4QNSA

Crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
b'GHKEVQLKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQTLIWPKYEAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase GCN5, putative
publication title Crystal structure of bromodomain from Plasmodium faciparum GCN5, PF3D7_0823300
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 40
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qnsA00
4LDFA 5I89A 3D7CA 3U5PA 5HJCA 4MEOA 3JVMA 5H85A 5F62A 4QSPA 3UVDA 4KV1A 3QZVA 5HQ5A 3I3JA 5DKDA 5A7CA 5I29A 5LJ0A 5DX4A 5HRVA 5CUEA 5D7XA 5CPEA 5TCMA 2OUOA 2OSSA 4YK0A 3RCWA 5F1HA 5DYXA 5AMEA 5HEMA 5L8UA 5FFYA 4HXMA 2RFJA 4J1PA 4YH3A 4LZRA 5A5NA 5E74A 5HELA 4MR5A 1E6IA 5D24A 5CQ3A 3JVLA 5ACYA 5CQTA 4QSTA 4BW1A 4CFKA 5HENA 4N4IA 3SVFA 1F68A 4IOQA 4QR5A 4IOOA 2LSPB 5DLZA 5DKHA 4YY6A 4YBMA 3ONIA 5I7YA 4YC9A 5CQ4A 5FE1A 4A9OA 4BW4A 4HXKA 5CQ7A 4PCIA 5EWHA 3SVGA 5II2A 5I1QA 4YH4A 4HXLA 3LQHA 2R0VA 3HMHA 5A5SA 4QY4A 4N4GA 4MEPA 3IU6A 4A9FA 5E9YA 4YYMA 5DW2A 4Y03A 5EWWA 4Z1QA 4CURA 3UV4A 4ZW1A 4N4HA 5CUCA 4QR4A 4BW2A 5I86A 5LVQA 4ZQLA 1X0JA 5FFVA 4QEWA 5BT4A 3AQAA 4TT2A 4BHWA 5DYCA 5EA1A 4OGJA 2OO1A 2NXBA 5A83A 5CP5A 5E3GA 5I88A 5EV9A 5ENEA 5LVRA 4YYHA 4NR5A 5FE3A 5D26A 5E9VA 1JM4B 5LJ2A 4Z6HA 5ENGA 4QEUA 5H1TA 4HXPA 5FE9A 4HXRA 5D25A 3Q2FA 2I7KA 5EVAA 2YELA 5DY7A 4QUTA 5E0RA 5I80A 2DVSA 2D9EA 4HBXA 5F61A 5I40A 2RO1A 5CY9A 3MB4A 5F60A 4J0SA 4NYXA 4O7EA 5EWCA 3UV2A 4F3IA 4WHWA 4HXOA 5HQ6A 5JI8A 4NUDA 5E9IA 5K29A 3S91A 2R0SA 5FH8A 5DW1A 5EI4A 3S92A 3O35A 4NRAA 5CRMA 4PTBA 5G4SA 1WUGA 5I7XA 4CUQA 4UITA 2R0YA 4QNSA 5AD2A 4ZC9A 5CUDA 4UYFB 4TS8A 3DAIA 5FBXA 4UIZA 2R10A 4N3WA 4MR3A 4FLPA 4OUFA 4NUEA 4O78A 5C4QA 5FG6A 5LUUA 5D3TA 5DLXA 3NXBA 5HQ7A 4C66A 4KV4A 4UIYA 4O7AA 5L98A 4CLBA 4XUBA 4IR4A 3LQIA 3MULA 4NYWA 4UIXA 5LKZA 4QR3A 4NR9A 5E9LA 3IU5A 2DWWA 4QEVA 5KTUA 4HBYA 4NRCA 