5A82A

Crystal structure of human atad2 bromodomain in complex with 4-(3r,4r) -4-(3-methyl-2-oxo-1,2-dihydro-1,7-naphthyridin-8-yl)aminopiperidin-3- yloxymethyl)-1-thiane-1,1-dione
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Inhibitor
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Structure-Based Optimization of Naphthyridones Into Potent Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a82A00
3LXJA 4BW3A 2D9EA 5A5QA 5L8UA 5CUBA 4QYLA 5D3NA 5D7XA 5AMEA 4WHWA 5IGMA 5F36A 4IORA 5FG4A 4YYGA 3QZVA 4MEOA 5E9VA 3MB4A 5AD3A 1ZS5A 3G0JA 4TU4A 5DKCA 4YYDA 5CGPA 4YYMA 3QZSA 4AKNA 5C87A 4ALGA 4YABA 4ZC9A 3IU5A 5EQ1A 4IR6A 4NRBA 2YQDA 5AMFA 2DVSA 3NXBA 5E9IA 4UYFB 5ENBA 4OUFA 5DLXA 3DAIA 1X0JA 3AQAA 4LC2A 2KTBB 3HMEA 5ENIA 4J1PA 4NYWA 5F1HA 5A82A 3FKMX 5EA1A 2L85A 5FH7A 5HFRA 2YELA 5CQTA 5D3PA 3Q2FA 4NR5A 5FE2A 5F5ZA 4YH4A 5FH8A 2I7KA 4YADA 5C8GA 4XY9A 2F6NA 5L8TA 4HXNA 5CUEA 4A9IA 4N4GA 4UIXA 5CU8A 2E7NA 5HEMA 4QZSA 5HCLA 4XYAA 5A83A 4TT2A 4LRGA 5IBNA 5F2PA 4LYSA 4QSPA 3MULA 2DWWA 4QSXA 5DYXA 5EVAA 3P1EA 5A5SA 1EQFA 5DBMA 4BW2A 2MJVB 5LJ0A 4NR7A 1WUGA 3DWYA 4YYIA 2F6JA 4UYDA 5HRXA 3S91A 4HBVA 4OGJA 5L99A 4DONA 4UITA 5CZGA 4NRCA 4N4FA 4QNSA 4IR4A 3MQMA 4O70A 5ENHA 4HXLA 4UIUA 3U5NA 3HMHA 5CUGA 5CRZA 3UVXA 4O74A 5DFCA 5F62A 5EP7A 5C89A 5EV9A 5CTLA 5DYCA 4A9LA 4PKLA 2R0SA 5F63A 4Z6IA 4YY6A 5D0CA 4O77A 5FE3A 3RCWA 5BT5A 4TTEA 4NYVA 5A5NA 4QEWA 4BJXA 5D3HA 4YH3A 4NRAA 4QY4A 3QZTA 4A9HA 4O7AA 5FE4A 2E3KA 3Q2EA 4O71A 5AD2A 2R0YA 4O7EA 2RFJA 5DYAA 5E9LA 5FE5A 4CL9A 2FSAA 5ENFA 5KTUA 4QEUA 3SVFA 3MB3A 2R10A 2OUOA 4LDFA 3P1DA 5E9KA 5I29A 2DVQA 4TT4A 5ENEA 4Z1SA 4X2IA 3UVYA 4YYNA 5BT4A 4TS8A 5DW2A 3UV2A 5KTXA 5CQ4A 4C67A 5I80A 2WP2A 4A9EA 4TT6A 4IOQA 5CPEA 5E0RA 4QC3A 2OSSA 4QSWA 5F25A 4QSTA 4QB3A 4UIVA 4QSRA 5HM0A 4NYXA 4E96A 2R0VA 4HXOA 1JM4B 5CRMA 5CQ7A 5KTWA 5EPSA 2YYNA 5TCMA 5EPBA 5I88A 5FH6A 2N9GA 5E3GA 4IR3A 4FLPA 4MEQA 4HBWA 2YW5A 4NUCA 4NR9A 5FFYA 5A81A 5A5OA 5LKXA 2RNWA 5CQ8A 5EGUA 4PCIA 5C85A 4O7BA 4KCXA 4Q0OA 5I40A 4TU6A 1WUMA 5A5RA 5D3TA 5FFVA 5HQ6A 2H60A 4BW4A 5J0DA 4NUDA 2NXBA 5HRWA 5IIDA 5HJCA 4YY4A 4MR6A 5EWHA 1F68A 5CUAA 4QSSA 4F3IA 4ZQLA 5JI8A 4O76A 3U5JA 4UIZA 4NR8A 5E3DA 5F61A 4RVRA 2G4AA 5G4SA 4YATA 4UYGA 5EU1A 2DVRA 3U5OA 4YYJA 4YYHA 4HBXA 5F1LA 4ALHA 4YBTA 5II1A 5I83A 4C66A 4KV4A 4PS5A 4A9NA 5LVRA 4IOOA 5D24A 5CS8A 2DVVA 4PCEA 5EISA 5CQ3A 3GG3A 3UV5A 2OO1A 5DX4A 3O34A 5E73A 5ENCA 5LUUA 3O36A 4XY8A 5FE7A 2D82A 5H85A 5A85A 3P1FA 4UYFA 4QSQA 4TZ2A 3S92A 3D7CA 4UIYA 4NS5A 4Y03A 3U5PA 3JVMA 4WIVA 3U5LA 5ACYA 5JWMA 5LJ2A 4MR4A 5CQ5A 4CUUA 4HXMA 4MR3A 5KO4A 5CFWA 4LYIA 4N3WA 3LQIA 5K29A 2GRCA 4QR5A 4CUPA 2YEMA 5E9MA 4HXSA 5EI4A 5FE0A 5A5PA 2DATA 5EICA 4CUQA 3G0LA 2I8NA 5HLSA 5IG6A 4WHUA 4PTBA 4CLBA 2E7OA 4Z6HA 5H1TA 5I86A 4NR6A 5L97A 4NQNA 4NUEA 5ENGA 4A9FA 4MENA 1N72A 3JVKA 4N4IA 3LQHA 5E9YA 5EPRA 5H1UA 5DLZA 5KU3A 5FE6A 5II2A 5I1QA 4NR4A 3ZYUA 5L96A 5EM3A 3JVJA 3IU6A 5DKHA 5H1VA 5EK9A 4PY6A 5D3JA 4QUUA 2RI7A 5DY7A 5BT3A 4KV1A 4A9JA 4YC9A 4QUTA 5F60A 5LKUA 5DFBA 2RS9B 4HXKA 2L5EA 4QSVA 4BW1A 4XUAA 5CUCA 2DKWA 2RNYA 5FB0A 2RO1A 4MEPA 1E6IA 3ONIA 5DYUA 4O72A 5D25A 4CURA 4QBMA 4Z1QA 5DW1A 4LZ2A 5I7XA 5EWCA 3U5MA 3HMFA 3AADA 5L98A 5IGKA 4A9KA 4A9OA 3U5KA 4UIWA 4J0SA 5FDZA 5A7CA 5I89A 5FE1A 5E74A 4QSUA 3MXFA 5D26A 5HRVA 5HELA 5EWDA 2YEKA 4UYHA 5FB1A 5FG5A 5KHMA 5CP5A 3TLPA 4Z93A 4XUBA 4LZRA 4QR4A 3LQJA 5LKZA 4QC1A 5COIA 5CY9A 5FE9A 4YAXA 5LJ1A 4CUSA 4UYEA 5CUDA 5EWVA 5G4RA 3O35A 