  3HME A;  4CUS A;  4HBV A;  5CQ3 A;  3LJW A;  5CUA A;  4UIT A;  5C87 A;  5D3T A;  5D3J A;  4TTE A;  4YYD A;  4XY9 A;  5F5Z A;  5C7N A;  4LYS A;  4HXR A;  4CUU A;  5CQ8 A;  5LKT A;  5FE9 A;  4KV4 A;  5FG6 A;  4NRC A;  5AD2 A;  5A5O A;  5H1U A;  2OSS A;  5FFW A;  1JSP B;  4TS8 A;  4UYG A;  2NXB A;  5H85 A;  4IOR A;  4AKH A;  4O70 A;  4TT2 A;  5HCL A;  5I86 A;  3S91 A;  4Y03 A;  4DON A;  4NR5 A;  5ENB A;  4UIY A;  5CUE A;  5DYU A;  3ERR A;  5EVA A;  4QSU A;  5FH6 A;  2OO1 A;  5CP5 A;  4NS5 A;  3IU5 A;  4LR6 A;  2MJV B;  3U5M A;  4YBM A;  5KO4 A;  4Z6I A;  4UYF A;  5FH7 A;  5HQ7 A;  4PY6 A;  4O77 A;  5HFQ A;  4A9L A;  2YYN A;  5CTL A;  4MEN A;  4J0S A;  3D1D A;  5A5Q A;  5HEL A;  4MEQ A;  3MB3 A;  3G0L A;  3AAD A;  4NRA A;  5BT4 A;  5JI8 A;  4CUR A;  5HRV A;  5J0D A;  5EV9 A;  3U5N A;  3U5O A;  5HEN A;  4A9O A;  5A5P A;  5DKD A;  4QSQ A;  4LZR A;  5FE3 A;  4ZW1 A;  4YAX A;  4QEV A;  5LJ1 A;  5HQ6 A;  2E7N A;  3P1C A;  4A9F A;  1JM4 B;  4NR8 A;  3DAI A;  4O74 A;  2R0Y A;  3O34 A;  4QSX A;  4WHU A;  4C67 A;  4OGI A;  5I89 A;  4LRG A;  4YC9 A;  4CUP A;  4NYW A;  5F61 A;  5FE2 A;  5CY9 A;  5EPR A;  3S92 A;  4J1P A;  4YBT A;  1ZKR A; 
#chains in the Genus database with same CATH homology
 4Z6H A;  3P5O A;  3O33 A;  3HMH A;  4LZ2 A;  3MUK A;  3SVG A;  5C4Q A;  5IID A;  5HEM A;  4NR9 A;  3QZT A;  5E3D A;  4QC3 A;  4UIZ A;  5KTU A;  2DKW A;  2D9E A;  5ENH A;  4HXS A;  4BJX A;  5L99 A;  4ZQL A;  2KTB B;  5F1H A;  2F6N A;  4BW2 A;  5C89 A;  2E3K A;  3K2J A;  5CFW A;  5LVQ A;  5FE6 A;  4QSR A;  3JVK A;  4O7B A;  4LC2 A;  2F6J A;  5D3N A;  4QR5 A;  4N4I A;  4Z1Q A;  5HLS A;  5E9K A;  4QEU A;  2G4A A;  4NR7 A;  5A5N A;  4CUQ A;  4MEO A;  2YEK A;  4CL9 A;  5EI4 A;  4YBS A;  5AD3 A;  5DY7 A;  5DYA A;  4LDF A;  2RS9 B;  4QYD A;  4Z1S A;  4O72 A;  5L8T A;  3P1E A;  4YK0 A;  5A5R A;  5CQ4 A;  2L84 A;  4O7F A;  4J0R A;  4QSP A;  5F25 A;  5CQ5 A;  5IGN A;  5ACY A;  4AKN A;  4F3I A;  3JVJ A;  3UW9 A;  5D0C A;  3AQA A;  5E9V A;  1EQF A;  2FSA A;  3TLP A;  5I40 A;  4HXN A;  3G0J A;  5FH8 A;  4QSS A;  3Q2E A;  4ZC9 A;  1WUM A;  5LKZ A;  2WP2 A;  5EWD A;  4NUE A;  4MEP A;  4TZ2 A;  5KHM A;  2WP1 A;  5CGP A;  5F1L A;  4J3I A;  5HJC