4YATA 5CTLA 2YQDA 5D3HA 5HM0A 5KHMA 5L96A 4QYDA 4CUPA 4BW3A 2KTBB 5EICA 3P5OA 4CUUA 4NUCA 5F2PA 4QC3A 5KO4A 5II1A 5A5RA 5FE5A 4LYWA 4NQNA 5F36A 5C89A 4E96A 5DYUA 4OGIA 5IGLA 4LRGA 3O33A 5C87A 5CZGA 3MB3A 5H1UA 5A81A 5ETBA 4TZ2A 5FE4A 4MEQA 4QUUA 5CU8A 2I8NA 4XUAA 3SVHA 5CQ6A 4QSQA 5C8GA 4NR8A 4NRBA 4IR3A 4UYGA 5F1LA 2G4AA 4YBSA 3MXFA 5FE7A 5A85A 1ZS5A 5FE2A 4O74A 5KTWA 2N9GA 3LXJA 5CQ5A 4HBWA 5D3RA 3U5KA 4NQMA 5AD3A 3U5JA 5EPBA 5KTXA 5H1VA 4QB3A 5J0DA 4IR6A 5CS8A 4QSRA 4QSXA 4WIVA 2RNWA 5D3PA 4YABA 4BJXA 4YY4A 4O77A 4UIVA 5FE0A 5LKXA 2FSAA 5E73A 1JSPB 5G4RA 2YW5A 5IIDA 3HMEA 4J3IA 4UYEA 5FG5A 5HFQA 1WUMA 3P1CA 4UYDA 5CQAA 4A9HA 2RNYA 3DWYA 5E9MA 5F3AA 5HFRA 5D3NA 2E3KA 4O7CA 4TTEA 3O34A 4XY8A 5CUBA 4YAXA 4PY6A 2L85A 4IR5A 5FE6A 4X2IA 3U5NA 4RVRA 2MJVB 5EWDA 4YADA 5CRZA 4UIUA 2YYNA 4DONA 5D3JA 4Q0NA 2DVVA 1EQFA 3GG3A 5CFWA 5LJ1A 3TLPA 5IGKA 4KCXA 5ENJA 4GPJA 5F5ZA 4TZ8A 5D3SA 2WP2A 5EPSA 4QBMA 4QYLA 5BT3A 4TYLA 4A9JA 4IORA 4LR6A 4Z1SA 2WP1A 3G0JA 2E7OA 5DKCA 2RNXA 3AADA 4TU6A 5DBMA 5EGUA 4Z93A 4UYHA 4CFLA 5EU1A 2H60A 5EM3A 1N72A 5EK9A 4QSWA 4NR6A 4NR4A 3UV5A 5D3LA 4A9MA 5DFDA 5DFCA 4PS5A 4YYNA 5F25A 4LYIA 4O72A 4LZ2A 3O36A 4Q0OA 4YYIA 5BT5A 3MQMA 4A9KA 5A5OA 4ALHA 2GRCA 3K2JA 4O71A 4O7BA 4UYFA 4LZSA 4QZSA 4TT6A 5FG4A 5EWVA 4TQNA 5A82A 5E7DA 3UVYA 4XYAA 2RS9B 5LKTA 3U5LA 4PCEA 4CUSA 3QZTA 4MENA 5FB1A 2L84A 5COIA 5CQ8A 4LC2A 5ENCA 5FH6A 5CGPA 5L8TA 4YYGA 4N4FA 5ETDA 3UW9A 4O70A 5E3DA 4A9IA 5HRXA 5TB6A 3LJWA 5IGMA 3MUKA 4O76A 4J0RA 2DVRA 4NXJA 5EPRA 3UVXA 5EP7A 5C7NA 2D82A 5AMFA 5E9KA 4NYVA 2YDWA 4HXSA 5FFWA 5A5PA 5DFBA 4Z6IA 2YEMA 4HBVA 4O7FA 5IBNA 5HLSA 4HXNA 4YYJA 5IG6A 4TU4A 5ENHA 2DKWA 5D0CA 2DATA 5FB0A 4A9EA 3Q2EA 5FH7A 5LKUA 4LYSA 5HRWA 4QC1A 4QSVA 4AKNA 5ENBA 5ENFA 5IGNA 2YEKA 3ZYUA 3U5OA 4NS5A 3G0LA 3JVJA 4CUTA 4MR4A 4WHUA 4O75A 2E7NA 4ALGA 3QZSA 2DVQA 2L5EA 2F6NA 5HCLA 4MR6A 3O37A 3FKMX 5C85A 5CUGA 4QSSA 3U5MA 4UIWA 5KU3A 3P1FA 5JWMA 5L99A 4XY9A 4C67A 4YYKA 5A5QA 4YBTA 5EISA 5EQ1A 2F6JA 3JVKA 4A9LA 2RI7A 5ENIA 4QSUA 4NR7A 4PKLA 3LQJA 5DYAA 4TT4A 5FE8A 4A9NA 5FDZA 3UVWA 3P1EA 5CUAA 3P1DA 4CL9A 3HMFA 5F63A 5L97A 5I83A 4YYDA
