5A82A

Crystal structure of human atad2 bromodomain in complex with 4-(3r,4r) -4-(3-methyl-2-oxo-1,2-dihydro-1,7-naphthyridin-8-yl)aminopiperidin-3- yloxymethyl)-1-thiane-1,1-dione
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Structure-Based Optimization of Naphthyridones Into Potent Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Inhibitor
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a82A00
4CUPA 3S92A 5FFVA 4MEQA 5EQ1A 2I8NA 5L99A 2DVVA 5DFDA 4NYVA 5ENFA 4LZSA 4QNSA 4HBVA 4LYIA 5KO4A 5CQ4A 5HFQA 4ZQLA 5F1HA 4NR7A 5EP7A 4AKNA 4YK0A 5FE1A 5ENBA 5H1TA 3LQJA 5EICA 5D0CA 5F2PA 4NUEA 2YYNA 3U5MA 3UV4A 5H1VA 2MJVB 5E3DA 4MENA 4NQNA 4OUFA 4WIVA 4OGJA 4HXRA 4IOQA 3ZYUA 2L5EA 3K2JA 5AD3A 5DBMA 3MQMA 5CP5A 4BW2A 3QZSA 4MEPA 5DYAA 4YYKA 4A9IA 4TT2A 4YY4A 4CFLA 5FE0A 4KV1A 5ETBA 5D24A 3IU6A 4QEVA 4UIZA 2GRCA 2R0YA 5CQ6A 3JVMA 5HCLA 5CUBA 4HXSA 5CQAA 4YYGA 5HFRA 4CL9A 5A81A 3U5JA 3UVDA 3AADA 5G4RA 5LJ1A 4E96A 5D3JA 4O76A 3Q2FA 5D3LA 3HMEA 5CPEA 4Z6HA 1F68A 4MEOA 3JVKA 4UIVA 4NRBA 4O74A 5EPBA 4IR5A 4LRGA 4QC1A 4A9MA 3GG3A 5HLSA 5D3SA 5H1UA 5F3AA 4IOOA 3U5NA 4NQMA 5D3RA 3U5OA 4X2IA 4UIYA 4CFKA 2NXBA 4QB3A 5DY7A 2WP1A 3LJWA 4PCEA 5C85A 3S91A 5DW2A 5HELA 4YYDA 3O36A 3LQHA 2L85A 5C87A 2DWWA 5FB1A 3P1EA 5EV9A 3U5LA 5ENCA 4WHWA 2F6JA 1X0JA 4YATA 4BW3A 4QBMA 5ENJA 5I7XA 3HMFA 3UV2A 4O7FA 3SVGA 5DYCA 4TU4A 5E9MA 3DWYA 3UVYA 5CQ3A 4NUDA 4O7EA 5FE4A 3NXBA 4LC2A 4YH3A 5CTLA 4RVRA 4XY8A 5BT3A 5LJ0A 4UYDA 5G4SA 2R10A 3O34A 4BW1A 5EI4A 3MXFA 4HXNA 4QUTA 5CRZA 4PCIA 2L84A 4HXLA 4YADA 5HRXA 5TCMA 5CQ8A 4UYEA 5K29A 4CUSA 3JVLA 5HQ6A 3P1DA 5ETDA 5D3HA 3AQAA 3MB3A 4ZW1A 4UIWA 5DKCA 5FDZA 2YDWA 2DATA 4CUQA 4YBTA 5CY9A 4O71A 5HRVA 3DAIA 5I29A 5FE6A 5BT5A 3MULA 3LXJA 4N4GA 3MB4A 5L98A 2D9EA 5CFWA 3D7CA 4YYHA 5F36A 4A9KA 4DONA 5DFBA 2G4AA 4TT4A 4O7CA 5FH7A 4N4IA 4QSQA 4ALGA 5HQ5A 4UYHA 5D7XA 2LSPB 4UYFB 5A83A 5EVAA 4TT6A 5CRMA 5A82A 5AMEA 5E9VA 5C4QA 2R0VA 5D3PA 5E7DA 4BJXA 5LUUA 5KTUA 4NR9A 3LQIA 5D26A 4YABA 4NR5A 5FBXA 4PKLA 4NYWA 5FE9A 4QR3A 5FG6A 4YBSA 4LZ2A 5A5NA 5FE5A 4TU6A 4MR6A 4HBWA 5I7YA 4FLPA 3MUKA 2I7KA 5D3TA 2RNYA 3SVFA 4LDFA 5J0DA 5IGMA 4J0SA 2E7OA 4J0RA 4LYWA 4YC9A 4HXKA 4TQNA 1WUMA 5A5QA 5I40A 4O7BA 4A9OA 3FKMX 5FFWA 4N4HA 5E9KA 5D3NA 5II1A 4NRAA 5IG6A 3P1FA 4O78A 4MR3A 2RS9B 2FSAA 5DX4A 4NYXA 4ZC9A 2H60A 3SVHA 2YEKA 2YELA 4TZ8A 5DFCA 5A5OA 5A85A 5CU8A 5EISA 4C66A 5F60A 3Q2EA 5ACYA 1JSPB 4XUAA 4QY4A 4YY6A 4O77A 5EGUA 2RFJA 2R0SA 2DVSA 5EWCA 5EWDA 1ZS5A 5EPRA 3UV5A 4XY9A 5A5RA 5CQ5A 4YH4A 4O75A 4N3WA 5C7NA 5II2A 4CUTA 5E9YA 3U5KA 3UVWA 3O37A 4UIXA 2RNXA 5L8TA 5F5ZA 5FG5A 4NRCA 5F25A 4A9EA 4NR6A 5COIA 4O72A 4YAXA 5DYUA 5EPSA 5HEMA 5HRWA 4YBMA 5ENHA 5BT4A 2YQDA 2DVRA 4QC3A 3IU5A 4QSPA 4Z1SA 5F63A 3O33A 5DKHA 4Z1QA 4Z93A 4QSRA 4A9JA 4QSVA 5FE2A 5EWWA 2D82A 4QUUA 2E7NA 2RI7A 5CUDA 4MR5A 4F3IA 5DW1A 4KCXA 5FE8A 3TLPA 5I86A 3P5OA 5ENEA 4NUCA 5FE7A 3QZTA 5KHMA 5E3GA 5KU3A 5C89A 4OGIA 2OSSA 4QSSA 5D25A 5CQ7A 3JVJA 4Q0OA 4Z6IA 4QEUA 5I80A 4YYNA 4HBYA 5E9LA 4LYSA 5FB0A 4CURA 4HXPA 5IGNA 5LKZA 4N4FA 4A9LA 4YYMA 5HQ7A 4UITA 4IR4A 4CLBA 4QEWA 5AD2A 4HBXA 5CUEA 4QR4A 3UW9A 1E6IA 2RNWA 4QSTA 5EWVA 4Y03A 5CGPA 5AMFA 5LKUA 5FH6A 4J3IA 5JI8A 2YW5A 4PS5A 5LVRA 5E9IA 4HXOA 4CUUA 4TYLA 4TTEA 4QSXA 5FG4A 5E0RA 5IIDA 5FFYA 4MR4A 3P1CA 4KV4A 5L8UA 3UVXA 5HM0A 2OO1A 5IGKA 5ENGA 5A5SA 4QYLA 1EQFA 4J1PA 4O7AA 4GPJA 4O70A 2OUOA 4A9FA 5L97A 4IR6A 4NR4A 2E3KA 4NR8A 4QZSA 2YEMA 4XUBA 2RO1A 3RCWA 5IGLA 5A5PA 4BW4A 5EU1A 