5IGMA

Crystal structure of the bromodomain of human brd9 in complex with bromosporine (bsp)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title Promiscuous targeting of bromodomains by bromosporine identifies BET proteins as master regulators of primary transcription response in leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5igmA00
4QR3A 2DVRA 5BT5A 3P1DA 4YY4A 2YW5A 3G0JA 2RNYA 4PS5A 5HEMA 4N4FA 4QYLA 2L5EA 5CQ7A 4BW3A 3MUKA 5L8TA 4GPJA 5C87A 2DKWA 5CY9A 4O7AA 5DYXA 4TT6A 3U5MA 4QR4A 3HMHA 5HFQA 4QUUA 5HENA 4CLBA 5G4SA 4YH4A 4YYGA 5DW1A 4HXKA 2DWWA 4MR5A 5CZGA 5F25A 5D3TA 5D24A 4CUSA 5EQ1A 3O37A 4IR6A 4F3IA 2RI7A 4UIUA 5L96A 4CFLA 2YYNA 4PCIA 4NYXA 5F36A 4YBMA 4YADA 4PY6A 5L8UA 3QZTA 5LVQA 5A83A 1F68A 2WP1A 4ZW1A 2NXBA 5FE8A 2E7OA 4IR5A 5DFCA 4YYKA 3JVJA 5C4QA 2KTBB 5HQ7A 5EWHA 4HXPA 3UV2A 5CQ6A 4A9MA 4OUFA 4QEWA 4ALHA 4O71A 5EI4A 5EVAA 4IORA 4AKNA 2F6JA 4RVRA 4A9IA 5CRMA 5AD3A 3MB3A 5A5RA 5CGPA 4HXSA 5KO4A 4O74A 4O70A 4QUTA 4Z6IA 5LKTA 5DKHA 2H60A 2MJVB 4UYDA 4YY6A 4LYWA 4LR6A 5HQ6A 4QSRA 5FE2A 4LZRA 5E7DA 4MR6A 5EWDA 4HBXA 3U5LA 5ETDA 5I7YA 5A5PA 3UVDA 5EU1A 3JVMA 4PTBA 2DVSA 2RFJA 5EV9A 3HMEA 5A7CA 5CQ3A 5A85A 5E9KA 4QC3A 4A9HA 5AMEA 5HJCA 5D3RA 3FKMX 5CP5A 4A9JA 5TB6A 5H1TA 5EPBA 4J1PA 4UYGA 3QZVA 2I8NA 5F2PA 5CUCA 4HXNA 3UVYA 4A9EA 4YBTA 4J3IA 5E9YA 5FE7A 4UIXA 4UIWA 5FBXA 4IR4A 5F1HA 5D3HA 4HXLA 5E74A 3MXFA 5E9IA 5L97A 4LZSA 4YYJA 3ONIA 5DLXA 2R0SA 4NR4A 5C7NA 4O72A 3NXBA 4NS5A 4TT2A 5HFRA 4NRAA 4WHWA 5EK9A 4TQNA 3AADA 5FE3A 2DATA 4O7FA 3MB4A 3UVWA 2OUOA 5A5QA 3DWYA 5DBMA 5LJ2A 5ENEA 4NYWA 4C67A 5JI8A 4PKLA 5DY7A 3MULA 4Q0NA 3U5PA 3QZSA 5E9VA 5BT4A 5IIDA 4OGJA 4QSXA 5C89A 5HM0A 4IR3A 5CUGA 3P1FA 5D3JA 4CUPA 5CUEA 4NRCA 4NRBA 2YEKA 3LQHA 4XY8A 3G0LA 4A9FA 5I1QA 5D7XA 5CUDA 4LDFA 5FH8A 4NYVA 5DKCA 4MEQA 4YYMA 2R0YA 4YH3A 4CL9A 4XUBA 3DAIA 5E9MA 3LJWA 5D3SA 3O35A 5FH7A 5KTUA 4WHUA 4HBYA 4XUAA 5HCLA 4O77A 5E3DA 5H1VA 4J0SA 3LQJA 4BHWA 4QY4A 5FE0A 5E9LA 5FB0A 2YEMA 5ENFA 5FE5A 4O76A 4MENA 5KU3A 2L85A 4TZ8A 4QR5A 4UYHA 5FE9A 5HRWA 5CPEA 4CUTA 5C85A 2FSAA 4IOQA 5IBNA 4NXJA 4QSPA 5EISA 4NR7A 5CTLA 5II1A 5CRZA 1ZS5A 2R10A 5FE4A 5DFDA 1JM4B 4YAXA 4A9LA 5TCMA 4ZQLA 4J0RA 4TU6A 4QZSA 3GG3A 3HMFA 4TTEA 4NUDA 5FH6A 4HBVA 5KTXA 5F1LA 5FE6A 5A5OA 5AD2A 5ACYA 1E6IA 5BT3A 3UV5A 2WP2A 4Z1QA 5F60A 5E3GA 5LJ0A 3O33A 4FLPA 5EP7A 5ENJA 4N4GA 3S92A 5CQAA 4HXMA 5L99A 3ZYUA 1WUMA 5ENBA 5IGMA 3I3JA 4LC2A 5F61A 3D7CA 5D3PA 2YELA 4IOOA 5D26A 3K2JA 5I80A 4UIZA 2D82A 3P1CA 5AMFA 3IU5A 5F62A 3RCWA 5CUBA 3O36A 4Z6HA 5LJ1A 3P5OA 4O7CA 4Q0OA 5FB1A 4YYDA 3U5NA 5CQ8A 5EPSA 3LQIA 5ENCA 5A81A 2GRCA 5A5NA 4LYSA 5FE1A 4BW2A 4UITA 4YATA 4NR6A 5K29A 5I83A 4KCXA 3SVGA 4ALGA 4E96A 3MQMA 4ZC9A 3UVXA 2E7NA 4NR8A 5KTWA 4N3WA 4XYAA 4OGIA 2D9EA 4Z93A 3UW9A 3O34A 5DLZA 4QC1A 3U5JA 4MR4A 4NUEA 5I29A 4TU4A 4C66A 5EICA 4DONA 4O78A 5E0RA 5FG5A 4NR5A 5LUUA 5F5ZA 1X0JA 5HRXA 4CFKA 4MEPA 5I88A 4TZ2A 5COIA 4A9NA 4BJXA 5FFWA 4XY9A 4YC9A 5G4RA 4HXRA 5LVRA 2R0VA 2YDWA 5HLSA 5CQ4A 5F63A 5ETBA 5CQTA 1JSPB 4LYIA 2RNWA 5I86A 2I7KA 4O7BA 3IU6A 5CU8A 4YYNA 5FFYA 4UIVA 2LSPB 5FFVA 4QEUA 4NUCA 4PCEA 4UYEA 4KV4A 5A82A 2OSSA 4HXOA 1WUGA 5C8GA 4O75A 5ENIA 5CQ5A 5LKXA 3LXJA 5H85A 2F6NA 5II2A 4YK0A 4X2IA 3SVFA 5FG6A 5HQ5A 5IGLA 5I40A 2L84A 4QSVA 4QYDA 5A5SA 3JVKA 3Q2FA 3U5OA 4HBWA 4QSTA 4N4HA 5FG4A 2RNXA 2OO1A 4UIYA 5DKDA 4TYLA 5KHMA 2G4AA 4MEOA 5D3NA 2DVVA 4LRGA 2YQDA 4NQNA 3Q2EA 4QSSA 5HRVA 4TS8A 2E3KA 3S91A 3SVHA 5DYAA 5EM3A 4A9OA 5E73A 5HELA 4UYFB 4YYIA 2N9GA 3TLPA 5DX4A 5EPRA 4N4IA 5DYUA 4UYFA 4QSQA 4MR3A 4YYHA 5EA1A 5LKZA 4QEVA 4QSUA 5EWCA 5I7XA 4A9KA 3JVLA 5EWWA 5CFWA 4CUQA 4YABA 3AQAA 4Z1SA 5IG6A 1N72A 4O7EA 4LZ2A 5DW2A 2RO1A 5D3LA 4CUUA 5EGUA 4WIVA 5ENGA 5DFBA 4YBSA 5JWMA 4TT4A 5IGNA 4QBMA 4NR9A 5D25A 5F3AA 4QNSA 4QSWA 5FDZA 5DYCA 2DVQA 1EQFA 5I89A 4CURA 4Y03A 5J0DA 5LKUA 5IGKA 5L98A 4KV1A 5H1UA 3P1EA 3U5KA 3UV4A 4BW4A 5D0CA 5CUAA 5EWVA 4BW1A 5ENHA 4NQMA 4QB3A 2RS9B 5CS8A