4HXPA 5D3SA 4OGIA 4TZ8A 4ZW1A 5HQ7A 4CFKA 3UW9A 4N4HA 4O7FA 3UV4A 4QR3A 5LVQA 2YDWA 5FBXA 5C4QA 3JVLA 4O7CA 5ETDA 3O33A 5HQ5A 5DFDA 5D3LA 5F3AA 4LZSA 5CQ6A 4CFLA 4MR5A 4YBMA 2WP1A 4A9MA 5CQAA 4NXJA 5ETBA 4HBYA 5TB6A 5C7NA 3K2JA 4GPJA 5E7DA 3UVDA 5FG6A 4HXRA 2RNXA 3I3JA 4QYDA 3SVGA 5FFWA 4LYWA 4J0RA 5ENJA 5FE8A 4CUTA 4YYKA 4YBSA 4BHWA 4QEVA 3LJWA 4YK0A 5IGNA 4Q0NA 5D3RA 2LSPB 4O75A 3SVHA 4LR6A 3P5OA 1JSPB 2L84A 5HFQA 4O78A 5EWWA 3MUKA 4IR5A 4TYLA 5IGLA 4J3IA 4NQMA 3O37A 5LKTA 5I7YA 4TQNA 5HENA 5DKDA 3UVWA 3P1CA
chains in the Genus database with same CATH superfamily
3LXJA 4BW3A 2D9EA 5A5QA 5L8UA 5CUBA 4QYLA 5D3NA 5D7XA 5AMEA 4WHWA 5IGMA 5F36A 4IORA 5FG4A 4YYGA 3QZVA 4MEOA 5E9VA 3MB4A 5AD3A 1ZS5A 3G0JA 4TU4A 5DKCA 4YYDA 5CGPA 4YYMA 3QZSA 4AKNA 5C87A 4ALGA 4YABA 4ZC9A 3IU5A 5EQ1A 4IR6A 4NRBA 2YQDA 5AMFA 2DVSA 3NXBA 5E9IA 4UYFB 5ENBA 4OUFA 5DLXA 3DAIA 1X0JA 3AQAA 4LC2A 2KTBB 3HMEA 5ENIA 4J1PA 4NYWA 5F1HA 5A82A 3FKMX 5EA1A 2L85A 5FH7A 5HFRA 2YELA 5CQTA 5D3PA 3Q2FA 4AI6A 4NR5A 5FE2A 5F5ZA 4YH4A 5FH8A 2I7KA 4YADA 5C8GA 4XY9A 2F6NA 5L8TA 4HXNA 5CUEA 4A9IA 4N4GA 4UIXA 5CU8A 4AKGA 2E7NA 5HEMA 4QZSA 5HCLA 4XYAA 5A83A 4TT2A 4LRGA 5IBNA 5F2PA 4LYSA 4QSPA 3MULA 2DWWA 4QSXA 5DYXA 5EVAA 3P1EA 5A5SA 1EQFA 5DBMA 4BW2A 2MJVB 5LJ0A 4NR7A 1WUGA 3DWYA 4YYIA 2F6JA 4UYDA 5HRXA 3S91A 4HBVA 4OGJA 5L99A 4DONA 4UITA 5CZGA 4NRCA 4N4FA 4QNSA 4IR4A 3MQMA 4O70A 5ENHA 4HXLA 4UIUA 3U5NA 3HMHA 5CUGA 5CRZA 3UVXA 4O74A 5DFCA 5F62A 5EP7A 5C89A 5EV9A 5CTLA 5DYCA 4A9LA 4PKLA 2R0SA 5F63A 4Z6IA 4YY6A 5D0CA 4O77A 5FE3A 3RCWA 5BT5A 4TTEA 4NYVA 5A5NA 4QEWA 4BJXA 5D3HA 4YH3A 4NRAA 4QY4A 3QZTA 4A9HA 4O7AA 5FE4A 2E3KA 3Q2EA 4O71A 5AD2A 2R0YA 4O7EA 2RFJA 5DYAA 5E9LA 5FE5A 4CL9A 2FSAA 5ENFA 5KTUA 4QEUA 3SVFA 3MB3A 2R10A 2OUOA 4LDFA 3P1DA 5E9KA 5I29A 2DVQA 4TT4A 5ENEA 4Z1SA 4X2IA 3UVYA 4YYNA 5BT4A 4TS8A 5DW2A 3UV2A 5KTXA 5CQ4A 4C67A 5I80A 2WP2A 4A9EA 4TT6A 4IOQA 5CPEA 5E0RA 4QC3A 2OSSA 4QSWA 5F25A 4QSTA 4QB3A 4UIVA 4QSRA 4AKIA 5HM0A 4NYXA 4E96A 2R0VA 4HXOA 1JM4B 5CRMA 5CQ7A 5KTWA 5EPSA 2YYNA 5TCMA 5EPBA 5I88A 5FH6A 2N9GA 5E3GA 4IR3A 4FLPA 4MEQA 4HBWA 2YW5A 1ZKRA 4NUCA 4NR9A 5FFYA 5A81A 5A5OA 5LKXA 2RNWA 5CQ8A 5EGUA 4PCIA 5C85A 4O7BA 4KCXA 4Q0OA 5I40A 4TU6A 1WUMA 5A5RA 5D3TA 5FFVA 5HQ6A 2H60A 4BW4A 5J0DA 4NUDA 2NXBA 5HRWA 5IIDA 5HJCA 4YY4A 4MR6A 5EWHA 1F68A 4AKHA 5CUAA 4QSSA 4F3IA 4ZQLA 5JI8A 4O76A 1PUOA 3U5JA 4UIZA 4NR8A 5E3DA 5F61A 4RVRA 2G4AA 5G4SA 4YATA 4UYGA 5EU1A 2DVRA 3U5OA 4YYJA 4YYHA 4HBXA 5F1LA 4ALHA 3D1DA 4YBTA 5II1A 5I83A 4C66A 4KV4A 4PS5A 4A9NA 5LVRA 4IOOA 5D24A 5CS8A 2DVVA 4PCEA 5EISA 5CQ3A 3GG3A 3UV5A 2OO1A 5DX4A 3O34A 5E73A 5ENCA 5LUUA 3O36A 4XY8A 5FE7A 2D82A 5H85A 5A85A 3P1FA 4UYFA 3ERRA 4QSQA 4TZ2A 3S92A 3D7CA 4UIYA 4NS5A 4Y03A 3U5PA 3JVMA 4WIVA 3U5LA 5ACYA 5JWMA 5LJ2A 4MR4A 5CQ5A 4CUUA 4HXMA 4MR3A 5KO4A 5CFWA 4LYIA 4N3WA 3LQIA 5K29A 2GRCA 4QR5A 4CUPA 2YEMA 5E9MA 4HXSA 5EI4A 5FE0A 5A5PA 2DATA 5EICA 4CUQA 3G0LA 2I8NA 5HLSA 5IG6A 4WHUA 4PTBA 4CLBA 2E7OA 4Z6HA 5H1TA 5I86A 4NR6A 5L97A 4NQNA 4NUEA 5ENGA 4A9FA 4MENA 1N72A 3JVKA 4N4IA 3LQHA 5E9YA 5EPRA 5H1UA 5DLZA 5KU3A 5FE6A 5II2A 5I1QA 4NR4A 3ZYUA 5L96A 5EM3A 3JVJA 3IU6A 5DKHA 5H1VA 5EK9A 4PY6A 5D3JA 4QUUA 2RI7A 5DY7A 5BT3A 4KV1A 3VKHA 4A9JA 4YC9A 4QUTA 5F60A 5LKUA 5DFBA 2RS9B 4HXKA 2L5EA 4QSVA 4BW1A 4XUAA 5CUCA 2DKWA 2RNYA 5FB0A 2RO1A 4MEPA 1E6IA 3ONIA 5DYUA 4O72A 5D25A 4CURA 4QBMA 4Z1QA 5DW1A 4LZ2A 5I7XA 5EWCA 3U5MA 3HMFA 3AADA 5L98A 5IGKA 4A9KA 2EJNA 4A9OA 3U5KA 4UIWA 4J0SA 