chains in the Genus database with same CATH superfamily
4LDFA 5I89A 3D7CA 3U5PA 5HJCA 4MEOA 3JVMA 5H85A 5F62A 4QSPA 3UVDA 3D1DA 4KV1A 3QZVA 5HQ5A 3I3JA 5DKDA 5A7CA 5I29A 5LJ0A 5DX4A 5HRVA 3VKHA 5CUEA 5D7XA 5CPEA 5TCMA 2OUOA 2OSSA 4YK0A 3RCWA 5F1HA 5DYXA 5AMEA 5HEMA 5L8UA 5FFYA 4HXMA 2RFJA 4J1PA 1ZKRA 4YH3A 4LZRA 5A5NA 5E74A 5HELA 4MR5A 1E6IA 5D24A 5CQ3A 3JVLA 5ACYA 5CQTA 4QSTA 4BW1A 4CFKA 5HENA 4N4IA 3SVFA 1F68A 4IOQA 4QR5A 4IOOA 2LSPB 5DLZA 5DKHA 4YY6A 4YBMA 3ONIA 5I7YA 4YC9A 5CQ4A 5FE1A 4A9OA 4BW4A 4HXKA 5CQ7A 4PCIA 5EWHA 3SVGA 5II2A 5I1QA 4YH4A 4HXLA 3LQHA 2R0VA 3HMHA 5A5SA 4QY4A 4N4GA 4MEPA 3IU6A 4A9FA 5E9YA 4YYMA 5DW2A 4Y03A 5EWWA 4Z1QA 4CURA 3UV4A 4ZW1A 4N4HA 5CUCA 4QR4A 4BW2A 3D1BA 5I86A 5LVQA 4ZQLA 1X0JA 5FFVA 4QEWA 5BT4A 3AQAA 4TT2A 4BHWA 5DYCA 5EA1A 4OGJA 2OO1A 2NXBA 5A83A 5CP5A 5E3GA 5I88A 5EV9A 5ENEA 5LVRA 4YYHA 4NR5A 5FE3A 5D26A 5E9VA 1JM4B 5LJ2A 4Z6HA 5ENGA 4QEUA 5H1TA 4HXPA 5FE9A 4HXRA 5D25A 3Q2FA 2I7KA 5EVAA 2YELA 5DY7A 4QUTA 5E0RA 5I80A 2DVSA 2D9EA 4HBXA 5F61A 5I40A 2RO1A 5CY9A 3MB4A 5F60A 4J0SA 4NYXA 4O7EA 5EWCA 3UV2A 4F3IA 4WHWA 4HXOA 5HQ6A 5JI8A 4NUDA 5E9IA 5K29A 3S91A 2R0SA 5FH8A 5DW1A 5EI4A 3S92A 3O35A 4NRAA 5CRMA 4PTBA 5G4SA 1WUGA 5I7XA 4CUQA 4UITA 2R0YA 4QNSA 5AD2A 4ZC9A 5CUDA 4UYFB 4TS8A 3DAIA 5FBXA 4UIZA 2R10A 4N3WA 4MR3A 4FLPA 4OUFA 4NUEA 4O78A 5C4QA 5FG6A 5LUUA 5D3TA 5DLXA 3NXBA 5HQ7A 4C66A 4KV4A 4UIYA 4O7AA 5L98A 4CLBA 4XUBA 4IR4A 3LQIA 3MULA 4NYWA 4UIXA 5LKZA 4QR3A 4NR9A 5E9LA 3IU5A 2DWWA 4QEVA 5KTUA 4HBYA 4NRCA 4YATA 5CTLA 2YQDA 5D3HA 5HM0A 5KHMA 5L96A 4QYDA 4CUPA 4BW3A 2KTBB 5EICA 3P5OA 4CUUA 4NUCA 