5I83A 4YYJA 5F62A 5EM3A 4UYFA 5DKDA 2F6NA 4XYAA 4TS8A 2DKWA 5H85A 4UIUA 5F61A 5CS8A 3ONIA 5E73A 4A9NA 5LKTA 5CUAA 5C8GA 5ENIA 3G0JA 4YYIA 5FE3A 5DYXA 4BHWA 1JM4B 4NXJA 4UYGA 4Q0NA 5L96A 5FH8A 4HXMA 5LVQA 3U5PA 5EA1A 4A9HA 5DLZA 5I88A 4PY6A 5CQTA 4QR5A 3O35A 5EWHA 5I89A 5F1LA 4QSWA 5KTWA 4WHUA 5EK9A 5DLXA 5HENA 2WP2A 2KTBB 4LR6A 3G0LA 4IR3A 1N72A 4QYDA 5CUCA 5A7CA 5LJ2A 5I1QA 5JWMA 5KTXA 4LZRA 5CZGA 4ALHA 3HMHA 5LKXA 5E74A 2DVQA 4PTBA 4C67A 4QSUA 5CUGA 3QZVA 4TZ2A 5TB6A 1WUGA 5IBNA 5HJCA 3I3JA 4NS5A 2N9GA 4IORA
chains in the Genus database with same CATH superfamily
4CUPA 3S92A 5FFVA 4MEQA 5EQ1A 2I8NA 5L99A 2DVVA 5DFDA 4NYVA 5ENFA 4LZSA 4QNSA 4HBVA 4LYIA 5KO4A 5CQ4A 5HFQA 4ZQLA 5F1HA 4NR7A 5EP7A 4AKNA 4YK0A 5FE1A 5ENBA 5H1TA 3LQJA 5EICA 5D0CA 5F2PA 4NUEA 2YYNA 3U5MA 3UV4A 5H1VA 2MJVB 5E3DA 4MENA 4NQNA 4OUFA 4WIVA 4OGJA 4HXRA 4IOQA 3ZYUA 2L5EA 3K2JA 5AD3A 5DBMA 3MQMA 5CP5A 4BW2A 3QZSA 4MEPA 5DYAA 4YYKA 4A9IA 4TT2A 4YY4A 4CFLA 5FE0A 4KV1A 5ETBA 5D24A 3IU6A 4QEVA 4UIZA 2GRCA 2R0YA 5CQ6A 3JVMA 5HCLA 5CUBA 4HXSA 5CQAA 4YYGA 5HFRA 4CL9A 5A81A 3U5JA 3UVDA 3AADA 5G4RA 5LJ1A 4E96A 5D3JA 4O76A 3Q2FA 5D3LA 3HMEA 5CPEA 4Z6HA 1F68A 4MEOA 3JVKA 4UIVA 4NRBA 4O74A 5EPBA 4IR5A 4LRGA 4QC1A 4A9MA 3GG3A 5HLSA 5D3SA 5H1UA 5F3AA 4IOOA 3U5NA 4NQMA 5D3RA 3U5OA 4X2IA 4UIYA 4CFKA 2NXBA 4QB3A 5DY7A 2WP1A 3LJWA 4PCEA 5C85A 3S91A 5DW2A 5HELA 4YYDA 3O36A 3LQHA 2L85A 5C87A 2DWWA 5FB1A 3P1EA 5EV9A 3U5LA 5ENCA 4WHWA 2F6JA 1X0JA 4YATA 4BW3A 4QBMA 5ENJA 5I7XA 3HMFA 3UV2A 4O7FA 3SVGA 5DYCA 4TU4A 5E9MA 3DWYA 3UVYA 2EJNA 5CQ3A 4NUDA 4O7EA 5FE4A 3NXBA 4LC2A 4YH3A 5CTLA 4RVRA 4XY8A 5BT3A 5LJ0A 4UYDA 5G4SA 2R10A 3O34A 4BW1A 5EI4A 3MXFA 4HXNA 4QUTA 5CRZA 4PCIA 2L84A 4HXLA 4YADA 5HRXA 5TCMA 5CQ8A 4UYEA 5K29A 4CUSA 3JVLA 5HQ6A 3P1DA 5ETDA 5D3HA 3AQAA 3MB3A 4ZW1A 4UIWA 5DKCA 5FDZA 2YDWA 2DATA 4CUQA 4YBTA 5CY9A 4O71A 5HRVA 3DAIA 5I29A 5FE6A 5BT5A 3MULA 3LXJA 4N4GA 3MB4A 5L98A 4AKHA 2D9EA 5CFWA 3D7CA 4YYHA 4AKIA 5F36A 4A9KA 3VKHA 4DONA 5DFBA 2G4AA 4TT4A 4O7CA 5FH7A 4N4IA 4QSQA 4ALGA 5HQ5A 4UYHA 5D7XA 2LSPB 4UYFB 5A83A 5EVAA 4TT6A 5CRMA 5A82A 5AMEA 5E9VA 5C4QA 2R0VA 5D3PA 5E7DA 4BJXA 5LUUA 5KTUA 4NR9A 1PUOA 3LQIA 5D26A 4YABA 4NR5A 5FBXA 4PKLA 4NYWA 5FE9A 4QR3A 5FG6A 3ERRA 4YBSA 4LZ2A 5A5NA 5FE5A 4TU6A 4MR6A 4HBWA 5I7YA 4FLPA 3MUKA 2I7KA 5D3TA 2RNYA 3SVFA 4LDFA 5J0DA 5IGMA 4J0SA 2E7OA 4J0RA 4LYWA 4YC9A 4HXKA 4TQNA 1WUMA 5A5QA 5I40A 4O7BA 4A9OA 3FKMX 5FFWA 4N4HA 5E9KA 5D3NA 5II1A 4NRAA 5IG6A 3P1FA 4O78A 4MR3A 2RS9B 2FSAA 5DX4A 4NYXA 4ZC9A 2H60A 3SVHA 1ZKRA 2YEKA 2YELA 4TZ8A 5DFCA 5A5OA 5A85A 5CU8A 5EISA 4C66A 5F60A 3Q2EA 5ACYA 1JSPB 4XUAA 4QY4A 4YY6A 4O77A 5EGUA 2RFJA 2R0SA 2DVSA 5EWCA 5EWDA 1ZS5A 5EPRA 3UV5A 4XY9A 5A5RA 5CQ5A 4YH4A 4O75A 4N3WA 5C7NA 5II2A 4CUTA 5E9YA 3U5KA 3UVWA 3O37A 4UIXA 2RNXA 5L8TA 5F5ZA 5FG5A 4NRCA 5F25A 4A9EA 4NR6A 5COIA 4O72A 4YAXA 5DYUA 5EPSA 5HEMA 5HRWA 4YBMA 5ENHA 5BT4A 2YQDA 2DVRA 4QC3A 3IU5A 4QSPA 4Z1SA 5F63A 3O33A 5DKHA 4Z1QA 4Z93A 4QSRA 4A9JA 4QSVA 5FE2A 5EWWA 2D82A 4QUUA 2E7NA 2RI7A 5CUDA 4MR5A 4AI6A 4F3IA 5DW1A 4KCXA 5FE8A 3TLPA 5I86A 3P5OA 5ENEA 4NUCA 5FE7A 3QZTA 5KHMA 5E3GA 5KU3A 5C89A 4OGIA 2OSSA 4QSSA 5D25A 5CQ7A 3JVJA 4Q0OA 4Z6IA 4QEUA 5I80A 4YYNA 4HBYA 5E9LA 4LYSA 5FB0A 4CURA 3D1BA 4HXPA 5IGNA 5LKZA 4N4FA 4A9LA 4YYMA 5HQ7A 4UITA 4IR4A 4CLBA 4QEWA 5AD2A 4HBXA 5CUEA 4QR4A 3UW9A 1E6IA 2RNWA 4QSTA 5EWVA 4Y03A 5CGPA 5AMFA 5LKUA 5FH6A 4J3IA 5JI8A 2YW5A 4PS5A 5LVRA 5E9IA 3VKGA 4HXOA 4CUUA 4TYLA 4TTEA 4QSXA 