chains in the Genus database with same CATH superfamily
4QR3A 2DVRA 5BT5A 3P1DA 4YY4A 2YW5A 3G0JA 2RNYA 4PS5A 5HEMA 1PUOA 4N4FA 4QYLA 2L5EA 5CQ7A 4BW3A 3MUKA 5L8TA 4GPJA 5C87A 2DKWA 5CY9A 4O7AA 5DYXA 4TT6A 3U5MA 4QR4A 3HMHA 5HFQA 4QUUA 5HENA 4CLBA 5G4SA 4YH4A 3ERRA 4YYGA 5DW1A 4HXKA 2DWWA 4MR5A 5CZGA 5F25A 5D3TA 5D24A 4CUSA 5EQ1A 3O37A 4IR6A 4F3IA 2RI7A 4UIUA 5L96A 4CFLA 2YYNA 4PCIA 4NYXA 5F36A 4YBMA 4YADA 4PY6A 5L8UA 3QZTA 5LVQA 5A83A 1F68A 2WP1A 4ZW1A 2NXBA 5FE8A 2E7OA 4IR5A 5DFCA 1ZKRA 4YYKA 3JVJA 5C4QA 2KTBB 5HQ7A 5EWHA 4HXPA 3UV2A 5CQ6A 4A9MA 4OUFA 4QEWA 4ALHA 4O71A 5EI4A 5EVAA 4IORA 4AKNA 2F6JA 4RVRA 4A9IA 3D1DA 5CRMA 5AD3A 3MB3A 5A5RA 5CGPA 4HXSA 5KO4A 4O74A 4O70A 4QUTA 4Z6IA 5LKTA 5DKHA 2H60A 2MJVB 4UYDA 4YY6A 4LYWA 4LR6A 5HQ6A 4QSRA 5FE2A 4LZRA 5E7DA 4MR6A 5EWDA 4HBXA 3U5LA 5ETDA 5I7YA 5A5PA 3UVDA 5EU1A 3JVMA 4PTBA 2DVSA 2RFJA 5EV9A 3HMEA 5A7CA 5CQ3A 5A85A 5E9KA 4QC3A 4A9HA 5AMEA 5HJCA 5D3RA 3FKMX 5CP5A 4A9JA 5TB6A 5H1TA 5EPBA 4AKHA 4J1PA 4UYGA 3QZVA 2I8NA 5F2PA 5CUCA 4HXNA 3UVYA 4A9EA 4YBTA 4J3IA 5E9YA 5FE7A 4UIXA 4UIWA 5FBXA 4IR4A 5F1HA 5D3HA 4HXLA 5E74A 3MXFA 5E9IA 5L97A 4LZSA 4YYJA 3ONIA 5DLXA 2R0SA 4NR4A 5C7NA 4O72A 3NXBA 4NS5A 4TT2A 5HFRA 4NRAA 4WHWA 5EK9A 4TQNA 3AADA 5FE3A 2DATA 4O7FA 3MB4A 3UVWA 2OUOA 5A5QA 3DWYA 5DBMA 5LJ2A 5ENEA 4NYWA 4C67A 5JI8A 4PKLA 5DY7A 3MULA 4Q0NA 3U5PA 3QZSA 5E9VA 5BT4A 5IIDA 4OGJA 4QSXA 5C89A 5HM0A 4IR3A 5CUGA 3P1FA 5D3JA 4CUPA 5CUEA 4NRCA 4NRBA 2YEKA 3LQHA 4XY8A 3G0LA 4A9FA 5I1QA 5D7XA 5CUDA 4LDFA 5FH8A 4NYVA 5DKCA 4MEQA 4YYMA 2R0YA 4YH3A 4CL9A 4XUBA 3DAIA 5E9MA 3LJWA 5D3SA 3O35A 5FH7A 5KTUA 4WHUA 4HBYA 4XUAA 5HCLA 4O77A 3VKGA 5E3DA 5H1VA 3VKHA 4J0SA 3LQJA 4BHWA 4QY4A 5FE0A 5E9LA 5FB0A 4AKIA 2YEMA 5ENFA 5FE5A 4O76A 4MENA 5KU3A 2L85A 4TZ8A 4QR5A 4UYHA 5FE9A 5HRWA 5CPEA 4CUTA 5C85A 2FSAA 4IOQA 5IBNA 4NXJA 4QSPA 5EISA 4NR7A 5CTLA 5II1A 5CRZA 1ZS5A 2R10A 5FE4A 5DFDA 1JM4B 4YAXA 4A9LA 5TCMA 4ZQLA 4J0RA 4TU6A 4AI6A 4QZSA 3GG3A 3HMFA 4TTEA 4NUDA 5FH6A 4HBVA 5KTXA 5F1LA 2EJNA 5FE6A 4AKGA 5A5OA 5AD2A 5ACYA 1E6IA 5BT3A 3UV5A 2WP2A 4Z1QA 5F60A 5E3GA 5LJ0A 3O33A 4FLPA 5EP7A 5ENJA 4N4GA 3S92A 5CQAA 4HXMA 5L99A 3ZYUA 1WUMA 5ENBA 5IGMA 3I3JA 4LC2A 5F61A 3D7CA 5D3PA 2YELA 4IOOA 5D26A 3K2JA 5I80A 4UIZA 2D82A 3P1CA 5AMFA 3IU5A 5F62A 3RCWA 5CUBA 3O36A 4Z6HA 5LJ1A 3P5OA 4O7CA 4Q0OA 5FB1A 4YYDA 3U5NA 5CQ8A 5EPSA 3LQIA 5ENCA 5A81A 2GRCA 5A5NA 4LYSA 5FE1A 4BW2A 4UITA 4YATA 4NR6A 5K29A 5I83A 4KCXA 3SVGA 4ALGA 4E96A 3MQMA 4ZC9A 3UVXA 2E7NA 4NR8A 5KTWA 4N3WA 4XYAA 4OGIA 2D9EA 4Z93A 3UW9A 3O34A 5DLZA 4QC1A 3U5JA 4MR4A 4NUEA 5I29A 4TU4A 4C66A 5EICA 4DONA 4O78A 3D1BA 5E0RA 5FG5A 4NR5A 5LUUA 5F5ZA 1X0JA 5HRXA 4CFKA 4MEPA 5I88A 4TZ2A 5COIA 4A9NA 4BJXA 5FFWA 4XY9A 4YC9A 5G4RA 4HXRA 5LVRA 2R0VA 2YDWA 5HLSA 5CQ4A 5F63A 5ETBA 5CQTA 1JSPB 4LYIA 2RNWA 5I86A 2I7KA 4O7BA 3IU6A 5CU8A 4YYNA 5FFYA 4UIVA 2LSPB 5FFVA 4QEUA 4NUCA 4PCEA 4UYEA 4KV4A 5A82A 2OSSA 4HXOA 1WUGA 5C8GA 4O75A 5ENIA 5CQ5A 5LKXA 3LXJA 5H85A 2F6NA 5II2A 4YK0A 