5F2PA 4QC3A 5KO4A 5II1A 5A5RA 5FE5A 4LYWA 4NQNA 3VKGA 5F36A 5C89A 4E96A 5DYUA 4OGIA 5IGLA 4LRGA 3O33A 5C87A 5CZGA 3MB3A 5H1UA 5A81A 5ETBA 4TZ2A 5FE4A 4MEQA 4QUUA 5CU8A 2I8NA 4XUAA 3SVHA 5CQ6A 4AKIA 4QSQA 5C8GA 4NR8A 4NRBA 4IR3A 4UYGA 5F1LA 2G4AA 4YBSA 3MXFA 5FE7A 5A85A 1ZS5A 5FE2A 4O74A 5KTWA 4AI6A 2N9GA 3LXJA 5CQ5A 4HBWA 5D3RA 3U5KA 4NQMA 5AD3A 3U5JA 5EPBA 5KTXA 5H1VA 4QB3A 5J0DA 4IR6A 5CS8A 4QSRA 4QSXA 4WIVA 2RNWA 5D3PA 4YABA 4BJXA 4YY4A 4O77A 4UIVA 5FE0A 5LKXA 2FSAA 5E73A 1JSPB 5G4RA 2YW5A 5IIDA 3HMEA 4J3IA 4UYEA 5FG5A 5HFQA 1WUMA 3P1CA 4UYDA 5CQAA 4A9HA 2RNYA 3DWYA 5E9MA 5F3AA 5HFRA 5D3NA 2E3KA 4O7CA 4TTEA 3O34A 4XY8A 5CUBA 4YAXA 4PY6A 2L85A 4IR5A 5FE6A 4X2IA 3U5NA 4RVRA 2MJVB 5EWDA 4YADA 2EJNA 5CRZA 4UIUA 4AKGA 2YYNA 4DONA 5D3JA 4Q0NA 2DVVA 1EQFA 3GG3A 5CFWA 5LJ1A 3TLPA 5IGKA 4KCXA 5ENJA 4GPJA 5F5ZA 4TZ8A 5D3SA 2WP2A 5EPSA 4QBMA 4QYLA 5BT3A 4TYLA 4A9JA 4IORA 4LR6A 4Z1SA 2WP1A 3G0JA 2E7OA 5DKCA 2RNXA 3AADA 4TU6A 5DBMA 5EGUA 4Z93A 4UYHA 4CFLA 5EU1A 2H60A 5EM3A 1N72A 5EK9A 4QSWA 4NR6A 4NR4A 3UV5A 5D3LA 4A9MA 5DFDA 5DFCA 4PS5A 4YYNA 5F25A 4LYIA 4O72A 4LZ2A 3O36A 4Q0OA 4YYIA 5BT5A 3MQMA 4A9KA 5A5OA 4ALHA 2GRCA 3K2JA 4O71A 4O7BA 4UYFA 4LZSA 4QZSA 4TT6A 5FG4A 5EWVA 4TQNA 5A82A 5E7DA 3UVYA 4XYAA 2RS9B 5LKTA 3U5LA 4PCEA 4CUSA 3QZTA 4MENA 5FB1A 2L84A 5COIA 5CQ8A 4LC2A 5ENCA 5FH6A 5CGPA 5L8TA 4YYGA 4N4FA 5ETDA 3UW9A 4O70A 5E3DA 4A9IA 5HRXA 5TB6A 3LJWA 5IGMA 3MUKA 4O76A 4J0RA 2DVRA 4NXJA 5EPRA 3UVXA 5EP7A 5C7NA 2D82A 5AMFA 5E9KA 4NYVA 2YDWA 4HXSA 1PUOA 5FFWA 5A5PA 5DFBA 4Z6IA 2YEMA 4HBVA 4O7FA 5IBNA 5HLSA 4HXNA 4YYJA 5IG6A 3ERRA 4TU4A 5ENHA 2DKWA 5D0CA 2DATA 5FB0A 4A9EA 3Q2EA 5FH7A 5LKUA 4LYSA 5HRWA 4QC1A 4QSVA 4AKNA 5ENBA 5ENFA 5IGNA 2YEKA 3ZYUA 3U5OA 4NS5A 3G0LA 3JVJA 4CUTA 4MR4A 4WHUA 4O75A 2E7NA 4ALGA 3QZSA 2DVQA 2L5EA 2F6NA 5HCLA 4MR6A 3O37A 3FKMX 5C85A 5CUGA 4QSSA 3U5MA 4UIWA 5KU3A 3P1FA 5JWMA 5L99A 4XY9A 4C67A 4YYKA 5A5QA 4YBTA 5EISA 5EQ1A 2F6JA 3JVKA 4A9LA 2RI7A 5ENIA 4QSUA 4NR7A 4PKLA 4AKHA 3LQJA 5DYAA 4TT4A 5FE8A 4A9NA 5FDZA 3UVWA 3P1EA 5CUAA 3P1DA 4CL9A 3HMFA 5F63A 5L97A 5I83A 4YYDA