5FG4A 5E0RA 5IIDA 5FFYA 4MR4A 3P1CA 4KV4A 5L8UA 3UVXA 5HM0A 2OO1A 5IGKA 5ENGA 5A5SA 4QYLA 1EQFA 4J1PA 4O7AA 4GPJA 4O70A 2OUOA 4A9FA 5L97A 4IR6A 4NR4A 2E3KA 4NR8A 4QZSA 2YEMA 4XUBA 2RO1A 3RCWA 5IGLA 5A5PA 4BW4A 5EU1A 5I83A 4YYJA 5F62A 5EM3A 4UYFA 5DKDA 2F6NA 4XYAA 4TS8A 2DKWA 3D1DA 5H85A 4UIUA 5F61A 5CS8A 3ONIA 5E73A 4A9NA 5LKTA 5CUAA 5C8GA 5ENIA 3G0JA 4YYIA 5FE3A 5DYXA 4BHWA 1JM4B 4NXJA 4UYGA 4Q0NA 5L96A 5FH8A 4HXMA 5LVQA 3U5PA 5EA1A 4A9HA 5DLZA 5I88A 4PY6A 5CQTA 4QR5A 3O35A 5EWHA 5I89A 5F1LA 4QSWA 5KTWA 4WHUA 5EK9A 5DLXA 5HENA 2WP2A 2KTBB 4LR6A 3G0LA 4AKGA 4IR3A 1N72A 4QYDA 5CUCA 5A7CA 5LJ2A 5I1QA 5JWMA 5KTXA 4LZRA 5CZGA 4ALHA 3HMHA 5LKXA 5E74A 2DVQA 4PTBA 4C67A 4QSUA 5CUGA 3QZVA 4TZ2A 5TB6A 1WUGA 5IBNA 5HJCA 3I3JA 4NS5A 2N9GA 4IORA
chains in the Genus database with same CATH topology
4CUPA 3S92A 5FFVA 4MEQA 5EQ1A 2I8NA 5L99A 2DVVA 5DFDA 4NYVA 5ENFA 4LZSA 4QNSA 4HBVA 4LYIA 5KO4A 5CQ4A 5HFQA 4ZQLA 5F1HA 4NR7A 5EP7A 4AKNA 4YK0A 5FE1A 5ENBA 5H1TA 3LQJA 5EICA 5D0CA 5F2PA 4NUEA 2YYNA 3U5MA 3UV4A 5H1VA 2MJVB 5E3DA 4MENA 4NQNA 4OUFA 4WIVA 4OGJA 4HXRA 4IOQA 3ZYUA 2L5EA 3K2JA 5AD3A 5DBMA 3MQMA 5CP5A 4BW2A 3QZSA 4MEPA 5DYAA 4YYKA 4A9IA 4TT2A 4YY4A 4CFLA 5FE0A 4KV1A 5ETBA 5D24A 3IU6A 4QEVA 4UIZA 2GRCA 2R0YA 5CQ6A 3JVMA 5HCLA 5CUBA 4HXSA 5CQAA 4YYGA 5HFRA 4CL9A 5A81A 3U5JA 3UVDA 3AADA 5G4RA 5LJ1A 4E96A 5D3JA 4O76A 3Q2FA 5D3LA 3HMEA 5CPEA 4Z6HA 1F68A 4MEOA 3JVKA 4UIVA 4NRBA 4O74A 5EPBA 4IR5A 4LRGA 4QC1A 4A9MA 3GG3A 5HLSA 5D3SA 5H1UA 5F3AA 4IOOA 3U5NA 4NQMA 5D3RA 3U5OA 4X2IA 4UIYA 4CFKA 2NXBA 4QB3A 5DY7A 2WP1A 3LJWA 4PCEA 5C85A 3S91A 5DW2A 5HELA 4YYDA 3O36A 3LQHA 2L85A 5C87A 2DWWA 5FB1A 3P1EA 5EV9A 3U5LA 5ENCA 4WHWA 2F6JA 1X0JA 4YATA 4BW3A 4QBMA 5ENJA 5I7XA 3HMFA 3UV2A 4O7FA 3SVGA 5DYCA 4TU4A 5E9MA 3DWYA 3UVYA 5CQ3A 4NUDA 4O7EA 5FE4A 3NXBA 4LC2A 4YH3A 5CTLA 4RVRA 4XY8A 5BT3A 5LJ0A 4UYDA 5G4SA 2R10A 3O34A 4BW1A 5EI4A 3MXFA 4HXNA 4QUTA 5CRZA 4PCIA 2L84A 4HXLA 4YADA 5HRXA 5TCMA 5CQ8A 4UYEA 5K29A 4CUSA 3JVLA 5HQ6A 3P1DA 5ETDA 5D3HA 3AQAA 3MB3A 4ZW1A 4UIWA 5DKCA 5FDZA 2YDWA 2DATA 4CUQA 4YBTA 5CY9A 4O71A 5HRVA 3DAIA 5I29A 5FE6A 5BT5A 3MULA 3LXJA 4N4GA 3MB4A 5L98A 2D9EA 5CFWA 3D7CA 4YYHA 5F36A 4A9KA 4DONA 5DFBA 2G4AA 4TT4A 4O7CA 5FH7A 4N4IA 4QSQA 4ALGA 5HQ5A 4UYHA 5D7XA 2LSPB 4UYFB 5A83A 5EVAA 4TT6A 5CRMA 5A82A 5AMEA 5E9VA 5C4QA 2R0VA 5D3PA 5E7DA 4BJXA 5LUUA 5KTUA 4NR9A 3LQIA 5D26A 4YABA 4NR5A 5FBXA 4PKLA 4NYWA 5FE9A 4QR3A 5FG6A 4YBSA 4LZ2A 5A5NA 5FE5A 4TU6A 4MR6A 4HBWA 5I7YA 4FLPA 3MUKA 2I7KA 5D3TA 2RNYA 3SVFA 4LDFA 5J0DA 5IGMA 4J0SA 2E7OA 4J0RA 4LYWA 4YC9A 4HXKA 4TQNA 1WUMA 5A5QA 5I40A 4O7BA 4A9OA 3FKMX 5FFWA 4N4HA 5E9KA 5D3NA 5II1A 4NRAA 5IG6A 3P1FA 4O78A 4MR3A 2RS9B 2FSAA 5DX4A 4NYXA 4ZC9A 2H60A 3SVHA 2YEKA 2YELA 4TZ8A 5DFCA 5A5OA 5A85A 5CU8A 5EISA 4C66A 5F60A 3Q2EA 5ACYA 1JSPB 4XUAA 4QY4A 4YY6A 4O77A 5EGUA 2RFJA 2R0SA 2DVSA 5EWCA 5EWDA 1ZS5A 5EPRA 3UV5A 4XY9A 5A5RA 5CQ5A 4YH4A 4O75A 4N3WA 5C7NA 5II2A 4CUTA 5E9YA 3U5KA 3UVWA 3O37A 4UIXA 2RNXA 5L8TA 5F5ZA 5FG5A 4NRCA 5F25A 4A9EA 4NR6A 5COIA 4O72A 4YAXA 5DYUA 5EPSA 5HEMA 5HRWA 4YBMA 5ENHA 5BT4A 2YQDA 2DVRA 4QC3A 3IU5A 4QSPA 4Z1SA 5F63A 3O33A 5DKHA 4Z1QA 4Z93A 4QSRA 4A9JA 4QSVA 5FE2A 5EWWA 2D82A 4QUUA 2E7NA 2RI7A 5CUDA 4MR5A 4F3IA 5DW1A 4KCXA 5FE8A 3TLPA 5I86A 3P5OA 5ENEA 4NUCA 5FE7A 3QZTA 5KHMA 5E3GA 5KU3A 5C89A 4OGIA 2OSSA 4QSSA 5D25A 5CQ7A 3JVJA 4Q0OA 4Z6IA 4QEUA 5I80A 4YYNA 4HBYA 5E9LA 4LYSA 5FB0A 4CURA 4HXPA 5IGNA 5LKZA 4N4FA 4A9LA 4YYMA 5HQ7A 4UITA 