4X2IA 3SVFA 5FG6A 5HQ5A 5IGLA 5I40A 2L84A 4QSVA 4QYDA 5A5SA 3JVKA 3Q2FA 3U5OA 4HBWA 4QSTA 4N4HA 5FG4A 2RNXA 2OO1A 4UIYA 5DKDA 4TYLA 5KHMA 2G4AA 4MEOA 5D3NA 2DVVA 4LRGA 2YQDA 4NQNA 3Q2EA 4QSSA 5HRVA 4TS8A 2E3KA 3S91A 3SVHA 5DYAA 5EM3A 4A9OA 5E73A 5HELA 4UYFB 4YYIA 2N9GA 3TLPA 5DX4A 5EPRA 4N4IA 5DYUA 4UYFA 4QSQA 4MR3A 4YYHA 5EA1A 5LKZA 4QEVA 4QSUA 5EWCA 5I7XA 4A9KA 3JVLA 5EWWA 5CFWA 4CUQA 4YABA 3AQAA 4Z1SA 5IG6A 1N72A 4O7EA 4LZ2A 5DW2A 2RO1A 5D3LA 4CUUA 5EGUA 4WIVA 5ENGA 5DFBA 4YBSA 5JWMA 4TT4A 5IGNA 4QBMA 4NR9A 5D25A 5F3AA 4QNSA 4QSWA 5FDZA 5DYCA 2DVQA 1EQFA 5I89A 4CURA 4Y03A 5J0DA 5LKUA 5IGKA 5L98A 4KV1A 5H1UA 3P1EA 3U5KA 3UV4A 4BW4A 5D0CA 5CUAA 5EWVA 4BW1A 5ENHA 4NQMA 4QB3A 2RS9B 5CS8A
chains in the Genus database with same CATH topology
4QR3A 2DVRA 5BT5A 3P1DA 4YY4A 2YW5A 3G0JA 2RNYA 4PS5A 5HEMA 4N4FA 4QYLA 2L5EA 5CQ7A 4BW3A 3MUKA 5L8TA 4GPJA 5C87A 2DKWA 5CY9A 4O7AA 5DYXA 4TT6A 3U5MA 4QR4A 3HMHA 5HFQA 4QUUA 5HENA 4CLBA 5G4SA 4YH4A 4YYGA 5DW1A 4HXKA 2DWWA 4MR5A 5CZGA 5F25A 5D3TA 5D24A 4CUSA 5EQ1A 3O37A 4IR6A 4F3IA 2RI7A 4UIUA 5L96A 4CFLA 2YYNA 4PCIA 4NYXA 5F36A 4YBMA 4YADA 4PY6A 5L8UA 3QZTA 5LVQA 5A83A 1F68A 2WP1A 4ZW1A 2NXBA 5FE8A 2E7OA 4IR5A 5DFCA 4YYKA 3JVJA 5C4QA 2KTBB 5HQ7A 5EWHA 4HXPA 3UV2A 5CQ6A 4A9MA 4OUFA 4QEWA 4ALHA 4O71A 5EI4A 5EVAA 4IORA 4AKNA 2F6JA 4RVRA 4A9IA 5CRMA 5AD3A 3MB3A 5A5RA 5CGPA 4HXSA 5KO4A 4O74A 4O70A 4QUTA 4Z6IA 5LKTA 5DKHA 2H60A 2MJVB 4UYDA 4YY6A 4LYWA 4LR6A 5HQ6A 4QSRA 5FE2A 4LZRA 5E7DA 4MR6A 5EWDA 4HBXA 3U5LA 5ETDA 5I7YA 5A5PA 3UVDA 5EU1A 3JVMA 4PTBA 2DVSA 2RFJA 5EV9A 3HMEA 5A7CA 5CQ3A 5A85A 5E9KA 4QC3A 4A9HA 5AMEA 5HJCA 5D3RA 3FKMX 5CP5A 4A9JA 5TB6A 5H1TA 5EPBA 4J1PA 4UYGA 3QZVA 2I8NA 5F2PA 5CUCA 4HXNA 3UVYA 4A9EA 4YBTA 4J3IA 5E9YA 5FE7A 4UIXA 4UIWA 5FBXA 4IR4A 5F1HA 5D3HA 4HXLA 5E74A 3MXFA 5E9IA 5L97A 4LZSA 4YYJA 3ONIA 5DLXA 2R0SA 4NR4A 5C7NA 4O72A 3NXBA 4NS5A 4TT2A 5HFRA 4NRAA 4WHWA 5EK9A 4TQNA 3AADA 5FE3A 2DATA 4O7FA 3MB4A 3UVWA 2OUOA 5A5QA 3DWYA 5DBMA 5LJ2A 5ENEA 4NYWA 4C67A 5JI8A 4PKLA 5DY7A 3MULA 4Q0NA 3U5PA 3QZSA 5E9VA 5BT4A 5IIDA 4OGJA 4QSXA 5C89A 5HM0A 4IR3A 5CUGA 3P1FA 5D3JA 4CUPA 5CUEA 4NRCA 4NRBA 2YEKA 3LQHA 4XY8A 3G0LA 4A9FA 5I1QA 5D7XA 5CUDA 4LDFA 5FH8A 4NYVA 5DKCA 4MEQA 4YYMA 2R0YA 4YH3A 4CL9A 4XUBA 3DAIA 5E9MA 3LJWA 5D3SA 3O35A 5FH7A 5KTUA 4WHUA 4HBYA 4XUAA 5HCLA 4O77A 5E3DA 5H1VA 4J0SA 3LQJA 4BHWA 4QY4A 5FE0A 5E9LA 5FB0A 2YEMA 5ENFA 5FE5A 4O76A 4MENA 5KU3A 2L85A 4TZ8A 4QR5A 4UYHA 5FE9A 5HRWA 5CPEA 4CUTA 5C85A 2FSAA 4IOQA 5IBNA 4NXJA 4QSPA 5EISA 4NR7A 5CTLA 5II1A 5CRZA 1ZS5A 2R10A 5FE4A 5DFDA 1JM4B 4YAXA 4A9LA 5TCMA 4ZQLA 4J0RA 4TU6A 4QZSA 3GG3A 3HMFA 4TTEA 4NUDA 5FH6A 4HBVA 5KTXA 5F1LA 5FE6A 5A5OA 5AD2A 5ACYA 1E6IA 5BT3A 3UV5A 2WP2A 4Z1QA 5F60A 5E3GA 5LJ0A 3O33A 4FLPA 5EP7A 5ENJA 4N4GA 3S92A 5CQAA 4HXMA 5L99A 3ZYUA 1WUMA 5ENBA 5IGMA 3I3JA 4LC2A 5F61A 3D7CA 5D3PA 2YELA 4IOOA 5D26A 3K2JA 5I80A 4UIZA 2D82A 3P1CA 5AMFA 3IU5A 5F62A 3RCWA 5CUBA 3O36A 4Z6HA 5LJ1A 3P5OA 4O7CA 4Q0OA 5FB1A 4YYDA 3U5NA 5CQ8A 5EPSA 3LQIA 5ENCA 5A81A 2GRCA 5A5NA 4LYSA 5FE1A 4BW2A 4UITA 4YATA 4NR6A 5K29A 5I83A 4KCXA 3SVGA 4ALGA 4E96A 3MQMA 4ZC9A 3UVXA 2E7NA 4NR8A 5KTWA 4N3WA 4XYAA 4OGIA 2D9EA 4Z93A 3UW9A 3O34A 5DLZA 4QC1A 3U5JA 4MR4A 4NUEA 5I29A 4TU4A 4C66A 5EICA 4DONA 4O78A 5E0RA 5FG5A 4NR5A 5LUUA 5F5ZA 1X0JA 5HRXA 4CFKA 4MEPA 5I88A 4TZ2A 5COIA 4A9NA 4BJXA 5FFWA 4XY9A 4YC9A 5G4RA 4HXRA 5LVRA 2R0VA 2YDWA 5HLSA 5CQ4A 5F63A 5ETBA 5CQTA 1JSPB 4LYIA 2RNWA 5I86A 2I7KA 