A;  3P1F A;  5D3L A;  4YH4 A;  4ALH A;  4YAD A;  4A9N A;  4LYW A;  5K29 A;  5EWC A;  5ENE A;  5IGL A;  5KTW A;  4IR4 A;  5FE4 A;  2DWW A;  4UYH A;  3ONI A;  4HXK A;  5FBX A;  3HMF A;  3LQJ A;  5I7X A;  4QUT A;  5DW2 A;  4YYK A;  5CU8 A;  5EPB A;  4UYE A;  4YYN A;  4TU6 A;  4A9M A;  2D82 A;  1F68 A;  5DLZ A;  2H60 A;  4IOO A;  5EK9 A;  2RO1 A;  4IR6 A;  1N72 A;  4IR5 A;  4A9I A;  5ETD A;  5BT5 A;  5EIS A;  5DYX A;  5DFC A;  5D24 A;  2RNW A;  5FE1 A;  5D26 A;  4QBM A;  3GG3 A;  3UV5 A;  3MXF A;  4NXJ A;  4MR6 A;  5AME A;  4PS5 A;  4QC1 A;  2R0V A;  5DFB A;  4TYL A;  5A7C A;  3QZS A;  5E0R A;  4UIX A;  5L96 A;  5DFD A;  5DKH A;  5II2 A;  5CRM A;  4A9H A;  3UV4 A;  5F36 A;  5A83 A;  5ENJ A;  5BT3 A;  5DKC A;  5CZG A;  4PCE A;  5CQA A;  4XUA A;  4YH3 A;  2YEM A;  4XY8 A;  2LSP B;  5EM3 A;  5EWV A;  5FB1 A;  4ALG A;  4BW3 A;  2I7K A;  3UVW A;  4QR3 A;  3MB4 A;  3JVM A;  5D3S A;  4RVR A;  3SVH A;  2R10 A;  2RNX A;  3FKM X;  5CUD A;  4O7E A;  1E6I A;  3MQM A;  4WHW A;  2YW5 A;  2GRC A;  4QB3 A;  4IOQ A;  5CQ6 A;  5DW1 A;  3SVF A;  1X0J A;  4A9E A;  4O76 A;  5CRZ A;  5FDZ A;  2DAT A;  5KU3 A;  5G4R A;  4Z93 A;  5EA1 A;  4YYI A;  5CS8 A;  4TZ8 A;  4LYI A;  5CUB A;  4FLP A;  4HXO A;  4PTB A;  5FE8 A;  4CFK A;  5I29 A;  5FG4 A;  5G4S A;  3U5P A;  5A82 A;  3QZV A;  5KTX A;  5E3G A;  5E7D A;  3LQH A;  5E9Y A;  5II1 A;  4HBY A;  5IBN A;  4O75 A;  3UVD A;  3NXB A;  5F62 A;  5CUC A;  5HFR A;  4QNS A;  5I88 A;  4KCX A;  4N4F A;  4QR4 A;  5DX4 A;  2I8N A;  4UIW A;  5D3P A;  3U5L A;  4X2I A;  4PKL A;  5ENG A;  4UYF B;  5FB0 A;  3RCW A;  4O71 A;  5A81 A;  4YY4 A;  4YAT A;  5E9M A;  5D7X A;  4TU4 A;  4NRB A;  4HBX A;  3JVL A;  2YDW A;  4QZS A;  5F3A A;  5LJ0 A;  2L5E A;  5EIC A;  5I7Y A;  5IG6 A;  3UVY A;  5C8G A;  3UVX A;  4NR4 A;  4YYM A;  5F2P A;  3I3J A;  4HXM A;  4LZS A;  5CUG A;  5FFV A;  2YEL A;  5AMF A;  5L8U A;  3P1D A;  5HM0 A;  4O78 A;  4YAB A;  4NQM A;  4UIV A;  4HXP A;  5A5S A;  4HXL A;  3LXJ A;  5EQ1 A;  3U5K A;  4NQN A;  2DVS A;  5CQT A;  4NYV A;  5H1T A;  3LQI A;  5FG5 A;  3D7C A;  5CPE A;  2DVQ A;  4NUD A;  4QY4 A;  4O7C A;  5IGK A;  2DVR A;  4XYA A;  5D3H A;  5D3R A;  4BW4 A;  5E73 A;  1WUG A;  4IR3 A;  4TQN