5FDZA 5A7CA 5I89A 5FE1A 5E74A 4QSUA 3MXFA 5D26A 5HRVA 5HELA 5EWDA 2YEKA 4UYHA 5FB1A 5FG5A 5KHMA 5CP5A 3TLPA 4Z93A 4XUBA 4LZRA 4QR4A 3LQJA 5LKZA 4QC1A 5COIA 5CY9A 5FE9A 4YAXA 5LJ1A 4CUSA 4UYEA 5CUDA 5EWVA 5G4RA 3O35A 4HXPA 3D1BA 5D3SA 4OGIA 4TZ8A 4ZW1A 5HQ7A 4CFKA 3UW9A 4N4HA 4O7FA 3UV4A 4QR3A 5LVQA 2YDWA 5FBXA 5C4QA 3JVLA 4O7CA 5ETDA 3O33A 5HQ5A 5DFDA 5D3LA 5F3AA 4LZSA 5CQ6A 4CFLA 4MR5A 4YBMA 2WP1A 4A9MA 5CQAA 4NXJA 5ETBA 4HBYA 5TB6A 5C7NA 3K2JA 3VKGA 4GPJA 5E7DA 3UVDA 5FG6A 4HXRA 2RNXA 3I3JA 4QYDA 3SVGA 5FFWA 4LYWA 4J0RA 5ENJA 5FE8A 4CUTA 4YYKA 4YBSA 4BHWA 4QEVA 3LJWA 4YK0A 5IGNA 4Q0NA 5D3RA 2LSPB 4O75A 3SVHA 4LR6A 3P5OA 1JSPB 2L84A 5HFQA 4O78A 5EWWA 3MUKA 4IR5A 4TYLA 5IGLA 4J3IA 4NQMA 3O37A 5LKTA 5I7YA 4TQNA 5HENA 5DKDA 3UVWA 3P1CA
chains in the Genus database with same CATH topology
3LXJA 4BW3A 2D9EA 5A5QA 5L8UA 5CUBA 4QYLA 5D3NA 5D7XA 5AMEA 4WHWA 5IGMA 5F36A 4IORA 5FG4A 4YYGA 3QZVA 4MEOA 5E9VA 3MB4A 5AD3A 1ZS5A 3G0JA 4TU4A 5DKCA 4YYDA 5CGPA 4YYMA 3QZSA 4AKNA 5C87A 4ALGA 4YABA 4ZC9A 3IU5A 5EQ1A 4IR6A 4NRBA 2YQDA 5AMFA 2DVSA 3NXBA 5E9IA 4UYFB 5ENBA 4OUFA 5DLXA 3DAIA 1X0JA 3AQAA 4LC2A 2KTBB 3HMEA 5ENIA 4J1PA 4NYWA 5F1HA 5A82A 3FKMX 5EA1A 2L85A 5FH7A 5HFRA 2YELA 5CQTA 5D3PA 3Q2FA 4NR5A 5FE2A 5F5ZA 4YH4A 5FH8A 2I7KA 4YADA 5C8GA 4XY9A 2F6NA 5L8TA 4HXNA 5CUEA 4A9IA 4N4GA 4UIXA 5CU8A 2E7NA 5HEMA 4QZSA 5HCLA 4XYAA 5A83A 4TT2A 4LRGA 5IBNA 5F2PA 4LYSA 4QSPA 3MULA 2DWWA 4QSXA 5DYXA 5EVAA 3P1EA 5A5SA 1EQFA 5DBMA 4BW2A 2MJVB 5LJ0A 4NR7A 1WUGA 3DWYA 4YYIA 2F6JA 4UYDA 5HRXA 3S91A 4HBVA 4OGJA 5L99A 4DONA 4UITA 5CZGA 4NRCA 4N4FA 4QNSA 4IR4A 3MQMA 4O70A 5ENHA 4HXLA 4UIUA 3U5NA 3HMHA 5CUGA 5CRZA 3UVXA 4O74A 5DFCA 5F62A 5EP7A 5C89A 5EV9A 5CTLA 5DYCA 4A9LA 4PKLA 2R0SA 5F63A 4Z6IA 4YY6A 5D0CA 4O77A 5FE3A 3RCWA 5BT5A 4TTEA 4NYVA 5A5NA 4QEWA 4BJXA 5D3HA 4YH3A 4NRAA 4QY4A 3QZTA 4A9HA 4O7AA 5FE4A 2E3KA 3Q2EA 4O71A 5AD2A 2R0YA 4O7EA 2RFJA 5DYAA 5E9LA 5FE5A 4CL9A 2FSAA 5ENFA 5KTUA 4QEUA 3SVFA 3MB3A 2R10A 2OUOA 4LDFA 3P1DA 5E9KA 5I29A 2DVQA 4TT4A 5ENEA 4Z1SA 4X2IA 3UVYA 4YYNA 5BT4A 4TS8A 5DW2A 3UV2A 5KTXA 5CQ4A 4C67A 5I80A 2WP2A 4A9EA 4TT6A 4IOQA 5CPEA 5E0RA 4QC3A 2OSSA 4QSWA 5F25A 4QSTA 4QB3A 4UIVA 4QSRA 5HM0A 4NYXA 4E96A 2R0VA 4HXOA 1JM4B 5CRMA 5CQ7A 5KTWA 5EPSA 2YYNA 5TCMA 5EPBA 5I88A 5FH6A 2N9GA 5E3GA 4IR3A 4FLPA 4MEQA 4HBWA 2YW5A 4NUCA 4NR9A 5FFYA 5A81A 5A5OA 5LKXA 2RNWA 5CQ8A 5EGUA 4PCIA 5C85A 4O7BA 4KCXA 4Q0OA 5I40A 4TU6A 1WUMA 5A5RA 5D3TA 5FFVA 5HQ6A 2H60A 4BW4A 5J0DA 4NUDA 2NXBA 5HRWA 5IIDA 5HJCA 4YY4A 4MR6A 5EWHA 1F68A 5CUAA 4QSSA 4F3IA 4ZQLA 5JI8A 4O76A 3U5JA 4UIZA 4NR8A 5E3DA 5F61A 4RVRA 2G4AA 5G4SA 4YATA 4UYGA 5EU1A 2DVRA 3U5OA 4YYJA 4YYHA 4HBXA 5F1LA 4ALHA 4YBTA 5II1A 5I83A 4C66A 4KV4A 4PS5A 4A9NA 5LVRA 4IOOA 5D24A 5CS8A 2DVVA 4PCEA 5EISA 5CQ3A 3GG3A 3UV5A 2OO1A 5DX4A 3O34A 5E73A 5ENCA 5LUUA 3O36A 4XY8A 5FE7A 2D82A 5H85A 5A85A 3P1FA 4UYFA 4QSQA 4TZ2A 3S92A 3D7CA 4UIYA 4NS5A 4Y03A 3U5PA 3JVMA 4WIVA 3U5LA 5ACYA 5JWMA 5LJ2A 4MR4A 5CQ5A 4CUUA 4HXMA 4MR3A 5KO4A 5CFWA 4LYIA 4N3WA 3LQIA 5K29A 2GRCA 4QR5A 4CUPA 2YEMA 5E9MA 4HXSA 5EI4A 5FE0A 5A5PA 2DATA 5EICA 4CUQA 3G0LA 2I8NA 5HLSA 5IG6A 4WHUA 4PTBA 4CLBA 2E7OA 4Z6HA 5H1TA 5I86A 4NR6A 5L97A 4NQNA 4NUEA 5ENGA 4A9FA 4MENA 1N72A 3JVKA 4N4IA 3LQHA 5E9YA 5EPRA 5H1UA 5DLZA 5KU3A 5FE6A 5II2A 5I1QA 4NR4A 3ZYUA 5L96A 5EM3A 3JVJA 3IU6A 5DKHA 5H1VA 5EK9A 4PY6A 5D3JA 4QUUA 2RI7A 5DY7A 5BT3A 4KV1A 4A9JA 4YC9A 4QUTA 5F60A 5LKUA 5DFBA 2RS9B 4HXKA 2L5EA 4QSVA 4BW1A 4XUAA 