chains in the Genus database with same CATH topology
4LDFA 5I89A 3D7CA 3U5PA 5HJCA 4MEOA 3JVMA 5H85A 5F62A 4QSPA 3UVDA 4KV1A 3QZVA 5HQ5A 3I3JA 5DKDA 5A7CA 5I29A 5LJ0A 5DX4A 5HRVA 5CUEA 5D7XA 5CPEA 5TCMA 2OUOA 2OSSA 4YK0A 3RCWA 5F1HA 5DYXA 5AMEA 5HEMA 5L8UA 5FFYA 4HXMA 2RFJA 4J1PA 4YH3A 4LZRA 5A5NA 5E74A 5HELA 4MR5A 1E6IA 5D24A 5CQ3A 3JVLA 5ACYA 5CQTA 4QSTA 4BW1A 4CFKA 5HENA 4N4IA 3SVFA 1F68A 4IOQA 4QR5A 4IOOA 2LSPB 5DLZA 5DKHA 4YY6A 4YBMA 3ONIA 5I7YA 4YC9A 5CQ4A 5FE1A 4A9OA 4BW4A 4HXKA 5CQ7A 4PCIA 5EWHA 3SVGA 5II2A 5I1QA 4YH4A 4HXLA 3LQHA 2R0VA 3HMHA 5A5SA 4QY4A 4N4GA 4MEPA 3IU6A 4A9FA 5E9YA 4YYMA 5DW2A 4Y03A 5EWWA 4Z1QA 4CURA 3UV4A 4ZW1A 4N4HA 5CUCA 4QR4A 4BW2A 5I86A 5LVQA 4ZQLA 1X0JA 5FFVA 4QEWA 5BT4A 3AQAA 4TT2A 4BHWA 5DYCA 5EA1A 4OGJA 2OO1A 2NXBA 5A83A 5CP5A 5E3GA 5I88A 5EV9A 5ENEA 5LVRA 4YYHA 4NR5A 5FE3A 5D26A 5E9VA 1JM4B 5LJ2A 4Z6HA 5ENGA 4QEUA 5H1TA 4HXPA 5FE9A 4HXRA 5D25A 3Q2FA 2I7KA 5EVAA 2YELA 5DY7A 4QUTA 5E0RA 5I80A 2DVSA 2D9EA 4HBXA 5F61A 5I40A 2RO1A 5CY9A 3MB4A 5F60A 4J0SA 4NYXA 4O7EA 5EWCA 3UV2A 4F3IA 4WHWA 4HXOA 5HQ6A 5JI8A 4NUDA 5E9IA 5K29A 3S91A 2R0SA 5FH8A 5DW1A 5EI4A 3S92A 3O35A 4NRAA 5CRMA 4PTBA 5G4SA 1WUGA 5I7XA 4CUQA 4UITA 2R0YA 4QNSA 5AD2A 4ZC9A 5CUDA 4UYFB 4TS8A 3DAIA 5FBXA 4UIZA 2R10A 4N3WA 4MR3A 4FLPA 4OUFA 4NUEA 4O78A 5C4QA 5FG6A 5LUUA 5D3TA 5DLXA 3NXBA 5HQ7A 4C66A 4KV4A 4UIYA 4O7AA 5L98A 4CLBA 4XUBA 4IR4A 3LQIA 3MULA 4NYWA 4UIXA 5LKZA 4QR3A 4NR9A 5E9LA 3IU5A 2DWWA 4QEVA 5KTUA 4HBYA 4NRCA 4YATA 5CTLA 2YQDA 5D3HA 5HM0A 5KHMA 5L96A 4QYDA 4CUPA 4BW3A 2KTBB 5EICA 3P5OA 4CUUA 4NUCA 5F2PA 4QC3A 5KO4A 5II1A 5A5RA 5FE5A 4LYWA 4NQNA 5F36A 5C89A 4E96A 