A;  5LKX A;  1ZS5 A;  5HRW A;  2YQD A;  4XUB A;  5D25 A;  2L85 A;  5C85 A;  4NR6 A;  4QUU A;  4O7A A;  3MUL A;  4OUF A;  5TCM A;  5E9I A;  4KV1 A;  5ENI A;  4BHW A;  4BW1 A;  5EGU A;  5E9L A;  4Q0O A;  5IGM A;  5E74 A;  5EWH A;  3UV2 A;  4YYG A;  3O35 A;  5TB6 A;  3IU6 A;  4A9K A;  2RNY A;  5FE7 A;  5I83 A;  4CLB A;  4QSW A;  5L97 A;  5LUU A;  4MR3 A;  4QST A;  5LVR A;  5F60 A;  4N3W A;  4CFL A;  5EU1 A;  4UYD A;  4E96 A;  5FE0 A;  5ENC A;  4PCI A;  5CQ7 A;  4YY6 A;  2DVV A;  2E7O A;  2R0S A;  5L98 A;  4N4H A;  4WIV A;  4CUT A;  2OUO A;  5EWW A;  4N4G A;  5DBM A;  4QEW A;  2RI7 A;  4UIU A;  5COI A;  4HBW A;  5DLX A;  3ZYU A;  5ENF A;  4QYL A;  5I80 A;  4NUC A;  5HQ5 A;  4QSV A;  4YYJ A;  5FE5 A;  4Q0N A;  4A9J A;  5LKU A;  4TT6 A;  3O37 A;  4GPJ A;  5FFY A;  5LJ2 A;  4MR4 A;  5DYC A;  5I1Q A;  2RFJ A;  5H1V A;  3DWY A;  4YYH A;  5JWM A;  4OGJ A;  4NYX A;  4C66 A;  5A85 A;  4TT4 A;  5F63 A;  3O36 A;  4MR5 A;  5EP7 A;  3Q2F A;  5HRX A;  5ETB A;  2N9G A;  5EPS A;  3U5J A;  3HME A;  4CUS A;  4HBV A;  5CQ3 A;  3LJW A;  5CUA A;  4UIT A;  5C87 A;  5D3T A;  5D3J A;  4TTE A;  4YYD A;  4XY9 A;  5F5Z A;  5C7N A;  4LYS A;  4HXR A;  4CUU A;  5CQ8 A;  5LKT A;  5FE9 A;  4KV4 A;  5FG6 A;  4NRC A;  5AD2 A;  5A5O A;  5H1U A;  2OSS A;  5FFW A;  1JSP B;  4TS8 A;  4UYG A;  2NXB A;  5H85 A;  4IOR A;  4O70 A;  4TT2 A;  5HCL A;  5I86 A;  3S91 A;  4Y03 A;  4DON A;  4NR5 A;  5ENB A;  4UIY A;  5CUE A;  5DYU A;  5EVA A;  4QSU A;  5FH6 A;  2OO1 A;  5CP5 A;  4NS5 A;  3IU5 A;  4LR6 A;  2MJV B;  3U5M A;  4YBM A;  5KO4 A;  4Z6I A;  4UYF A;  5FH7 A;  5HQ7 A;  4PY6 A;  4O77 A;  5HFQ A;  4A9L A;  2YYN A;  5CTL A;  4MEN A;  4J0S A;  5A5Q A;  5HEL A;  4MEQ A;  3MB3 A;  3G0L A;  3AAD A;  4NRA A;  5BT4 A;  5JI8 A;  4CUR A;  5HRV A;  5J0D A;  5EV9 A;  3U5N A;  3U5O A;  5HEN A;  4A9O A;  5A5P A;  5DKD A;  4QSQ A;  4LZR A;  5FE3 A;  4ZW1 A;  4YAX A;  4QEV A;  5LJ1 A;  5HQ6 A;  2E7N A;  3P1C A;  4A9F A;  1JM4 B;  4NR8 A;  3DAI A;  4O74 A;  2R0Y A;  3O34 A;  4QSX A;  4WHU A;  4C67 A;  4OGI A;  5I89 A;  4LRG A;  4YC9 A;  4CUP A;  4NYW A;  5F61 A;  5FE2 A;  5CY9 A;  5EPR A;  3S92 A;  4J1P A;  4YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...