4IR4A 4CLBA 4QEWA 5AD2A 4HBXA 5CUEA 4QR4A 3UW9A 1E6IA 2RNWA 4QSTA 5EWVA 4Y03A 5CGPA 5AMFA 5LKUA 5FH6A 4J3IA 5JI8A 2YW5A 4PS5A 5LVRA 5E9IA 4HXOA 4CUUA 4TYLA 4TTEA 4QSXA 5FG4A 5E0RA 5IIDA 5FFYA 4MR4A 3P1CA 4KV4A 5L8UA 3UVXA 5HM0A 2OO1A 5IGKA 5ENGA 5A5SA 4QYLA 1EQFA 4J1PA 4O7AA 4GPJA 4O70A 2OUOA 4A9FA 5L97A 4IR6A 4NR4A 2E3KA 4NR8A 4QZSA 2YEMA 4XUBA 2RO1A 3RCWA 5IGLA 5A5PA 4BW4A 5EU1A 5I83A 4YYJA 5F62A 5EM3A 4UYFA 5DKDA 2F6NA 4XYAA 4TS8A 2DKWA 5H85A 4UIUA 5F61A 5CS8A 3ONIA 5E73A 4A9NA 5LKTA 5CUAA 5C8GA 5ENIA 3G0JA 4YYIA 5FE3A 5DYXA 4BHWA 1JM4B 4NXJA 4UYGA 4Q0NA 5L96A 5FH8A 4HXMA 5LVQA 3U5PA 5EA1A 4A9HA 5DLZA 5I88A 4PY6A 5CQTA 4QR5A 3O35A 5EWHA 5I89A 5F1LA 4QSWA 5KTWA 4WHUA 5EK9A 5DLXA 5HENA 2WP2A 2KTBB 4LR6A 3G0LA 4IR3A 1N72A 4QYDA 5CUCA 5A7CA 5LJ2A 5I1QA 5JWMA 5KTXA 4LZRA 5CZGA 4ALHA 3HMHA 5LKXA 5E74A 2DVQA 4PTBA 4C67A 4QSUA 5CUGA 3QZVA 4TZ2A 5TB6A 1WUGA 5IBNA 5HJCA 3I3JA 4NS5A 2N9GA 4IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUP A;  3S92 A;  5FFV A;  4MEQ A;  5EQ1 A;  2I8N A;  5L99 A;  2DVV A;  5DFD A;  4NYV A;  5ENF A;  4LZS A;  4QNS A;  4HBV A;  4LYI A;  5KO4 A;  5CQ4 A;  5HFQ A;  4ZQL A;  5F1H A;  4NR7 A;  5EP7 A;  4AKN A;  4YK0 A;  5FE1 A;  5ENB A;  5H1T A;  3LQJ A;  5EIC A;  5D0C A;  5F2P A;  4NUE A;  2YYN A;  3U5M A;  3UV4 A;  5H1V A;  2MJV B;  5E3D A;  4MEN A;  4NQN A;  4OUF A;  4WIV A;  4OGJ A;  4HXR A;  4IOQ A;  3ZYU A;  2L5E A;  3K2J A;  5AD3 A;  5DBM A;  3MQM A;  5CP5 A;  4BW2 A;  3QZS A;  4MEP A;  5DYA A;  4YYK A;  4A9I A;  4TT2 A;  4YY4 A;  4CFL A;  5FE0 A;  4KV1 A;  5ETB A;  5D24 A;  3IU6 A;  4QEV A;  4UIZ A;  2GRC A;  2R0Y A;  5CQ6 A;  3JVM A;  5HCL A;  5CUB A;  4HXS A;  5CQA A;  4YYG A;  5HFR A;  4CL9 A;  5A81 A;  3U5J A;  3UVD A;  3AAD A;  5G4R A;  5LJ1 A;  4E96 A;  5D3J A;  4O76 A;  3Q2F A;  5D3L A;  3HME A;  5CPE A;  4Z6H A;  1F68 A;  4MEO A;  3JVK A;  4UIV A;  4NRB A;  4O74 A;  5EPB A;  4IR5 A;  4LRG A;  4QC1 A;  4A9M A;  3GG3 A;  5HLS A;  5D3S A;  5H1U A;  5F3A A;  4IOO A;  3U5N A;  4NQM A;  5D3R A;  3U5O A;  4X2I A;  4UIY A;  4CFK A;  2NXB A;  4QB3 A;  5DY7 A;  2WP1 A;  3LJW A;  4PCE A;  5C85 A;  3S91 A;  5DW2 A;  5HEL A;  4YYD A;  3O36 A;  3LQH A;  2L85 A;  5C87 A;  2DWW A;  5FB1 A;  3P1E A;  5EV9 A;  3U5L A;  5ENC A;  4WHW A;  2F6J A;  1X0J A;  4YAT A;  4BW3 A;  4QBM A;  5ENJ A;  5I7X A;  3HMF A;  3UV2 A;  4O7F A;  3SVG A;  5DYC A;  4TU4 A;  5E9M A;  3DWY A;  3UVY A;  5CQ3 A;  4NUD A;  4O7E A;  5FE4 A;  3NXB A;  4LC2 A;  4YH3 A;  5CTL A;  4RVR A;  4XY8 A;  5BT3 A;  5LJ0 A;  4UYD A;  5G4S A;  2R10 A;  3O34 A;  4BW1 A;  5EI4 A;  3MXF A;  4HXN A;  4QUT A;  5CRZ A;  4PCI A;  2L84 A;  4HXL A;  4YAD A;  5HRX A;  5TCM A;  5CQ8 A;  4UYE A;  5K29 A;  4CUS A;  3JVL A;  5HQ6 A;  3P1D A;  5ETD A;  5D3H A;  3AQA A;  3MB3 A;  4ZW1 A;  4UIW A;  5DKC A;  5FDZ A;  2YDW A;  2DAT A;  4CUQ A;  4YBT A;  5CY9 A;  4O71 A;  5HRV A;  3DAI A;  5I29 A;  5FE6 A;  5BT5 A;  3MUL A;  3LXJ A;  4N4G A;  3MB4 A;  5L98 A;  2D9E A;  5CFW A;  3D7C A;  4YYH A;  5F36 A;  4A9K A;  4DON A;  5DFB A;  2G4A A;  4TT4 A;  4O7C A;  5FH7 A;  4N4I A;  4QSQ A;  4ALG A;  5HQ5 A;  4UYH A;  5D7X A;  2LSP B;  4UYF B;  5A83 A;  5EVA A;  4TT6 A;  5CRM A;  5A82 A;  5AME A;  5E9V A;  5C4Q A;  2R0V A;  5D3P A;  5E7D A;  4BJX A;  5LUU A;  5KTU A;  4NR9 A;  3LQI A;  5D26 A;  4YAB A;  4NR5 A;  5FBX A;  4PKL A;  4NYW A;  5FE9 A;  4QR3 A;  5FG6 A;  4YBS A;  4LZ2 A;  5A5N A;  5FE5 A;  4TU6 A;  4MR6 A;  4HBW A;  5I7Y