5CUCA 2DKWA 2RNYA 5FB0A 2RO1A 4MEPA 1E6IA 3ONIA 5DYUA 4O72A 5D25A 4CURA 4QBMA 4Z1QA 5DW1A 4LZ2A 5I7XA 5EWCA 3U5MA 3HMFA 3AADA 5L98A 5IGKA 4A9KA 4A9OA 3U5KA 4UIWA 4J0SA 5FDZA 5A7CA 5I89A 5FE1A 5E74A 4QSUA 3MXFA 5D26A 5HRVA 5HELA 5EWDA 2YEKA 4UYHA 5FB1A 5FG5A 5KHMA 5CP5A 3TLPA 4Z93A 4XUBA 4LZRA 4QR4A 3LQJA 5LKZA 4QC1A 5COIA 5CY9A 5FE9A 4YAXA 5LJ1A 4CUSA 4UYEA 5CUDA 5EWVA 5G4RA 3O35A 4HXPA 5D3SA 4OGIA 4TZ8A 4ZW1A 5HQ7A 4CFKA 3UW9A 4N4HA 4O7FA 3UV4A 4QR3A 5LVQA 2YDWA 5FBXA 5C4QA 3JVLA 4O7CA 5ETDA 3O33A 5HQ5A 5DFDA 5D3LA 5F3AA 4LZSA 5CQ6A 4CFLA 4MR5A 4YBMA 2WP1A 4A9MA 5CQAA 4NXJA 5ETBA 4HBYA 5TB6A 5C7NA 3K2JA 4GPJA 5E7DA 3UVDA 5FG6A 4HXRA 2RNXA 3I3JA 4QYDA 3SVGA 5FFWA 4LYWA 4J0RA 5ENJA 5FE8A 4CUTA 4YYKA 4YBSA 4BHWA 4QEVA 3LJWA 4YK0A 5IGNA 4Q0NA 5D3RA 2LSPB 4O75A 3SVHA 4LR6A 3P5OA 1JSPB 2L84A 5HFQA 4O78A 5EWWA 3MUKA 4IR5A 4TYLA 5IGLA 4J3IA 4NQMA 3O37A 5LKTA 5I7YA 4TQNA 5HENA 5DKDA 3UVWA 3P1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXJ A;  4BW3 A;  2D9E A;  5A5Q A;  5L8U A;  5CUB A;  4QYL A;  5D3N A;  5D7X A;  5AME A;  4WHW A;  5IGM A;  5F36 A;  4IOR A;  5FG4 A;  4YYG A;  3QZV A;  4MEO A;  5E9V A;  3MB4 A;  5AD3 A;  1ZS5 A;  3G0J A;  4TU4 A;  5DKC A;  4YYD A;  5CGP A;  4YYM A;  3QZS A;  4AKN A;  5C87 A;  4ALG A;  4YAB A;  4ZC9 A;  3IU5 A;  5EQ1 A;  4IR6 A;  4NRB A;  2YQD A;  5AMF A;  2DVS A;  3NXB A;  5E9I A;  4UYF B;  5ENB A;  4OUF A;  5DLX A;  3DAI A;  1X0J A;  3AQA A;  4LC2 A;  2KTB B;  3HME A;  5ENI A;  4J1P A;  4NYW A;  5F1H A;  5A82 A;  3FKM X;  5EA1 A;  2L85 A;  5FH7 A;  5HFR A;  2YEL A;  5CQT A;  5D3P A;  3Q2F A;  4NR5 A;  5FE2 A;  5F5Z A;  4YH4 A;  5FH8 A;  2I7K A;  4YAD A;  5C8G A;  4XY9 A;  2F6N A;  5L8T A;  4HXN A;  5CUE A;  4A9I A;  4N4G A;  4UIX A;  5CU8 A;  2E7N A;  5HEM A;  4QZS A;  5HCL A;  4XYA A;  5A83 A;  4TT2 A;  4LRG A;  5IBN A;  5F2P A;  4LYS A;  4QSP A;  3MUL A;  2DWW A;  4QSX A;  5DYX A;  5EVA A;  3P1E A;  5A5S A;  1EQF A;  5DBM A;  4BW2 A;  2MJV B;  5LJ0 A;  4NR7 A;  1WUG A;  3DWY A;  4YYI A;  2F6J A;  4UYD A;  5HRX A;  3S91 A;  4HBV A;  4OGJ A;  5L99 A;  4DON A;  4UIT A;  5CZG A;  4NRC A;  4N4F A;  4QNS A;  4IR4 A;  3MQM A;  4O70 A;  5ENH A;  4HXL A;  4UIU A;  3U5N A;  3HMH A;  5CUG A;  5CRZ A;  3UVX A;  4O74 A;  5DFC A;  5F62 A;  5EP7 A;  5C89 A;  5EV9 A;  5CTL A;  5DYC A;  4A9L A;  4PKL A;  2R0S A;  5F63 A;  4Z6I A;  4YY6 A;  5D0C A;  4O77 A;  5FE3 A;  3RCW A;  5BT5 A;  4TTE A;  4NYV A;  5A5N A;  4QEW A;  4BJX A;  5D3H A;  4YH3 A;  4NRA A;  4QY4 A;  3QZT A;  4A9H A;  4O7A A;  5FE4 A;  2E3K A;  3Q2E A;  4O71 A;  5AD2 A;  2R0Y A;  4O7E A;  2RFJ A;  5DYA A;  5E9L A;  5FE5 A;  4CL9 A;  2FSA A;  5ENF A;  5KTU A;  4QEU A;  3SVF A;  3MB3 A;  2R10 A;  2OUO A;  4LDF A;  3P1D A;  5E9K A;  5I29 A;  2DVQ A;  4TT4 A;  5ENE A;  4Z1S A;  4X2I A;  3UVY A;  4YYN A;  5BT4 A;  4TS8 A;  5DW2 A;  3UV2 A;  5KTX A;  5CQ4 A;  4C67 A;  5I80 A;  2WP2 A;  4A9E A;  4TT6 A;  4IOQ A;  5CPE A;  5E0R A;  4QC3 A;  2OSS A;  4QSW A;  5F25 A;  4QST A;  4QB3 A;  4UIV A;  4QSR A;  5HM0 A;  4NYX A;  4E96 A;  2R0V A;  4HXO A;  1JM4 B;  5CRM A;  5CQ7 A;  5KTW A;  5EPS A;  2YYN A;  5TCM A;  5EPB A;  5I88 A;  5FH6 A;  2N9G A;  5E3G A;  4IR3 A;  4FLP A;  4MEQ A;  4HBW A;  2YW5 A;  4NUC A;  4NR9 A;  5FFY A;  5A81 A;  5A5O A;  5LKX A;  2RNW A;  5CQ8 A;  5EGU A;  4PCI A;  5C85 A;  4O7B A;  4KCX A;  4Q0O A;  5I40 A;  4TU6 A;  1WUM A;  5A5R A;  5D3T A;  5FFV A;  5HQ6 A;  2H60 A;  4BW4 A;  5J0D A;  4NUD