5DYUA 4OGIA 5IGLA 4LRGA 3O33A 5C87A 5CZGA 3MB3A 5H1UA 5A81A 5ETBA 4TZ2A 5FE4A 4MEQA 4QUUA 5CU8A 2I8NA 4XUAA 3SVHA 5CQ6A 4QSQA 5C8GA 4NR8A 4NRBA 4IR3A 4UYGA 5F1LA 2G4AA 4YBSA 3MXFA 5FE7A 5A85A 1ZS5A 5FE2A 4O74A 5KTWA 2N9GA 3LXJA 5CQ5A 4HBWA 5D3RA 3U5KA 4NQMA 5AD3A 3U5JA 5EPBA 5KTXA 5H1VA 4QB3A 5J0DA 4IR6A 5CS8A 4QSRA 4QSXA 4WIVA 2RNWA 5D3PA 4YABA 4BJXA 4YY4A 4O77A 4UIVA 5FE0A 5LKXA 2FSAA 5E73A 1JSPB 5G4RA 2YW5A 5IIDA 3HMEA 4J3IA 4UYEA 5FG5A 5HFQA 1WUMA 3P1CA 4UYDA 5CQAA 4A9HA 2RNYA 3DWYA 5E9MA 5F3AA 5HFRA 5D3NA 2E3KA 4O7CA 4TTEA 3O34A 4XY8A 5CUBA 4YAXA 4PY6A 2L85A 4IR5A 5FE6A 4X2IA 3U5NA 4RVRA 2MJVB 5EWDA 4YADA 5CRZA 4UIUA 2YYNA 4DONA 5D3JA 4Q0NA 2DVVA 1EQFA 3GG3A 5CFWA 5LJ1A 3TLPA 5IGKA 4KCXA 5ENJA 4GPJA 5F5ZA 4TZ8A 5D3SA 2WP2A 5EPSA 4QBMA 4QYLA 5BT3A 4TYLA 4A9JA 4IORA 4LR6A 4Z1SA 2WP1A 3G0JA 2E7OA 5DKCA 2RNXA 3AADA 4TU6A 5DBMA 5EGUA 4Z93A 4UYHA 4CFLA 5EU1A 2H60A 5EM3A 1N72A 5EK9A 4QSWA 4NR6A 4NR4A 3UV5A 5D3LA 4A9MA 5DFDA 5DFCA 4PS5A 4YYNA 5F25A 4LYIA 4O72A 4LZ2A 3O36A 4Q0OA 4YYIA 5BT5A 3MQMA 4A9KA 5A5OA 4ALHA 2GRCA 3K2JA 4O71A 4O7BA 4UYFA 4LZSA 4QZSA 4TT6A 5FG4A 5EWVA 4TQNA 5A82A 5E7DA 3UVYA 4XYAA 2RS9B 5LKTA 3U5LA 4PCEA 4CUSA 3QZTA 4MENA 5FB1A 2L84A 5COIA 5CQ8A 4LC2A 5ENCA 5FH6A 5CGPA 5L8TA 4YYGA 4N4FA 5ETDA 3UW9A 4O70A 5E3DA 4A9IA 5HRXA 5TB6A 3LJWA 5IGMA 3MUKA 4O76A 4J0RA 2DVRA 4NXJA 5EPRA 3UVXA 5EP7A 5C7NA 2D82A 5AMFA 5E9KA 4NYVA 2YDWA 4HXSA 5FFWA 5A5PA 5DFBA 4Z6IA 2YEMA 4HBVA 4O7FA 5IBNA 5HLSA 4HXNA 4YYJA 5IG6A 4TU4A 5ENHA 2DKWA 5D0CA 2DATA 5FB0A 4A9EA 3Q2EA 5FH7A 5LKUA 4LYSA 5HRWA 4QC1A 4QSVA 4AKNA 5ENBA 5ENFA 5IGNA 2YEKA 3ZYUA 3U5OA 4NS5A 3G0LA 3JVJA 4CUTA 4MR4A 4WHUA 4O75A 2E7NA 4ALGA 3QZSA 2DVQA 2L5EA 2F6NA 5HCLA 4MR6A 3O37A 3FKMX 5C85A 5CUGA 4QSSA 3U5MA 4UIWA 5KU3A 3P1FA 5JWMA 5L99A 4XY9A 4C67A 4YYKA 5A5QA 4YBTA 5EISA 5EQ1A 2F6JA 3JVKA 4A9LA 2RI7A 5ENIA 4QSUA 4NR7A 4PKLA 