A;  4FLP A;  3MUK A;  2I7K A;  5D3T A;  2RNY A;  3SVF A;  4LDF A;  5J0D A;  5IGM A;  4J0S A;  2E7O A;  4J0R A;  4LYW A;  4YC9 A;  4HXK A;  4TQN A;  1WUM A;  5A5Q A;  5I40 A;  4O7B A;  4A9O A;  3FKM X;  5FFW A;  4N4H A;  5E9K A;  5D3N A;  5II1 A;  4NRA A;  5IG6 A;  3P1F A;  4O78 A;  4MR3 A;  2RS9 B;  2FSA A;  5DX4 A;  4NYX A;  4ZC9 A;  2H60 A;  3SVH A;  2YEK A;  2YEL A;  4TZ8 A;  5DFC A;  5A5O A;  5A85 A;  5CU8 A;  5EIS A;  4C66 A;  5F60 A;  3Q2E A;  5ACY A;  1JSP B;  4XUA A;  4QY4 A;  4YY6 A;  4O77 A;  5EGU A;  2RFJ A;  2R0S A;  2DVS A;  5EWC A;  5EWD A;  1ZS5 A;  5EPR A;  3UV5 A;  4XY9 A;  5A5R A;  5CQ5 A;  4YH4 A;  4O75 A;  4N3W A;  5C7N A;  5II2 A;  4CUT A;  5E9Y A;  3U5K A;  3UVW A;  3O37 A;  4UIX A;  2RNX A;  5L8T A;  5F5Z A;  5FG5 A;  4NRC A;  5F25 A;  4A9E A;  4NR6 A;  5COI A;  4O72 A;  4YAX A;  5DYU A;  5EPS A;  5HEM A;  5HRW A;  4YBM A;  5ENH A;  5BT4 A;  2YQD A;  2DVR A;  4QC3 A;  3IU5 A;  4QSP A;  4Z1S A;  5F63 A;  3O33 A;  5DKH A;  4Z1Q A;  4Z93 A;  4QSR A;  4A9J A;  4QSV A;  5FE2 A;  5EWW A;  2D82 A;  4QUU A;  2E7N A;  2RI7 A;  5CUD A;  4MR5 A;  4F3I A;  5DW1 A;  4KCX A;  5FE8 A;  3TLP A;  5I86 A;  3P5O A;  5ENE A;  4NUC A;  5FE7 A;  3QZT A;  5KHM A;  5E3G A;  5KU3 A;  5C89 A;  4OGI A;  2OSS A;  4QSS A;  5D25 A;  5CQ7 A;  3JVJ A;  4Q0O A;  4Z6I A;  4QEU A;  5I80 A;  4YYN A;  4HBY A;  5E9L A;  4LYS A;  5FB0 A;  4CUR A;  4HXP A;  5IGN A;  5LKZ A;  4N4F A;  4A9L A;  4YYM A;  5HQ7 A;  4UIT A;  4IR4 A;  4CLB A;  4QEW A;  5AD2 A;  4HBX A;  5CUE A;  4QR4 A;  3UW9 A;  1E6I A;  2RNW A;  4QST A;  5EWV A;  4Y03 A;  5CGP A;  5AMF A;  5LKU A;  5FH6 A;  4J3I A;  5JI8 A;  2YW5 A;  4PS5 A;  5LVR A;  5E9I A;  4HXO A;  4CUU A;  4TYL A;  4TTE A;  4QSX A;  5FG4 A;  5E0R A;  5IID A;  5FFY A;  4MR4 A;  3P1C A;  4KV4 A;  5L8U A;  3UVX A;  5HM0 A;  2OO1 A;  5IGK A;  5ENG A;  5A5S A;  4QYL A;  1EQF A;  4J1P A;  4O7A A;  4GPJ A;  4O70 A;  2OUO A;  4A9F A;  5L97 A;  4IR6 A;  4NR4 A;  2E3K A;  4NR8 A;  4QZS A;  2YEM A;  4XUB A;  2RO1 A;  3RCW A;  5IGL A;  5A5P A;  4BW4 A;  5EU1 A;  5I83 A;  4YYJ A;  5F62 A;  5EM3 A;  4UYF A;  5DKD A;  2F6N A;  4XYA A;  4TS8 A;  2DKW A;  5H85 A;  4UIU A;  5F61 A;  5CS8 A;  3ONI A;  5E73 A;  4A9N A;  5LKT A;  5CUA A;  5C8G A;  5ENI A;  3G0J A;  4YYI A;  5FE3 A;  5DYX A;  4BHW A;  1JM4 B;  4NXJ A;  4UYG A;  4Q0N A;  5L96 A;  5FH8 A;  4HXM A;  5LVQ A;  3U5P A;  5EA1 A;  4A9H A;  5DLZ A;  5I88 A;  4PY6 A;  5CQT A;  4QR5 A;  3O35 A;  5EWH A;  5I89 A;  5F1L A;  4QSW A;  5KTW A;  4WHU A;  5EK9 A;  5DLX A;  5HEN A;  2WP2 A;  2KTB B;  4LR6 A;  3G0L A;  4IR3 A;  1N72 A;  4QYD A;  5CUC A;  5A7C A;  5LJ2 A;  5I1Q A;  5JWM A;  5KTX A;  4LZR A;  5CZG A;  4ALH A;  3HMH A;  5LKX A;  5E74 A;  2DVQ A;  4PTB A;  4C67 A;  4QSU A;  5CUG A;  3QZV A;  4TZ2 A;  5TB6 A;  1WUG A;  5IBN A;  5HJC A;  3I3J A;  4NS5 A;  2N9G A;  4IOR A; 
#chains in the Genus database with same CATH topology
 4CUP A;  3S92 A;  5FFV A;  4MEQ A;  5EQ1 A;  2I8N A;  5L99 A;  2DVV A;  5DFD A;  4NYV A;  5ENF A;  4LZS A;  4QNS A;  4HBV A;  4LYI A;  5KO4 A;  5CQ4 A;  5HFQ A;  4ZQL A;  5F1H A;  4NR7 A;  5EP7 A;  4AKN A;  4YK0 A;  5FE1 A;  5ENB A;  5H1T A;  3LQJ A;  5EIC A;  5D0C A;  5F2P A;  4NUE A;  2YYN A;  3U5M A;  3UV4 A;  5H1V A;  2MJV B;  5E3D A;  4MEN A;  4NQN A;  4OUF A;  4WIV A;  4OGJ A;  4HXR A;  4IOQ A;  3ZYU A;  2L5E A;  3K2J A;  5AD3 A;  5DBM A;  3MQM A;  5CP5 A;  4BW2 A;  3QZS A;  4MEP A;  5DYA A;  4YYK A;  4A9I A;  4TT2 A;  4YY4 A;  4CFL A;  5FE0 A;  4KV1 A;  5ETB A;  5D24 A;  3IU6 A;  4QEV A;  4UIZ A;  2GRC A;  2R0Y A;  5CQ6 A;  3JVM A;  5HCL A;  5CUB A;  4HXS A;  5CQA A;  4YYG A;  5HFR A;  4CL9 A;  5A81 A;  3U5J A;  3UVD A;  3AAD A;  5G4R A;  5LJ1 A;  4E96 A;  5D3J A;  4O76 A;  3Q2F A;  5D3L A;  3HME A;  5CPE A;  4Z6H A;  1F68 A;  4MEO A;  3JVK A;  4UIV A;  4NRB A;  4O74 A;  5EPB A;  4IR5 A;  4LRG A;  4QC1 A;  4A9M A;  3GG3 A;  5HLS A;  5D3S A;  5H1U A;  5F3A A;  4IOO A;  3U5N A;  4NQM A;  5D3R A;  3U5O A;  4X2I A;  4UIY A;  4CFK A;  2NXB A;  4QB3 A;  5DY7 A;  2WP1 A;  3LJW A;  4PCE A;  5C85 A;  3S91 A;  5DW2 A;  5HEL A;  4YYD A;  3O36 A;  3LQH A;  2L85 A;  5C87 A;  2DWW A;  5FB1 A;  3P1E A;  5EV9 A;  3U5L A;  5ENC A;  4WHW A;  2F6J A;  1X0J A;  4YAT A;  4BW3 A;  4QBM A;  5ENJ A;  5I7X A;  3HMF A;  3UV2 A;  4O7F A;  3SVG A;  5DYC A;  4TU4 A;  5E9M A;  3DWY A;  3UVY A;  2EJN A;  5CQ3 A;  4NUD A;  4O7E A;  5FE4 A;  3NXB A;  4LC2 A;  4YH3 A;  5CTL A;  4RVR A;  4XY8 A;  5BT3 A;  5LJ0 A;  4UYD A;  5G4S A;  2R10 A;  3O34 A;  4BW1 A;  5EI4 A;  3MXF A;  4HXN A;  4QUT A;  5CRZ A;  4PCI A;  2L84 A;  4HXL A;  4YAD A;  5HRX A;  5TCM A;  5CQ8 A;  4UYE A;  5K29 A;  4CUS A;  3JVL A;  5HQ6 A;  3P1D A;  5ETD A;  5D3H A;  3AQA A;  3MB3 A;  4ZW1 A;  4UIW A;  5DKC A;  5FDZ A;  2YDW A;  2DAT A;  4CUQ A;  4YBT A;  5CY9 A;  4O71 A;  5HRV A;  3DAI A;  5I29 A;  5FE6 A;  5BT5 A;  3MUL A;  3LXJ A;  4N4G A;  3MB4 A;  5L98 A;  4AKH A;  2D9E A;  5CFW A;  3D7C A;  4YYH A;  4AKI A;  5F36 A;  4A9K A;  3VKH A;  4DON A;  5DFB A;  2G4A A;  4TT4 A;  4O7C A;  5FH7 A;  4N4I A;  4QSQ A;  4ALG A;  5HQ5 A;  4UYH A;  5D7X A;  2LSP B;  4UYF B;  5A83 A;  5EVA A;  4TT6 A;  5CRM A;  5A82 A;  5AME A;  5E9V A;  5C4Q A;  2R0V A;  5D3P A;  5E7D A;  4BJX A;  5LUU A;  5KTU A;  4NR9 A;  1PUO A;  3LQI A;  5D26 A;  4YAB A;  4NR5 A;  5FBX A;  4PKL A;  4NYW A;  5FE9 A;  4QR3 A;  5FG6 A;  3ERR A;  4YBS A;  4LZ2 A;  5A5N A;  5FE5 A;  4TU6 A;  4MR6 A;  4HBW A;  5I7Y A;  4FLP A;  3MUK A;  2I7K A;  5D3T A;  2RNY A;  3SVF A;  4LDF A;  5J0D A;  5IGM A;  4J0S A;  2E7O A;  4J0R A;  4LYW A;  4YC9 A;  4HXK A;  4TQN A;  1WUM A;  5A5Q A;  5I40 A;  4O7B A;  4A9O A;  3FKM X;  5FFW A;  4N4H A;  5E9K A;  5D3N A;  5II1 A;  4NRA A;  5IG6 A;  3P1F A;  4O78 A;  4MR3 A;  2RS9 B;  2FSA A;  5DX4 A;  4NYX A;  4ZC9 A;  2H60 A;  3SVH A;  1ZKR A;  2YEK A;  2YEL A;  4TZ8 A;  5DFC A;  5A5O A;  5A85 A;  5CU8 A;  5EIS A;  4C66 A;  5F60 A;  3Q2E A;  5ACY A;  1JSP B;  4XUA A;  4QY4 A;  4YY6 A;  4O77 A;  5EGU A;  2RFJ A;  2R0S A;  2DVS A;  5EWC A;  5EWD A;  1ZS5 A;  5EPR A;  3UV5 A;  4XY9 A;  5A5R A;  5CQ5 A;  4YH4 A;  4O75 A;  4N3W A;  5C7N A;  5II2 A;  4CUT A;  5E9Y A;  3U5K A;  3UVW A;  3O37 A;  4UIX A;  2RNX A;  5L8T A;  5F5Z A;  5FG5 A;  4NRC A;  5F25 A;  4A9E A;  4NR6 A;  5COI A;  4O72 A;  4YAX A;  5DYU A;  5EPS A;  5HEM A;  5HRW A;  4YBM A;  5ENH A;  5BT4 A;  2YQD A;  2DVR A;  4QC3 A;  3IU5 A;  4QSP A;  4Z1S A;  5F63 A;  3O33 A;  5DKH A;  4Z1Q A;  4Z93 A;  4QSR A;  4A9J A;  4QSV A;  5FE2 A;  5EWW A;  2D82 A;  4QUU A;  2E7N A;  2RI7 A;  5CUD A;  4MR5 A;  4AI6 A;  4F3I A;  5DW1 A;  4KCX A;  5FE8 A;  3TLP A;  5I86 A;  3P5O A;  5ENE A;  4NUC A;  5FE7 A;  3QZT A;  5KHM A;  5E3G A;  5KU3 A;  5C89 A;  4OGI A;  2OSS A;  4QSS A;  5D25 A;  5CQ7 A;  3JVJ A;  4Q0O A;  4Z6I A;  4QEU A;  5I80 A;  4YYN A;  4HBY A;  5E9L A;  4LYS A;  5FB0 A;  4CUR A;  3D1B A;  4HXP A;  5IGN A;  5LKZ A;  4N4F