A;  2NXB A;  5HRW A;  5IID A;  5HJC A;  4YY4 A;  4MR6 A;  5EWH A;  1F68 A;  5CUA A;  4QSS A;  4F3I A;  4ZQL A;  5JI8 A;  4O76 A;  3U5J A;  4UIZ A;  4NR8 A;  5E3D A;  5F61 A;  4RVR A;  2G4A A;  5G4S A;  4YAT A;  4UYG A;  5EU1 A;  2DVR A;  3U5O A;  4YYJ A;  4YYH A;  4HBX A;  5F1L A;  4ALH A;  4YBT A;  5II1 A;  5I83 A;  4C66 A;  4KV4 A;  4PS5 A;  4A9N A;  5LVR A;  4IOO A;  5D24 A;  5CS8 A;  2DVV A;  4PCE A;  5EIS A;  5CQ3 A;  3GG3 A;  3UV5 A;  2OO1 A;  5DX4 A;  3O34 A;  5E73 A;  5ENC A;  5LUU A;  3O36 A;  4XY8 A;  5FE7 A;  2D82 A;  5H85 A;  5A85 A;  3P1F A;  4UYF A;  4QSQ A;  4TZ2 A;  3S92 A;  3D7C A;  4UIY A;  4NS5 A;  4Y03 A;  3U5P A;  3JVM A;  4WIV A;  3U5L A;  5ACY A;  5JWM A;  5LJ2 A;  4MR4 A;  5CQ5 A;  4CUU A;  4HXM A;  4MR3 A;  5KO4 A;  5CFW A;  4LYI A;  4N3W A;  3LQI A;  5K29 A;  2GRC A;  4QR5 A;  4CUP A;  2YEM A;  5E9M A;  4HXS A;  5EI4 A;  5FE0 A;  5A5P A;  2DAT A;  5EIC A;  4CUQ A;  3G0L A;  2I8N A;  5HLS A;  5IG6 A;  4WHU A;  4PTB A;  4CLB A;  2E7O A;  4Z6H A;  5H1T A;  5I86 A;  4NR6 A;  5L97 A;  4NQN A;  4NUE A;  5ENG A;  4A9F A;  4MEN A;  1N72 A;  3JVK A;  4N4I A;  3LQH A;  5E9Y A;  5EPR A;  5H1U A;  5DLZ A;  5KU3 A;  5FE6 A;  5II2 A;  5I1Q A;  4NR4 A;  3ZYU A;  5L96 A;  5EM3 A;  3JVJ A;  3IU6 A;  5DKH A;  5H1V A;  5EK9 A;  4PY6 A;  5D3J A;  4QUU A;  2RI7 A;  5DY7 A;  5BT3 A;  4KV1 A;  4A9J A;  4YC9 A;  4QUT A;  5F60 A;  5LKU A;  5DFB A;  2RS9 B;  4HXK A;  2L5E A;  4QSV A;  4BW1 A;  4XUA A;  5CUC A;  2DKW A;  2RNY A;  5FB0 A;  2RO1 A;  4MEP A;  1E6I A;  3ONI A;  5DYU A;  4O72 A;  5D25 A;  4CUR A;  4QBM A;  4Z1Q A;  5DW1 A;  4LZ2 A;  5I7X A;  5EWC A;  3U5M A;  3HMF A;  3AAD A;  5L98 A;  5IGK A;  4A9K A;  4A9O A;  3U5K A;  4UIW A;  4J0S A;  5FDZ A;  5A7C A;  5I89 A;  5FE1 A;  5E74 A;  4QSU A;  3MXF A;  5D26 A;  5HRV A;  5HEL A;  5EWD A;  2YEK A;  4UYH A;  5FB1 A;  5FG5 A;  5KHM A;  5CP5 A;  3TLP A;  4Z93 A;  4XUB A;  4LZR A;  4QR4 A;  3LQJ A;  5LKZ A;  4QC1 A;  5COI A;  5CY9 A;  5FE9 A;  4YAX A;  5LJ1 A;  4CUS A;  4UYE A;  5CUD A;  5EWV A;  5G4R A;  3O35 A;  4HXP A;  5D3S A;  4OGI A;  4TZ8 A;  4ZW1 A;  5HQ7 A;  4CFK A;  3UW9 A;  4N4H A;  4O7F A;  3UV4 A;  4QR3 A;  5LVQ A;  2YDW A;  5FBX A;  5C4Q A;  3JVL A;  4O7C A;  5ETD A;  3O33 A;  5HQ5 A;  5DFD A;  5D3L A;  5F3A A;  4LZS A;  5CQ6 A;  4CFL A;  4MR5 A;  4YBM A;  2WP1 A;  4A9M A;  5CQA A;  4NXJ A;  5ETB A;  4HBY A;  5TB6 A;  5C7N A;  3K2J A;  4GPJ A;  5E7D A;  3UVD A;  5FG6 A;  4HXR A;  2RNX A;  3I3J A;  4QYD A;  3SVG A;  5FFW A;  4LYW A;  4J0R A;  5ENJ A;  5FE8 A;  4CUT A;  4YYK A;  4YBS A;  4BHW A;  4QEV A;  3LJW A;  4YK0 A;  5IGN A;  4Q0N A;  5D3R A;  2LSP B;  4O75 A;  3SVH A;  4LR6 A;  3P5O A;  1JSP B;  2L84 A;  5HFQ A;  4O78 A;  5EWW A;  3MUK A;  4IR5 A;  4TYL A;  5IGL A;  4J3I A;  4NQM A;  3O37 A;  5LKT A;  5I7Y A;  4TQN A;  5HEN A;  5DKD A;  3UVW A;  3P1C A; 
#chains in the Genus database with same CATH topology
 3LXJ A;  4BW3 A;  2D9E A;  5A5Q A;  5L8U A;  5CUB A;  4QYL A;  5D3N A;  5D7X A;  5AME A;  4WHW A;  5IGM A;  5F36 A;  4IOR A;  5FG4 A;  4YYG A;  3QZV A;  4MEO A;  5E9V A;  3MB4 A;  5AD3 A;  1ZS5 A;  3G0J A;  4TU4 A;  5DKC A;  4YYD A;  5CGP A;  4YYM A;  3QZS A;  4AKN A;  5C87 A;  4ALG A;  4YAB A;  4ZC9 A;  3IU5 A;  5EQ1 A;  4IR6 A;  4NRB A;  2YQD A;  5AMF A;  2DVS A;  3NXB A;  5E9I A;  4UYF B;  5ENB A;  4OUF A;  5DLX A;  3DAI A;  1X0J A;  3AQA A;  4LC2 A;  2KTB B;  3HME A;  5ENI A;  4J1P A;  4NYW A;  5F1H A;  5A82 