4O7BA 3IU6A 5CU8A 4YYNA 5FFYA 4UIVA 2LSPB 5FFVA 4QEUA 4NUCA 4PCEA 4UYEA 4KV4A 5A82A 2OSSA 4HXOA 1WUGA 5C8GA 4O75A 5ENIA 5CQ5A 5LKXA 3LXJA 5H85A 2F6NA 5II2A 4YK0A 4X2IA 3SVFA 5FG6A 5HQ5A 5IGLA 5I40A 2L84A 4QSVA 4QYDA 5A5SA 3JVKA 3Q2FA 3U5OA 4HBWA 4QSTA 4N4HA 5FG4A 2RNXA 2OO1A 4UIYA 5DKDA 4TYLA 5KHMA 2G4AA 4MEOA 5D3NA 2DVVA 4LRGA 2YQDA 4NQNA 3Q2EA 4QSSA 5HRVA 4TS8A 2E3KA 3S91A 3SVHA 5DYAA 5EM3A 4A9OA 5E73A 5HELA 4UYFB 4YYIA 2N9GA 3TLPA 5DX4A 5EPRA 4N4IA 5DYUA 4UYFA 4QSQA 4MR3A 4YYHA 5EA1A 5LKZA 4QEVA 4QSUA 5EWCA 5I7XA 4A9KA 3JVLA 5EWWA 5CFWA 4CUQA 4YABA 3AQAA 4Z1SA 5IG6A 1N72A 4O7EA 4LZ2A 5DW2A 2RO1A 5D3LA 4CUUA 5EGUA 4WIVA 5ENGA 5DFBA 4YBSA 5JWMA 4TT4A 5IGNA 4QBMA 4NR9A 5D25A 5F3AA 4QNSA 4QSWA 5FDZA 5DYCA 2DVQA 1EQFA 5I89A 4CURA 4Y03A 5J0DA 5LKUA 5IGKA 5L98A 4KV1A 5H1UA 3P1EA 3U5KA 3UV4A 4BW4A 5D0CA 5CUAA 5EWVA 4BW1A 5ENHA 4NQMA 4QB3A 2RS9B 5CS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR3 A;  2DVR A;  5BT5 A;  3P1D A;  4YY4 A;  2YW5 A;  3G0J A;  2RNY A;  4PS5 A;  5HEM A;  4N4F A;  4QYL A;  2L5E A;  5CQ7 A;  4BW3 A;  3MUK A;  5L8T A;  4GPJ A;  5C87 A;  2DKW A;  5CY9 A;  4O7A A;  5DYX A;  4TT6 A;  3U5M A;  4QR4 A;  3HMH A;  5HFQ A;  4QUU A;  5HEN A;  4CLB A;  5G4S A;  4YH4 A;  4YYG A;  5DW1 A;  4HXK A;  2DWW A;  4MR5 A;  5CZG A;  5F25 A;  5D3T A;  5D24 A;  4CUS A;  5EQ1 A;  3O37 A;  4IR6 A;  4F3I A;  2RI7 A;  4UIU A;  5L96 A;  4CFL A;  2YYN A;  4PCI A;  4NYX A;  5F36 A;  4YBM A;  4YAD A;  4PY6 A;  5L8U A;  3QZT A;  5LVQ A;  5A83 A;  1F68 A;  2WP1 A;  4ZW1 A;  2NXB A;  5FE8 A;  2E7O A;  4IR5 A;  5DFC A;  4YYK A;  3JVJ A;  5C4Q A;  2KTB B;  5HQ7 A;  5EWH A;  4HXP A;  3UV2 A;  5CQ6 A;  4A9M A;  4OUF A;  4QEW A;  4ALH A;  4O71 A;  5EI4 A;  5EVA A;  4IOR A;  4AKN A;  2F6J A;  4RVR A;  4A9I A;  5CRM A;  5AD3 A;  3MB3 A;  5A5R A;  5CGP A;  4HXS A;  5KO4 A;  4O74 A;  4O70 A;  4QUT A;  4Z6I A;  5LKT A;  5DKH A;  2H60 A;  2MJV B;  4UYD A;  4YY6 A;  4LYW A;  4LR6 A;  5HQ6 A;  4QSR A;  5FE2 A;  4LZR A;  5E7D A;  4MR6 A;  5EWD A;  4HBX A;  3U5L A;  5ETD A;  5I7Y A;  5A5P A;  3UVD A;  5EU1 A;  3JVM A;  4PTB A;  2DVS A;  2RFJ A;  5EV9 A;  3HME A;  5A7C A;  5CQ3 A;  5A85 A;  5E9K A;  4QC3 A;  4A9H A;  5AME A;  5HJC A;  5D3R A;  3FKM X;  5CP5 A;  4A9J A;  5TB6 A;  5H1T A;  5EPB A;  4J1P A;  4UYG A;  3QZV A;  2I8N A;  5F2P A;  5CUC A;  4HXN A;  3UVY A;  4A9E A;  4YBT A;  4J3I A;  5E9Y A;  5FE7 A;  4UIX A;  4UIW A;  5FBX A;  4IR4 A;  5F1H A;  5D3H A;  4HXL A;  5E74 A;  3MXF A;  5E9I A;  5L97 A;  4LZS A;  4YYJ A;  3ONI A;  5DLX A;  2R0S A;  4NR4 A;  5C7N A;  4O72 A;  3NXB A;  4NS5 A;  4TT2 A;  5HFR A;  4NRA A;  4WHW A;  5EK9 A;  4TQN A;  3AAD A;  5FE3 A;  2DAT A;  4O7F A;  3MB4 A;  3UVW A;  2OUO A;  5A5Q A;  3DWY A;  5DBM A;  5LJ2 A;  5ENE A;  4NYW A;  4C67 A;  5JI8 A;  4PKL A;  5DY7 A;  3MUL A;  4Q0N A;  3U5P A;  3QZS A;  5E9V A;  5BT4 A;  5IID A;  4OGJ A;  4QSX A;  5C89 A;  5HM0 A;  4IR3 A;  5CUG A;  3P1F A;  5D3J A;  4CUP A;  5CUE A;  4NRC A;  4NRB A;  2YEK A;  3LQH A;  4XY8 A;  3G0L A;  4A9F A;  5I1Q A;  5D7X A;  5CUD A;  4LDF A;  5FH8 A;  4NYV A;  5DKC A;  4MEQ A;  4YYM A;  2R0Y A;  4YH3 A;  4CL9 A;  4XUB A;  3DAI A;  5E9M A;  3LJW A;  5D3S A;  3O35 A;  5FH7 A;  5KTU A;  4WHU A;  4HBY A;  4XUA A;  5HCL A;  4O77 A;  5E3D A;  5H1V A;  4J0S A;  3LQJ A;  4BHW A;  4QY4 A;  5FE0 A;  5E9L A;  5FB0 A;  2YEM A;  5ENF A;  5FE5 A;  4O76 A;  4MEN A;  5KU3 A;  2L85 A;  4TZ8 A;  4QR5 A;  4UYH A;  