A;  4A9L A;  4YYM A;  5HQ7 A;  4UIT A;  4IR4 A;  4CLB A;  4QEW A;  5AD2 A;  4HBX A;  5CUE A;  4QR4 A;  3UW9 A;  1E6I A;  2RNW A;  4QST A;  5EWV A;  4Y03 A;  5CGP A;  5AMF A;  5LKU A;  5FH6 A;  4J3I A;  5JI8 A;  2YW5 A;  4PS5 A;  5LVR A;  5E9I A;  3VKG A;  4HXO A;  4CUU A;  4TYL A;  4TTE A;  4QSX A;  5FG4 A;  5E0R A;  5IID A;  5FFY A;  4MR4 A;  3P1C A;  4KV4 A;  5L8U A;  3UVX A;  5HM0 A;  2OO1 A;  5IGK A;  5ENG A;  5A5S A;  4QYL A;  1EQF A;  4J1P A;  4O7A A;  4GPJ A;  4O70 A;  2OUO A;  4A9F A;  5L97 A;  4IR6 A;  4NR4 A;  2E3K A;  4NR8 A;  4QZS A;  2YEM A;  4XUB A;  2RO1 A;  3RCW A;  5IGL A;  5A5P A;  4BW4 A;  5EU1 A;  5I83 A;  4YYJ A;  5F62 A;  5EM3 A;  4UYF A;  5DKD A;  2F6N A;  4XYA A;  4TS8 A;  2DKW A;  3D1D A;  5H85 A;  4UIU A;  5F61 A;  5CS8 A;  3ONI A;  5E73 A;  4A9N A;  5LKT A;  5CUA A;  5C8G A;  5ENI A;  3G0J A;  4YYI A;  5FE3 A;  5DYX A;  4BHW A;  1JM4 B;  4NXJ A;  4UYG A;  4Q0N A;  5L96 A;  5FH8 A;  4HXM A;  5LVQ A;  3U5P A;  5EA1 A;  4A9H A;  5DLZ A;  5I88 A;  4PY6 A;  5CQT A;  4QR5 A;  3O35 A;  5EWH A;  5I89 A;  5F1L A;  4QSW A;  5KTW A;  4WHU A;  5EK9 A;  5DLX A;  5HEN A;  2WP2 A;  2KTB B;  4LR6 A;  3G0L A;  4AKG A;  4IR3 A;  1N72 A;  4QYD A;  5CUC A;  5A7C A;  5LJ2 A;  5I1Q A;  5JWM A;  5KTX A;  4LZR A;  5CZG A;  4ALH A;  3HMH A;  5LKX A;  5E74 A;  2DVQ A;  4PTB A;  4C67 A;  4QSU A;  5CUG A;  3QZV A;  4TZ2 A;  5TB6 A;  1WUG A;  5IBN A;  5HJC A;  3I3J A;  4NS5 A;  2N9G A;  4IOR A; 
#chains in the Genus database with same CATH homology
 4CUP A;  3S92 A;  5FFV A;  4MEQ A;  5EQ1 A;  2I8N A;  5L99 A;  2DVV A;  5DFD A;  4NYV A;  5ENF A;  4LZS A;  4QNS A;  4HBV A;  4LYI A;  5KO4 A;  5CQ4 A;  5HFQ A;  4ZQL A;  5F1H A;  4NR7 A;  5EP7 A;  4AKN A;  4YK0 A;  5FE1 A;  5ENB A;  5H1T A;  3LQJ A;  5EIC A;  5D0C A;  5F2P A;  4NUE A;  2YYN A;  3U5M A;  3UV4 A;  5H1V A;  2MJV B;  5E3D A;  4MEN A;  4NQN A;  4OUF A;  4WIV A;  4OGJ A;  4HXR A;  4IOQ A;  3ZYU A;  2L5E A;  3K2J A;  5AD3 A;  5DBM A;  3MQM A;  5CP5 A;  4BW2 A;  3QZS A;  4MEP A;  5DYA A;  4YYK A;  4A9I A;  4TT2 A;  4YY4 A;  4CFL A;  5FE0 A;  4KV1 A;  5ETB A;  5D24 A;  3IU6 A;  4QEV A;  4UIZ A;  2GRC A;  2R0Y A;  5CQ6 A;  3JVM A;  5HCL A;  5CUB A;  4HXS A;  5CQA A;  4YYG A;  5HFR A;  4CL9 A;  5A81 A;  3U5J A;  3UVD A;  3AAD A;  5G4R A;  5LJ1 A;  4E96 A;  5D3J A;  4O76 A;  3Q2F A;  5D3L A;  3HME A;  5CPE A;  4Z6H A;  1F68 A;  4MEO A;  3JVK A;  4UIV A;  4NRB A;  4O74 A;  5EPB A;  4IR5 A;  4LRG A;  4QC1 A;  4A9M A;  3GG3 A;  5HLS A;  5D3S A;  5H1U A;  5F3A A;  4IOO A;  3U5N A;  4NQM A;  5D3R A;  3U5O A;  4X2I A;  4UIY A;  4CFK A;  2NXB A;  4QB3 A;  5DY7 A;  2WP1 A;  3LJW A;  4PCE A;  5C85 A;  3S91 A;  5DW2 A;  5HEL A;  4YYD A;  3O36 A;  3LQH A;  2L85 A;  5C87 A;  2DWW A;  5FB1 A;  3P1E A;  5EV9 A;  3U5L A;  5ENC A;  4WHW A;  2F6J A;  1X0J A;  4YAT A;  4BW3 A;  4QBM A;  5ENJ A;  5I7X A;  3HMF A;  3UV2 A;  4O7F A;  3SVG A;  5DYC A;  4TU4 A;  5E9M A;  3DWY A;  3UVY A;  5CQ3 A;  4NUD A;  4O7E A;  5FE4 A;  3NXB A;  4LC2 A;  4YH3 A;  5CTL A;  4RVR A;  4XY8 A;  5BT3 A;  5LJ0 A;  4UYD A;  5G4S A;  2R10 A;  3O34 A;  4BW1 A;  5EI4 A;  3MXF A;  4HXN A;  4QUT A;  5CRZ A;  4PCI A;  2L84 A;  4HXL A;  4YAD A;  5HRX A;  5TCM A;  5CQ8 A;  4UYE A;  5K29 A;  4CUS A;  3JVL A;  5HQ6 A;  3P1D A;  5ETD A;  5D3H A;  3AQA A;  3MB3 A;  4ZW1 A;  4UIW A;  5DKC A;  5FDZ A;  2YDW A;  2DAT A;  4CUQ A;  4YBT A;  5CY9 A;  4O71 A;  5HRV A;  3DAI A;  5I29 A;  5FE6 A;  5BT5 