A;  3FKM X;  5EA1 A;  2L85 A;  5FH7 A;  5HFR A;  2YEL A;  5CQT A;  5D3P A;  3Q2F A;  4AI6 A;  4NR5 A;  5FE2 A;  5F5Z A;  4YH4 A;  5FH8 A;  2I7K A;  4YAD A;  5C8G A;  4XY9 A;  2F6N A;  5L8T A;  4HXN A;  5CUE A;  4A9I A;  4N4G A;  4UIX A;  5CU8 A;  4AKG A;  2E7N A;  5HEM A;  4QZS A;  5HCL A;  4XYA A;  5A83 A;  4TT2 A;  4LRG A;  5IBN A;  5F2P A;  4LYS A;  4QSP A;  3MUL A;  2DWW A;  4QSX A;  5DYX A;  5EVA A;  3P1E A;  5A5S A;  1EQF A;  5DBM A;  4BW2 A;  2MJV B;  5LJ0 A;  4NR7 A;  1WUG A;  3DWY A;  4YYI A;  2F6J A;  4UYD A;  5HRX A;  3S91 A;  4HBV A;  4OGJ A;  5L99 A;  4DON A;  4UIT A;  5CZG A;  4NRC A;  4N4F A;  4QNS A;  4IR4 A;  3MQM A;  4O70 A;  5ENH A;  4HXL A;  4UIU A;  3U5N A;  3HMH A;  5CUG A;  5CRZ A;  3UVX A;  4O74 A;  5DFC A;  5F62 A;  5EP7 A;  5C89 A;  5EV9 A;  5CTL A;  5DYC A;  4A9L A;  4PKL A;  2R0S A;  5F63 A;  4Z6I A;  4YY6 A;  5D0C A;  4O77 A;  5FE3 A;  3RCW A;  5BT5 A;  4TTE A;  4NYV A;  5A5N A;  4QEW A;  4BJX A;  5D3H A;  4YH3 A;  4NRA A;  4QY4 A;  3QZT A;  4A9H A;  4O7A A;  5FE4 A;  2E3K A;  3Q2E A;  4O71 A;  5AD2 A;  2R0Y A;  4O7E A;  2RFJ A;  5DYA A;  5E9L A;  5FE5 A;  4CL9 A;  2FSA A;  5ENF A;  5KTU A;  4QEU A;  3SVF A;  3MB3 A;  2R10 A;  2OUO A;  4LDF A;  3P1D A;  5E9K A;  5I29 A;  2DVQ A;  4TT4 A;  5ENE A;  4Z1S A;  4X2I A;  3UVY A;  4YYN A;  5BT4 A;  4TS8 A;  5DW2 A;  3UV2 A;  5KTX A;  5CQ4 A;  4C67 A;  5I80 A;  2WP2 A;  4A9E A;  4TT6 A;  4IOQ A;  5CPE A;  5E0R A;  4QC3 A;  2OSS A;  4QSW A;  5F25 A;  4QST A;  4QB3 A;  4UIV A;  4QSR A;  4AKI A;  5HM0 A;  4NYX A;  4E96 A;  2R0V A;  4HXO A;  1JM4 B;  5CRM A;  5CQ7 A;  5KTW A;  5EPS A;  2YYN A;  5TCM A;  5EPB A;  5I88 A;  5FH6 A;  2N9G A;  5E3G A;  4IR3 A;  4FLP A;  4MEQ A;  4HBW A;  2YW5 A;  1ZKR A;  4NUC A;  4NR9 A;  5FFY A;  5A81 A;  5A5O A;  5LKX A;  2RNW A;  5CQ8 A;  5EGU A;  4PCI A;  5C85 A;  4O7B A;  4KCX A;  4Q0O A;  5I40 A;  4TU6 A;  1WUM A;  5A5R A;  5D3T A;  5FFV A;  5HQ6 A;  2H60 A;  4BW4 A;  5J0D A;  4NUD A;  2NXB A;  5HRW A;  5IID A;  5HJC A;  4YY4 A;  4MR6 A;  5EWH A;  1F68 A;  4AKH A;  5CUA A;  4QSS A;  4F3I A;  4ZQL A;  5JI8 A;  4O76 A;  1PUO A;  3U5J A;  4UIZ A;  4NR8 A;  5E3D A;  5F61 A;  4RVR A;  2G4A A;  5G4S A;  4YAT A;  4UYG A;  5EU1 A;  2DVR A;  3U5O A;  4YYJ A;  4YYH A;  4HBX A;  5F1L A;  4ALH A;  3D1D A;  4YBT A;  5II1 A;  5I83 A;  4C66 A;  4KV4 A;  4PS5 A;  4A9N A;  5LVR A;  4IOO A;  5D24 A;  5CS8 A;  2DVV A;  4PCE A;  5EIS A;  5CQ3 A;  3GG3 A;  3UV5 A;  2OO1 A;  5DX4 A;  3O34 A;  5E73 A;  5ENC A;  5LUU A;  3O36 A;  4XY8 A;  5FE7 A;  2D82 A;  5H85 A;  5A85 A;  3P1F A;  4UYF A;  3ERR A;  4QSQ A;  4TZ2 A;  3S92 A;  3D7C A;  4UIY A;  4NS5 A;  4Y03 A;  3U5P A;  3JVM A;  4WIV A;  3U5L A;  5ACY A;  5JWM A;  5LJ2 A;  4MR4 A;  5CQ5 A;  4CUU A;  4HXM A;  4MR3 A;  5KO4 A;  5CFW A;  4LYI A;  4N3W A;  3LQI A;  5K29 A;  2GRC A;  4QR5 A;  4CUP A;  2YEM A;  5E9M A;  4HXS A;  5EI4 A;  5FE0 A;  5A5P A;  2DAT A;  5EIC A;  4CUQ A;  3G0L A;  2I8N A;  5HLS A;  5IG6 A;  4WHU A;  4PTB A;  4CLB A;  2E7O A;  4Z6H A;  5H1T A;  5I86 A;  4NR6 A;  5L97 A;  4NQN A;  4NUE A;  5ENG A;  4A9F A;  4MEN A;  1N72 A;  3JVK A;  4N4I A;  3LQH A;  5E9Y A;  5EPR A;  5H1U A;  5DLZ A;  5KU3 A;  5FE6 A;  5II2 A;  5I1Q A;  4NR4 A;  3ZYU A;  5L96 A;  5EM3 A;  3JVJ A;  3IU6 A;  5DKH A;  5H1V A;  5EK9 A;  4PY6 A;  5D3J A;  4QUU A;  2RI7 A;  5DY7 A;  5BT3 A;  4KV1 A;  3VKH A;  4A9J A;  4YC9 A;  4QUT A;  5F60 A;  5LKU A;  5DFB A;  2RS9 B;  4HXK