5FE9 A;  5HRW A;  5CPE A;  4CUT A;  5C85 A;  2FSA A;  4IOQ A;  5IBN A;  4NXJ A;  4QSP A;  5EIS A;  4NR7 A;  5CTL A;  5II1 A;  5CRZ A;  1ZS5 A;  2R10 A;  5FE4 A;  5DFD A;  1JM4 B;  4YAX A;  4A9L A;  5TCM A;  4ZQL A;  4J0R A;  4TU6 A;  4QZS A;  3GG3 A;  3HMF A;  4TTE A;  4NUD A;  5FH6 A;  4HBV A;  5KTX A;  5F1L A;  5FE6 A;  5A5O A;  5AD2 A;  5ACY A;  1E6I A;  5BT3 A;  3UV5 A;  2WP2 A;  4Z1Q A;  5F60 A;  5E3G A;  5LJ0 A;  3O33 A;  4FLP A;  5EP7 A;  5ENJ A;  4N4G A;  3S92 A;  5CQA A;  4HXM A;  5L99 A;  3ZYU A;  1WUM A;  5ENB A;  5IGM A;  3I3J A;  4LC2 A;  5F61 A;  3D7C A;  5D3P A;  2YEL A;  4IOO A;  5D26 A;  3K2J A;  5I80 A;  4UIZ A;  2D82 A;  3P1C A;  5AMF A;  3IU5 A;  5F62 A;  3RCW A;  5CUB A;  3O36 A;  4Z6H A;  5LJ1 A;  3P5O A;  4O7C A;  4Q0O A;  5FB1 A;  4YYD A;  3U5N A;  5CQ8 A;  5EPS A;  3LQI A;  5ENC A;  5A81 A;  2GRC A;  5A5N A;  4LYS A;  5FE1 A;  4BW2 A;  4UIT A;  4YAT A;  4NR6 A;  5K29 A;  5I83 A;  4KCX A;  3SVG A;  4ALG A;  4E96 A;  3MQM A;  4ZC9 A;  3UVX A;  2E7N A;  4NR8 A;  5KTW A;  4N3W A;  4XYA A;  4OGI A;  2D9E A;  4Z93 A;  3UW9 A;  3O34 A;  5DLZ A;  4QC1 A;  3U5J A;  4MR4 A;  4NUE A;  5I29 A;  4TU4 A;  4C66 A;  5EIC A;  4DON A;  4O78 A;  5E0R A;  5FG5 A;  4NR5 A;  5LUU A;  5F5Z A;  1X0J A;  5HRX A;  4CFK A;  4MEP A;  5I88 A;  4TZ2 A;  5COI A;  4A9N A;  4BJX A;  5FFW A;  4XY9 A;  4YC9 A;  5G4R A;  4HXR A;  5LVR A;  2R0V A;  2YDW A;  5HLS A;  5CQ4 A;  5F63 A;  5ETB A;  5CQT A;  1JSP B;  4LYI A;  2RNW A;  5I86 A;  2I7K A;  4O7B A;  3IU6 A;  5CU8 A;  4YYN A;  5FFY A;  4UIV A;  2LSP B;  5FFV A;  4QEU A;  4NUC A;  4PCE A;  4UYE A;  4KV4 A;  5A82 A;  2OSS A;  4HXO A;  1WUG A;  5C8G A;  4O75 A;  5ENI A;  5CQ5 A;  5LKX A;  3LXJ A;  5H85 A;  2F6N A;  5II2 A;  4YK0 A;  4X2I A;  3SVF A;  5FG6 A;  5HQ5 A;  5IGL A;  5I40 A;  2L84 A;  4QSV A;  4QYD A;  5A5S A;  3JVK A;  3Q2F A;  3U5O A;  4HBW A;  4QST A;  4N4H A;  5FG4 A;  2RNX A;  2OO1 A;  4UIY A;  5DKD A;  4TYL A;  5KHM A;  2G4A A;  4MEO A;  5D3N A;  2DVV A;  4LRG A;  2YQD A;  4NQN A;  3Q2E A;  4QSS A;  5HRV A;  4TS8 A;  2E3K A;  3S91 A;  3SVH A;  5DYA A;  5EM3 A;  4A9O A;  5E73 A;  5HEL A;  4UYF B;  4YYI A;  2N9G A;  3TLP A;  5DX4 A;  5EPR A;  4N4I A;  5DYU A;  4UYF A;  4QSQ A;  4MR3 A;  4YYH A;  5EA1 A;  5LKZ A;  4QEV A;  4QSU A;  5EWC A;  5I7X A;  4A9K A;  3JVL A;  5EWW A;  5CFW A;  4CUQ A;  4YAB A;  3AQA A;  4Z1S A;  5IG6 A;  1N72 A;  4O7E A;  4LZ2 A;  5DW2 A;  2RO1 A;  5D3L A;  4CUU A;  5EGU A;  4WIV A;  5ENG A;  5DFB A;  4YBS A;  5JWM A;  4TT4 A;  5IGN A;  4QBM A;  4NR9 A;  5D25 A;  5F3A A;  4QNS A;  4QSW A;  5FDZ A;  5DYC A;  2DVQ A;  1EQF A;  5I89 A;  4CUR A;  4Y03 A;  5J0D A;  5LKU A;  5IGK A;  5L98 A;  4KV1 A;  5H1U A;  3P1E A;  3U5K A;  3UV4 A;  4BW4 A;  5D0C A;  5CUA A;  5EWV A;  4BW1 A;  5ENH A;  4NQM A;  4QB3 A;  2RS9 B;  5CS8 A; 
#chains in the Genus database with same CATH topology
 4QR3 A;  2DVR A;  5BT5 A;  3P1D A;  4YY4 A;  2YW5 A;  3G0J A;  2RNY A;  4PS5 A;  5HEM A;  1PUO A;  4N4F A;  4QYL A;  2L5E A;  5CQ7 A;  4BW3 A;  3MUK A;  5L8T A;  4GPJ A;  5C87 A;  2DKW A;  5CY9 A;  4O7A A;  5DYX A;  4TT6 A;  3U5M A;  4QR4 A;  3HMH A;  5HFQ A;  4QUU A;  5HEN A;  4CLB A;  5G4S A;  4YH4 A;  3ERR A;  4YYG A;  5DW1 A;  4HXK A;  2DWW A;  4MR5 A;  5CZG A;  5F25 A;  5D3T A;  5D24 A;  4CUS A;  5EQ1 A;  3O37 A;  4IR6 A;  4F3I A;  2RI7 A;  4UIU A;  5L96 A;  4CFL A;  2YYN A;  4PCI A;  4NYX A;  5F36 A;  4YBM A;  4YAD A;  4PY6 A;  