A;  3MUL A;  3LXJ A;  4N4G A;  3MB4 A;  5L98 A;  2D9E A;  5CFW A;  3D7C A;  4YYH A;  5F36 A;  4A9K A;  4DON A;  5DFB A;  2G4A A;  4TT4 A;  4O7C A;  5FH7 A;  4N4I A;  4QSQ A;  4ALG A;  5HQ5 A;  4UYH A;  5D7X A;  2LSP B;  4UYF B;  5A83 A;  5EVA A;  4TT6 A;  5CRM A;  5A82 A;  5AME A;  5E9V A;  5C4Q A;  2R0V A;  5D3P A;  5E7D A;  4BJX A;  5LUU A;  5KTU A;  4NR9 A;  3LQI A;  5D26 A;  4YAB A;  4NR5 A;  5FBX A;  4PKL A;  4NYW A;  5FE9 A;  4QR3 A;  5FG6 A;  4YBS A;  4LZ2 A;  5A5N A;  5FE5 A;  4TU6 A;  4MR6 A;  4HBW A;  5I7Y A;  4FLP A;  3MUK A;  2I7K A;  5D3T A;  2RNY A;  3SVF A;  4LDF A;  5J0D A;  5IGM A;  4J0S A;  2E7O A;  4J0R A;  4LYW A;  4YC9 A;  4HXK A;  4TQN A;  1WUM A;  5A5Q A;  5I40 A;  4O7B A;  4A9O A;  3FKM X;  5FFW A;  4N4H A;  5E9K A;  5D3N A;  5II1 A;  4NRA A;  5IG6 A;  3P1F A;  4O78 A;  4MR3 A;  2RS9 B;  2FSA A;  5DX4 A;  4NYX A;  4ZC9 A;  2H60 A;  3SVH A;  2YEK A;  2YEL A;  4TZ8 A;  5DFC A;  5A5O A;  5A85 A;  5CU8 A;  5EIS A;  4C66 A;  5F60 A;  3Q2E A;  5ACY A;  1JSP B;  4XUA A;  4QY4 A;  4YY6 A;  4O77 A;  5EGU A;  2RFJ A;  2R0S A;  2DVS A;  5EWC A;  5EWD A;  1ZS5 A;  5EPR A;  3UV5 A;  4XY9 A;  5A5R A;  5CQ5 A;  4YH4 A;  4O75 A;  4N3W A;  5C7N A;  5II2 A;  4CUT A;  5E9Y A;  3U5K A;  3UVW A;  3O37 A;  4UIX A;  2RNX A;  5L8T A;  5F5Z A;  5FG5 A;  4NRC A;  5F25 A;  4A9E A;  4NR6 A;  5COI A;  4O72 A;  4YAX A;  5DYU A;  5EPS A;  5HEM A;  5HRW A;  4YBM A;  5ENH A;  5BT4 A;  2YQD A;  2DVR A;  4QC3 A;  3IU5 A;  4QSP A;  4Z1S A;  5F63 A;  3O33 A;  5DKH A;  4Z1Q A;  4Z93 A;  4QSR A;  4A9J A;  4QSV A;  5FE2 A;  5EWW A;  2D82 A;  4QUU A;  2E7N A;  2RI7 A;  5CUD A;  4MR5 A;  4F3I A;  5DW1 A;  4KCX A;  5FE8 A;  3TLP A;  5I86 A;  3P5O A;  5ENE A;  4NUC A;  5FE7 A;  3QZT A;  5KHM A;  5E3G A;  5KU3 A;  5C89 A;  4OGI A;  2OSS A;  4QSS A;  5D25 A;  5CQ7 A;  3JVJ A;  4Q0O A;  4Z6I A;  4QEU A;  5I80 A;  4YYN A;  4HBY A;  5E9L A;  4LYS A;  5FB0 A;  4CUR A;  4HXP A;  5IGN A;  5LKZ A;  4N4F A;  4A9L A;  4YYM A;  5HQ7 A;  4UIT A;  4IR4 A;  4CLB A;  4QEW A;  5AD2 A;  4HBX A;  5CUE A;  4QR4 A;  3UW9 A;  1E6I A;  2RNW A;  4QST A;  5EWV A;  4Y03 A;  5CGP A;  5AMF A;  5LKU A;  5FH6 A;  4J3I A;  5JI8 A;  2YW5 A;  4PS5 A;  5LVR A;  5E9I A;  4HXO A;  4CUU A;  4TYL A;  4TTE A;  4QSX A;  5FG4 A;  5E0R A;  5IID A;  5FFY A;  4MR4 A;  3P1C A;  4KV4 A;  5L8U A;  3UVX A;  5HM0 A;  2OO1 A;  5IGK A;  5ENG A;  5A5S A;  4QYL A;  1EQF A;  4J1P A;  4O7A A;  4GPJ A;  4O70 A;  2OUO A;  4A9F A;  5L97 A;  4IR6 A;  4NR4 A;  2E3K A;  4NR8 A;  4QZS A;  2YEM A;  4XUB A;  2RO1 A;  3RCW A;  5IGL A;  5A5P A;  4BW4 A;  5EU1 A;  5I83 A;  4YYJ A;  5F62 A;  5EM3 A;  4UYF A;  5DKD A;  2F6N A;  4XYA A;  4TS8 A;  2DKW A;  5H85 A;  4UIU A;  5F61 A;  5CS8 A;  3ONI A;  5E73 A;  4A9N A;  5LKT A;  5CUA A;  5C8G A;  5ENI A;  3G0J A;  4YYI A;  5FE3 A;  5DYX A;  4BHW A;  1JM4 B;  4NXJ A;  4UYG A;  4Q0N A;  5L96 A;  5FH8 A;  4HXM A;  5LVQ A;  3U5P A;  5EA1 A;  4A9H A;  5DLZ A;  5I88 A;  4PY6 A;  5CQT A;  4QR5 A;  3O35 A;  5EWH A;  5I89 A;  5F1L A;  4QSW A;  5KTW A;  4WHU A;  5EK9 A;  5DLX A;  5HEN A;  2WP2 A;  2KTB B;  4LR6 A;  3G0L A;  4IR3 A;  1N72 A;  4QYD A;  5CUC A;  5A7C A;  5LJ2 A;  5I1Q A;  5JWM A;  5KTX A;  4LZR A;  5CZG A;  4ALH A;  3HMH A;  5LKX A;  5E74 A;  2DVQ A;  4PTB A;  4C67 A;  4QSU A;  5CUG A;  3QZV A;  4TZ2 A;  5TB6 A;  1WUG A;  5IBN A;  5HJC A;  3I3J A;  4NS5 A;  2N9G A;  4IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...