A;  2L5E A;  4QSV A;  4BW1 A;  4XUA A;  5CUC A;  2DKW A;  2RNY A;  5FB0 A;  2RO1 A;  4MEP A;  1E6I A;  3ONI A;  5DYU A;  4O72 A;  5D25 A;  4CUR A;  4QBM A;  4Z1Q A;  5DW1 A;  4LZ2 A;  5I7X A;  5EWC A;  3U5M A;  3HMF A;  3AAD A;  5L98 A;  5IGK A;  4A9K A;  2EJN A;  4A9O A;  3U5K A;  4UIW A;  4J0S A;  5FDZ A;  5A7C A;  5I89 A;  5FE1 A;  5E74 A;  4QSU A;  3MXF A;  5D26 A;  5HRV A;  5HEL A;  5EWD A;  2YEK A;  4UYH A;  5FB1 A;  5FG5 A;  5KHM A;  5CP5 A;  3TLP A;  4Z93 A;  4XUB A;  4LZR A;  4QR4 A;  3LQJ A;  5LKZ A;  4QC1 A;  5COI A;  5CY9 A;  5FE9 A;  4YAX A;  5LJ1 A;  4CUS A;  4UYE A;  5CUD A;  5EWV A;  5G4R A;  3O35 A;  4HXP A;  3D1B A;  5D3S A;  4OGI A;  4TZ8 A;  4ZW1 A;  5HQ7 A;  4CFK A;  3UW9 A;  4N4H A;  4O7F A;  3UV4 A;  4QR3 A;  5LVQ A;  2YDW A;  5FBX A;  5C4Q A;  3JVL A;  4O7C A;  5ETD A;  3O33 A;  5HQ5 A;  5DFD A;  5D3L A;  5F3A A;  4LZS A;  5CQ6 A;  4CFL A;  4MR5 A;  4YBM A;  2WP1 A;  4A9M A;  5CQA A;  4NXJ A;  5ETB A;  4HBY A;  5TB6 A;  5C7N A;  3K2J A;  3VKG A;  4GPJ A;  5E7D A;  3UVD A;  5FG6 A;  4HXR A;  2RNX A;  3I3J A;  4QYD A;  3SVG A;  5FFW A;  4LYW A;  4J0R A;  5ENJ A;  5FE8 A;  4CUT A;  4YYK A;  4YBS A;  4BHW A;  4QEV A;  3LJW A;  4YK0 A;  5IGN A;  4Q0N A;  5D3R A;  2LSP B;  4O75 A;  3SVH A;  4LR6 A;  3P5O A;  1JSP B;  2L84 A;  5HFQ A;  4O78 A;  5EWW A;  3MUK A;  4IR5 A;  4TYL A;  5IGL A;  4J3I A;  4NQM A;  3O37 A;  5LKT A;  5I7Y A;  4TQN A;  5HEN A;  5DKD A;  3UVW A;  3P1C A; 
#chains in the Genus database with same CATH homology
 3LXJ A;  4BW3 A;  2D9E A;  5A5Q A;  5L8U A;  5CUB A;  4QYL A;  5D3N A;  5D7X A;  5AME A;  4WHW A;  5IGM A;  5F36 A;  4IOR A;  5FG4 A;  4YYG A;  3QZV A;  4MEO A;  5E9V A;  3MB4 A;  5AD3 A;  1ZS5 A;  3G0J A;  4TU4 A;  5DKC A;  4YYD A;  5CGP A;  4YYM A;  3QZS A;  4AKN A;  5C87 A;  4ALG A;  4YAB A;  4ZC9 A;  3IU5 A;  5EQ1 A;  4IR6 A;  4NRB A;  2YQD A;  5AMF A;  2DVS A;  3NXB A;  5E9I A;  4UYF B;  5ENB A;  4OUF A;  5DLX A;  3DAI A;  1X0J A;  3AQA A;  4LC2 A;  2KTB B;  3HME A;  5ENI A;  4J1P A;  4NYW A;  5F1H A;  5A82 A;  3FKM X;  5EA1 A;  2L85 A;  5FH7 A;  5HFR A;  2YEL A;  5CQT A;  5D3P A;  3Q2F A;  4NR5 A;  5FE2 A;  5F5Z A;  4YH4 A;  5FH8 A;  2I7K A;  4YAD A;  5C8G A;  4XY9 A;  2F6N A;  5L8T A;  4HXN A;  5CUE A;  4A9I A;  4N4G A;  4UIX A;  5CU8 A;  2E7N A;  5HEM A;  4QZS A;  5HCL A;  4XYA A;  5A83 A;  4TT2 A;  4LRG A;  5IBN A;  5F2P A;  4LYS A;  4QSP A;  3MUL A;  2DWW A;  4QSX A;  5DYX A;  5EVA A;  3P1E A;  5A5S A;  1EQF A;  5DBM A;  4BW2 A;  2MJV B;  5LJ0 A;  4NR7 A;  1WUG A;  3DWY A;  4YYI A;  2F6J A;  4UYD A;  5HRX A;  3S91 A;  4HBV A;  4OGJ A;  5L99 A;  4DON A;  4UIT A;  5CZG A;  4NRC A;  4N4F A;  4QNS A;  4IR4 A;  3MQM A;  4O70 A;  5ENH A;  4HXL A;  4UIU A;  3U5N A;  3HMH A;  5CUG A;  5CRZ A;  3UVX A;  4O74 A;  5DFC A;  5F62 A;  5EP7 A;  5C89 A;  5EV9 A;  5CTL A;  5DYC A;  4A9L A;  4PKL A;  2R0S A;  5F63 A;  4Z6I A;  4YY6 A;  5D0C A;  4O77 A;  5FE3 A;  3RCW A;  5BT5 A;  4TTE A;  4NYV A;  5A5N A;  4QEW A;  4BJX A;  5D3H A;  4YH3 A;  4NRA A;  4QY4 A;  3QZT A;  4A9H A;  4O7A A;  5FE4 A;  2E3K A;  3Q2E A;  4O71 A;  5AD2 A;  2R0Y A;  4O7E A;  2RFJ A;  5DYA A;  5E9L A;  5FE5 A;  4CL9 A;  2FSA A;  5ENF A;  5KTU A;  4QEU A;  3SVF A;  3MB3 A;  2R10 A;  2OUO A;  4LDF A;  3P1D A;  5E9K A;  5I29 A;  2DVQ A;  4TT4 A;  5ENE A;  4Z1S A;  4X2I A;  3UVY A;  4YYN A;  5BT4 A;  4TS8 A;  5DW2 A;  3UV2 A;  5KTX A;  5CQ4 A;  4C67 A;  5I80 A;  2WP2 A;  4A9E A;  4TT6 