5L8U A;  3QZT A;  5LVQ A;  5A83 A;  1F68 A;  2WP1 A;  4ZW1 A;  2NXB A;  5FE8 A;  2E7O A;  4IR5 A;  5DFC A;  1ZKR A;  4YYK A;  3JVJ A;  5C4Q A;  2KTB B;  5HQ7 A;  5EWH A;  4HXP A;  3UV2 A;  5CQ6 A;  4A9M A;  4OUF A;  4QEW A;  4ALH A;  4O71 A;  5EI4 A;  5EVA A;  4IOR A;  4AKN A;  2F6J A;  4RVR A;  4A9I A;  3D1D A;  5CRM A;  5AD3 A;  3MB3 A;  5A5R A;  5CGP A;  4HXS A;  5KO4 A;  4O74 A;  4O70 A;  4QUT A;  4Z6I A;  5LKT A;  5DKH A;  2H60 A;  2MJV B;  4UYD A;  4YY6 A;  4LYW A;  4LR6 A;  5HQ6 A;  4QSR A;  5FE2 A;  4LZR A;  5E7D A;  4MR6 A;  5EWD A;  4HBX A;  3U5L A;  5ETD A;  5I7Y A;  5A5P A;  3UVD A;  5EU1 A;  3JVM A;  4PTB A;  2DVS A;  2RFJ A;  5EV9 A;  3HME A;  5A7C A;  5CQ3 A;  5A85 A;  5E9K A;  4QC3 A;  4A9H A;  5AME A;  5HJC A;  5D3R A;  3FKM X;  5CP5 A;  4A9J A;  5TB6 A;  5H1T A;  5EPB A;  4AKH A;  4J1P A;  4UYG A;  3QZV A;  2I8N A;  5F2P A;  5CUC A;  4HXN A;  3UVY A;  4A9E A;  4YBT A;  4J3I A;  5E9Y A;  5FE7 A;  4UIX A;  4UIW A;  5FBX A;  4IR4 A;  5F1H A;  5D3H A;  4HXL A;  5E74 A;  3MXF A;  5E9I A;  5L97 A;  4LZS A;  4YYJ A;  3ONI A;  5DLX A;  2R0S A;  4NR4 A;  5C7N A;  4O72 A;  3NXB A;  4NS5 A;  4TT2 A;  5HFR A;  4NRA A;  4WHW A;  5EK9 A;  4TQN A;  3AAD A;  5FE3 A;  2DAT A;  4O7F A;  3MB4 A;  3UVW A;  2OUO A;  5A5Q A;  3DWY A;  5DBM A;  5LJ2 A;  5ENE A;  4NYW A;  4C67 A;  5JI8 A;  4PKL A;  5DY7 A;  3MUL A;  4Q0N A;  3U5P A;  3QZS A;  5E9V A;  5BT4 A;  5IID A;  4OGJ A;  4QSX A;  5C89 A;  5HM0 A;  4IR3 A;  5CUG A;  3P1F A;  5D3J A;  4CUP A;  5CUE A;  4NRC A;  4NRB A;  2YEK A;  3LQH A;  4XY8 A;  3G0L A;  4A9F A;  5I1Q A;  5D7X A;  5CUD A;  4LDF A;  5FH8 A;  4NYV A;  5DKC A;  4MEQ A;  4YYM A;  2R0Y A;  4YH3 A;  4CL9 A;  4XUB A;  3DAI A;  5E9M A;  3LJW A;  5D3S A;  3O35 A;  5FH7 A;  5KTU A;  4WHU A;  4HBY A;  4XUA A;  5HCL A;  4O77 A;  3VKG A;  5E3D A;  5H1V A;  3VKH A;  4J0S A;  3LQJ A;  4BHW A;  4QY4 A;  5FE0 A;  5E9L A;  5FB0 A;  4AKI A;  2YEM A;  5ENF A;  5FE5 A;  4O76 A;  4MEN A;  5KU3 A;  2L85 A;  4TZ8 A;  4QR5 A;  4UYH A;  5FE9 A;  5HRW A;  5CPE A;  4CUT A;  5C85 A;  2FSA A;  4IOQ A;  5IBN A;  4NXJ A;  4QSP A;  5EIS A;  4NR7 A;  5CTL A;  5II1 A;  5CRZ A;  1ZS5 A;  2R10 A;  5FE4 A;  5DFD A;  1JM4 B;  4YAX A;  4A9L A;  5TCM A;  4ZQL A;  4J0R A;  4TU6 A;  4AI6 A;  4QZS A;  3GG3 A;  3HMF A;  4TTE A;  4NUD A;  5FH6 A;  4HBV A;  5KTX A;  5F1L A;  2EJN A;  5FE6 A;  4AKG A;  5A5O A;  5AD2 A;  5ACY A;  1E6I A;  5BT3 A;  3UV5 A;  2WP2 A;  4Z1Q A;  5F60 A;  5E3G A;  5LJ0 A;  3O33 A;  4FLP A;  5EP7 A;  5ENJ A;  4N4G A;  3S92 A;  5CQA A;  4HXM A;  5L99 A;  3ZYU A;  1WUM A;  5ENB A;  5IGM A;  3I3J A;  4LC2 A;  5F61 A;  3D7C A;  5D3P A;  2YEL A;  4IOO A;  5D26 A;  3K2J A;  5I80 A;  4UIZ A;  2D82 A;  3P1C A;  5AMF A;  3IU5 A;  5F62 A;  3RCW A;  5CUB A;  3O36 A;  4Z6H A;  5LJ1 A;  3P5O A;  4O7C A;  4Q0O A;  5FB1 A;  4YYD A;  3U5N A;  5CQ8 A;  5EPS A;  3LQI A;  5ENC A;  5A81 A;  2GRC A;  5A5N A;  4LYS A;  5FE1 A;  4BW2 A;  4UIT A;  4YAT A;  4NR6 A;  5K29 A;  5I83 A;  4KCX A;  3SVG A;  4ALG A;  4E96 A;  3MQM A;  4ZC9 A;  3UVX A;  2E7N A;  4NR8 A;  5KTW A;  4N3W A;  4XYA A;  4OGI A;  2D9E A;  4Z93 A;  3UW9 A;  3O34 A;  5DLZ A;  4QC1 A;  3U5J A;  4MR4 A;  4NUE A;  5I29 A;  4TU4 A;  4C66 A;  5EIC A;  4DON A;  4O78 A;  3D1B A;  5E0R A;  5FG5 A;  4NR5 A;  5LUU A;  5F5Z A;  1X0J A;  5HRX A;  4CFK A;  4MEP A;  5I88 A;  4TZ2 A;  5COI A;  4A9N A;  4BJX A;  5FFW A;  4XY9 A;  4YC9 A;  5G4R A;  4HXR A;  5LVR