A;  4IOQ A;  5CPE A;  5E0R A;  4QC3 A;  2OSS A;  4QSW A;  5F25 A;  4QST A;  4QB3 A;  4UIV A;  4QSR A;  5HM0 A;  4NYX A;  4E96 A;  2R0V A;  4HXO A;  1JM4 B;  5CRM A;  5CQ7 A;  5KTW A;  5EPS A;  2YYN A;  5TCM A;  5EPB A;  5I88 A;  5FH6 A;  2N9G A;  5E3G A;  4IR3 A;  4FLP A;  4MEQ A;  4HBW A;  2YW5 A;  4NUC A;  4NR9 A;  5FFY A;  5A81 A;  5A5O A;  5LKX A;  2RNW A;  5CQ8 A;  5EGU A;  4PCI A;  5C85 A;  4O7B A;  4KCX A;  4Q0O A;  5I40 A;  4TU6 A;  1WUM A;  5A5R A;  5D3T A;  5FFV A;  5HQ6 A;  2H60 A;  4BW4 A;  5J0D A;  4NUD A;  2NXB A;  5HRW A;  5IID A;  5HJC A;  4YY4 A;  4MR6 A;  5EWH A;  1F68 A;  5CUA A;  4QSS A;  4F3I A;  4ZQL A;  5JI8 A;  4O76 A;  3U5J A;  4UIZ A;  4NR8 A;  5E3D A;  5F61 A;  4RVR A;  2G4A A;  5G4S A;  4YAT A;  4UYG A;  5EU1 A;  2DVR A;  3U5O A;  4YYJ A;  4YYH A;  4HBX A;  5F1L A;  4ALH A;  4YBT A;  5II1 A;  5I83 A;  4C66 A;  4KV4 A;  4PS5 A;  4A9N A;  5LVR A;  4IOO A;  5D24 A;  5CS8 A;  2DVV A;  4PCE A;  5EIS A;  5CQ3 A;  3GG3 A;  3UV5 A;  2OO1 A;  5DX4 A;  3O34 A;  5E73 A;  5ENC A;  5LUU A;  3O36 A;  4XY8 A;  5FE7 A;  2D82 A;  5H85 A;  5A85 A;  3P1F A;  4UYF A;  4QSQ A;  4TZ2 A;  3S92 A;  3D7C A;  4UIY A;  4NS5 A;  4Y03 A;  3U5P A;  3JVM A;  4WIV A;  3U5L A;  5ACY A;  5JWM A;  5LJ2 A;  4MR4 A;  5CQ5 A;  4CUU A;  4HXM A;  4MR3 A;  5KO4 A;  5CFW A;  4LYI A;  4N3W A;  3LQI A;  5K29 A;  2GRC A;  4QR5 A;  4CUP A;  2YEM A;  5E9M A;  4HXS A;  5EI4 A;  5FE0 A;  5A5P A;  2DAT A;  5EIC A;  4CUQ A;  3G0L A;  2I8N A;  5HLS A;  5IG6 A;  4WHU A;  4PTB A;  4CLB A;  2E7O A;  4Z6H A;  5H1T A;  5I86 A;  4NR6 A;  5L97 A;  4NQN A;  4NUE A;  5ENG A;  4A9F A;  4MEN A;  1N72 A;  3JVK A;  4N4I A;  3LQH A;  5E9Y A;  5EPR A;  5H1U A;  5DLZ A;  5KU3 A;  5FE6 A;  5II2 A;  5I1Q A;  4NR4 A;  3ZYU A;  5L96 A;  5EM3 A;  3JVJ A;  3IU6 A;  5DKH A;  5H1V A;  5EK9 A;  4PY6 A;  5D3J A;  4QUU A;  2RI7 A;  5DY7 A;  5BT3 A;  4KV1 A;  4A9J A;  4YC9 A;  4QUT A;  5F60 A;  5LKU A;  5DFB A;  2RS9 B;  4HXK A;  2L5E A;  4QSV A;  4BW1 A;  4XUA A;  5CUC A;  2DKW A;  2RNY A;  5FB0 A;  2RO1 A;  4MEP A;  1E6I A;  3ONI A;  5DYU A;  4O72 A;  5D25 A;  4CUR A;  4QBM A;  4Z1Q A;  5DW1 A;  4LZ2 A;  5I7X A;  5EWC A;  3U5M A;  3HMF A;  3AAD A;  5L98 A;  5IGK A;  4A9K A;  4A9O A;  3U5K A;  4UIW A;  4J0S A;  5FDZ A;  5A7C A;  5I89 A;  5FE1 A;  5E74 A;  4QSU A;  3MXF A;  5D26 A;  5HRV A;  5HEL A;  5EWD A;  2YEK A;  4UYH A;  5FB1 A;  5FG5 A;  5KHM A;  5CP5 A;  3TLP A;  4Z93 A;  4XUB A;  4LZR A;  4QR4 A;  3LQJ A;  5LKZ A;  4QC1 A;  5COI A;  5CY9 A;  5FE9 A;  4YAX A;  5LJ1 A;  4CUS A;  4UYE A;  5CUD A;  5EWV A;  5G4R A;  3O35 A;  4HXP A;  5D3S A;  4OGI A;  4TZ8 A;  4ZW1 A;  5HQ7 A;  4CFK A;  3UW9 A;  4N4H A;  4O7F A;  3UV4 A;  4QR3 A;  5LVQ A;  2YDW A;  5FBX A;  5C4Q A;  3JVL A;  4O7C A;  5ETD A;  3O33 A;  5HQ5 A;  5DFD A;  5D3L A;  5F3A A;  4LZS A;  5CQ6 A;  4CFL A;  4MR5 A;  4YBM A;  2WP1 A;  4A9M A;  5CQA A;  4NXJ A;  5ETB A;  4HBY A;  5TB6 A;  5C7N A;  3K2J A;  4GPJ A;  5E7D A;  3UVD A;  5FG6 A;  4HXR A;  2RNX A;  3I3J A;  4QYD A;  3SVG A;  5FFW A;  4LYW A;  4J0R A;  5ENJ A;  5FE8 A;  4CUT A;  4YYK A;  4YBS A;  4BHW A;  4QEV A;  3LJW A;  4YK0 A;  5IGN A;  4Q0N A;  5D3R A;  2LSP B;  4O75 A;  3SVH A;  4LR6 A;  3P5O A;  1JSP B;  2L84 A;  5HFQ A;  4O78 A;  5EWW A;  3MUK A;  4IR5 A;  4TYL A;  5IGL A;  4J3I A;  4NQM A;  3O37 A;  5LKT A;  5I7Y A;  4TQN A;  5HEN A;  5DKD A;  3UVW A;  3P1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...