A;  2R0V A;  2YDW A;  5HLS A;  5CQ4 A;  5F63 A;  5ETB A;  5CQT A;  1JSP B;  4LYI A;  2RNW A;  5I86 A;  2I7K A;  4O7B A;  3IU6 A;  5CU8 A;  4YYN A;  5FFY A;  4UIV A;  2LSP B;  5FFV A;  4QEU A;  4NUC A;  4PCE A;  4UYE A;  4KV4 A;  5A82 A;  2OSS A;  4HXO A;  1WUG A;  5C8G A;  4O75 A;  5ENI A;  5CQ5 A;  5LKX A;  3LXJ A;  5H85 A;  2F6N A;  5II2 A;  4YK0 A;  4X2I A;  3SVF A;  5FG6 A;  5HQ5 A;  5IGL A;  5I40 A;  2L84 A;  4QSV A;  4QYD A;  5A5S A;  3JVK A;  3Q2F A;  3U5O A;  4HBW A;  4QST A;  4N4H A;  5FG4 A;  2RNX A;  2OO1 A;  4UIY A;  5DKD A;  4TYL A;  5KHM A;  2G4A A;  4MEO A;  5D3N A;  2DVV A;  4LRG A;  2YQD A;  4NQN A;  3Q2E A;  4QSS A;  5HRV A;  4TS8 A;  2E3K A;  3S91 A;  3SVH A;  5DYA A;  5EM3 A;  4A9O A;  5E73 A;  5HEL A;  4UYF B;  4YYI A;  2N9G A;  3TLP A;  5DX4 A;  5EPR A;  4N4I A;  5DYU A;  4UYF A;  4QSQ A;  4MR3 A;  4YYH A;  5EA1 A;  5LKZ A;  4QEV A;  4QSU A;  5EWC A;  5I7X A;  4A9K A;  3JVL A;  5EWW A;  5CFW A;  4CUQ A;  4YAB A;  3AQA A;  4Z1S A;  5IG6 A;  1N72 A;  4O7E A;  4LZ2 A;  5DW2 A;  2RO1 A;  5D3L A;  4CUU A;  5EGU A;  4WIV A;  5ENG A;  5DFB A;  4YBS A;  5JWM A;  4TT4 A;  5IGN A;  4QBM A;  4NR9 A;  5D25 A;  5F3A A;  4QNS A;  4QSW A;  5FDZ A;  5DYC A;  2DVQ A;  1EQF A;  5I89 A;  4CUR A;  4Y03 A;  5J0D A;  5LKU A;  5IGK A;  5L98 A;  4KV1 A;  5H1U A;  3P1E A;  3U5K A;  3UV4 A;  4BW4 A;  5D0C A;  5CUA A;  5EWV A;  4BW1 A;  5ENH A;  4NQM A;  4QB3 A;  2RS9 B;  5CS8 A; 
#chains in the Genus database with same CATH homology
 4QR3 A;  2DVR A;  5BT5 A;  3P1D A;  4YY4 A;  2YW5 A;  3G0J A;  2RNY A;  4PS5 A;  5HEM A;  4N4F A;  4QYL A;  2L5E A;  5CQ7 A;  4BW3 A;  3MUK A;  5L8T A;  4GPJ A;  5C87 A;  2DKW A;  5CY9 A;  4O7A A;  5DYX A;  4TT6 A;  3U5M A;  4QR4 A;  3HMH A;  5HFQ A;  4QUU A;  5HEN A;  4CLB A;  5G4S A;  4YH4 A;  4YYG A;  5DW1 A;  4HXK A;  2DWW A;  4MR5 A;  5CZG A;  5F25 A;  5D3T A;  5D24 A;  4CUS A;  5EQ1 A;  3O37 A;  4IR6 A;  4F3I A;  2RI7 A;  4UIU A;  5L96 A;  4CFL A;  2YYN A;  4PCI A;  4NYX A;  5F36 A;  4YBM A;  4YAD A;  4PY6 A;  5L8U A;  3QZT A;  5LVQ A;  5A83 A;  1F68 A;  2WP1 A;  4ZW1 A;  2NXB A;  5FE8 A;  2E7O A;  4IR5 A;  5DFC A;  4YYK A;  3JVJ A;  5C4Q A;  2KTB B;  5HQ7 A;  5EWH A;  4HXP A;  3UV2 A;  5CQ6 A;  4A9M A;  4OUF A;  4QEW A;  4ALH A;  4O71 A;  5EI4 A;  5EVA A;  4IOR A;  4AKN A;  2F6J A;  4RVR A;  4A9I A;  5CRM A;  5AD3 A;  3MB3 A;  5A5R A;  5CGP A;  4HXS A;  5KO4 A;  4O74 A;  4O70 A;  4QUT A;  4Z6I A;  5LKT A;  5DKH A;  2H60 A;  2MJV B;  4UYD A;  4YY6 A;  4LYW A;  4LR6 A;  5HQ6 A;  4QSR A;  5FE2 A;  4LZR A;  5E7D A;  4MR6 A;  5EWD A;  4HBX A;  3U5L A;  5ETD A;  5I7Y A;  5A5P A;  3UVD A;  5EU1 A;  3JVM A;  4PTB A;  2DVS A;  2RFJ A;  5EV9 A;  3HME A;  5A7C A;  5CQ3 A;  5A85 A;  5E9K A;  4QC3 A;  4A9H A;  5AME A;  5HJC A;  5D3R A;  3FKM X;  5CP5 A;  4A9J A;  5TB6 A;  5H1T A;  5EPB A;  4J1P A;  4UYG A;  3QZV A;  2I8N A;  5F2P A;  5CUC A;  4HXN A;  3UVY A;  4A9E A;  4YBT A;  4J3I A;  5E9Y A;  5FE7 A;  4UIX A;  4UIW A;  5FBX A;  4IR4 A;  5F1H A;  5D3H A;  4HXL A;  5E74 A;  3MXF A;  5E9I A;  5L97 A;  4LZS A;  4YYJ A;  3ONI A;  5DLX A;  2R0S A;  4NR4 A;  5C7N A;  4O72 A;  3NXB A;  4NS5 A;  4TT2 A;  5HFR A;  4NRA A;  4WHW A;  5EK9 A;  4TQN A;  3AAD A;  5FE3 A;  2DAT A;  4O7F A;  3MB4 A;  3UVW A;  2OUO A;  5A5Q A;  3DWY A;  5DBM A;  5LJ2 A;  5ENE A;  4NYW A;  4C67 A;  5JI8 A;  4PKL A;  5DY7 A;  3MUL A;  4Q0N A;  3U5P A;  3QZS A;  5E9V A;  5BT4 A;  5IID A;  4OGJ A;  4QSX A;  5C89 A;  5HM0 A;  4IR3 A;  5CUG A;  3P1F A;  5D3J A;  4CUP A;  5CUE A;  4NRC A;  4NRB A;  2YEK A;  3LQH A;  4XY8 A;  3G0L A;  4A9F A;  5I1Q A;  5D7X A;  5CUD A;  4LDF A;  5FH8 A;  4NYV A;  5DKC A;  4MEQ A;  4YYM A;  2R0Y A;  4YH3 A;  4CL9 A;  4XUB A;  3DAI A;  5E9M A;  3LJW A;  5D3S A;  3O35 A;  5FH7 A;  5KTU A;  4WHU A;  4HBY A;  4XUA A;  5HCL A;  4O77 A;  5E3D A;  5H1V A;  4J0S A;  3LQJ A;  4BHW A;  4QY4 A;  5FE0 A;  5E9L A;  5FB0 A;  2YEM A;  5ENF A;  5FE5 A;  4O76 A;  4MEN A;  5KU3 A;  2L85 A;  4TZ8 A;  4QR5 A;  4UYH A;  5FE9 A;  5HRW A;  5CPE A;  4CUT A;  5C85 A;  2FSA A;  4IOQ A;  5IBN A;  4NXJ A;  4QSP A;  5EIS A;  4NR7 A;  5CTL A;  5II1 A;  5CRZ A;  1ZS5 A;  2R10 A;  5FE4 A;  5DFD A;  1JM4 B;  4YAX A;  4A9L A;  5TCM A;  4ZQL A;  4J0R A;  4TU6 A;  4QZS A;  3GG3 A;  3HMF A;  4TTE A;  4NUD A;  5FH6 A;  4HBV A;  5KTX A;  5F1L A;  5FE6 A;  5A5O A;  5AD2 A;  5ACY A;  1E6I A;  5BT3 A;  3UV5 A;  2WP2 A;  4Z1Q A;  5F60 A;  5E3G A;  5LJ0 A;  3O33 A;  4FLP A;  5EP7 A;  5ENJ A;  4N4G A;  3S92 A;  5CQA A;  4HXM A;  5L99 A;  3ZYU A;  1WUM A;  5ENB A;  5IGM A;  3I3J A;  4LC2 A;  5F61 A;  3D7C A;  5D3P A;  2YEL A;  4IOO A;  5D26 A;  3K2J A;  5I80 A;  4UIZ A;  2D82 A;  3P1C A;  5AMF A;  3IU5 A;  5F62 A;  3RCW A;  5CUB A;  3O36 A;  4Z6H A;  5LJ1 A;  3P5O A;  4O7C A;  4Q0O A;  5FB1 A;  4YYD A;  3U5N A;  5CQ8 A;  5EPS A;  3LQI A;  5ENC A;  5A81 A;  2GRC A;  5A5N A;  4LYS A;  5FE1 A;  4BW2 A;  4UIT A;  4YAT A;  4NR6 A;  5K29 A;  5I83 A;  4KCX A;  3SVG A;  4ALG A;  4E96 A;  3MQM A;  4ZC9 A;  3UVX A;  2E7N A;  4NR8 A;  5KTW A;  4N3W A;  4XYA A;  4OGI A;  2D9E A;  4Z93 A;  3UW9 A;  3O34 A;  5DLZ A;  4QC1 A;  3U5J A;  4MR4 A;  4NUE A;  5I29 A;  4TU4 A;  4C66 A;  5EIC A;  4DON A;  4O78 A;  5E0R A;  5FG5 A;  4NR5 A;  5LUU A;  5F5Z A;  1X0J A;  5HRX A;  4CFK A;  4MEP A;  5I88 A;  4TZ2 A;  5COI A;  4A9N A;  4BJX A;  5FFW A;  4XY9 A;  4YC9 A;  5G4R A;  4HXR A;  5LVR A;  2R0V A;  2YDW A;  5HLS A;  5CQ4 A;  5F63 A;  5ETB A;  5CQT A;  1JSP B;  4LYI A;  2RNW A;  5I86 A;  2I7K A;  4O7B A;  3IU6 A;  5CU8 A;  4YYN A;  5FFY A;  4UIV A;  2LSP B;  5FFV A;  4QEU A;  4NUC A;  4PCE A;  4UYE A;  4KV4 A;  5A82 A;  2OSS A;  4HXO A;  1WUG A;  5C8G A;  4O75 A;  5ENI A;  5CQ5 A;  5LKX A;  3LXJ A;  5H85 A;  2F6N A;  5II2 A;  4YK0 A;  4X2I A;  3SVF A;  5FG6 A;  5HQ5 A;  5IGL A;  5I40 A;  2L84 A;  4QSV A;  4QYD A;  5A5S A;  3JVK A;  3Q2F A;  3U5O A;  4HBW A;  4QST A;  4N4H A;  5FG4 A;  2RNX A;  2OO1 A;  4UIY A;  5DKD A;  4TYL A;  5KHM A;  2G4A A;  4MEO A;  5D3N A;  2DVV A;  4LRG A;  2YQD A;  4NQN A;  3Q2E A;  4QSS A;  5HRV A;  4TS8 A;  2E3K A;  3S91 A;  3SVH A;  5DYA A;  5EM3 A;  4A9O A;  5E73 A;  5HEL A;  4UYF B;  4YYI A;  2N9G A;  3TLP A;  5DX4 A;  5EPR A;  4N4I A;  5DYU A;  4UYF A;  4QSQ A;  4MR3 A;  4YYH A;  5EA1 A;  5LKZ A;  4QEV A;  4QSU A;  5EWC A;  5I7X A;  4A9K A;  3JVL A;  5EWW A;  5CFW A;  4CUQ A;  4YAB A;  3AQA A;  4Z1S A;  5IG6 A;  1N72 A;  4O7E A;  4LZ2 A;  5DW2 A;  2RO1 A;  5D3L A;  4CUU A;  5EGU A;  4WIV A;  5ENG A;  5DFB A;  4YBS A;  5JWM A;  4TT4 A;  5IGN A;  4QBM A;  4NR9 A;  5D25 A;  5F3A A;  4QNS A;  4QSW A;  5FDZ A;  5DYC A;  2DVQ A;  1EQF A;  5I89 A;  4CUR A;  4Y03 A;  5J0D A;  5LKU A;  5IGK A;  5L98 A;  4KV1 A;  5H1U A;  3P1E A;  3U5K A;  3UV4 A;  4BW4 A;  5D0C A;  5CUA A;  5EWV A;  4BW1 A;  5ENH A;  4NQM A;  4QB3 A;  2RS9 B;  5CS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...