3LQJA 5DYAA 4TT4A 5FE8A 4A9NA 5FDZA 3UVWA 3P1EA 5CUAA 3P1DA 4CL9A 3HMFA 5F63A 5L97A 5I83A 4YYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDF A;  5I89 A;  3D7C A;  3U5P A;  5HJC A;  4MEO A;  3JVM A;  5H85 A;  5F62 A;  4QSP A;  3UVD A;  4KV1 A;  3QZV A;  5HQ5 A;  3I3J A;  5DKD A;  5A7C A;  5I29 A;  5LJ0 A;  5DX4 A;  5HRV A;  5CUE A;  5D7X A;  5CPE A;  5TCM A;  2OUO A;  2OSS A;  4YK0 A;  3RCW A;  5F1H A;  5DYX A;  5AME A;  5HEM A;  5L8U A;  5FFY A;  4HXM A;  2RFJ A;  4J1P A;  4YH3 A;  4LZR A;  5A5N A;  5E74 A;  5HEL A;  4MR5 A;  1E6I A;  5D24 A;  5CQ3 A;  3JVL A;  5ACY A;  5CQT A;  4QST A;  4BW1 A;  4CFK A;  5HEN A;  4N4I A;  3SVF A;  1F68 A;  4IOQ A;  4QR5 A;  4IOO A;  2LSP B;  5DLZ A;  5DKH A;  4YY6 A;  4YBM A;  3ONI A;  5I7Y A;  4YC9 A;  5CQ4 A;  5FE1 A;  4A9O A;  4BW4 A;  4HXK A;  5CQ7 A;  4PCI A;  5EWH A;  3SVG A;  5II2 A;  5I1Q A;  4YH4 A;  4HXL A;  3LQH A;  2R0V A;  3HMH A;  5A5S A;  4QY4 A;  4N4G A;  4MEP A;  3IU6 A;  4A9F A;  5E9Y A;  4YYM A;  5DW2 A;  4Y03 A;  5EWW A;  4Z1Q A;  4CUR A;  3UV4 A;  4ZW1 A;  4N4H A;  5CUC A;  4QR4 A;  4BW2 A;  5I86 A;  5LVQ A;  4ZQL A;  1X0J A;  5FFV A;  4QEW A;  5BT4 A;  3AQA A;  4TT2 A;  4BHW A;  5DYC A;  5EA1 A;  4OGJ A;  2OO1 A;  2NXB A;  5A83 A;  5CP5 A;  5E3G A;  5I88 A;  5EV9 A;  5ENE A;  5LVR A;  4YYH A;  4NR5 A;  5FE3 A;  5D26 A;  5E9V A;  1JM4 B;  5LJ2 A;  4Z6H A;  5ENG A;  4QEU A;  5H1T A;  4HXP A;  5FE9 A;  4HXR A;  5D25 A;  3Q2F A;  2I7K A;  5EVA A;  2YEL A;  5DY7 A;  4QUT A;  5E0R A;  5I80 A;  2DVS A;  2D9E A;  4HBX A;  5F61 A;  5I40 A;  2RO1 A;  5CY9 A;  3MB4 A;  5F60 A;  4J0S A;  4NYX A;  4O7E A;  5EWC A;  3UV2 A;  4F3I A;  4WHW A;  4HXO A;  5HQ6 A;  5JI8 A;  4NUD A;  5E9I A;  5K29 A;  3S91 A;  2R0S A;  5FH8 A;  5DW1 A;  5EI4 A;  3S92 A;  3O35 A;  4NRA A;  5CRM A;  4PTB A;  5G4S A;  1WUG A;  5I7X A;  4CUQ A;  4UIT A;  2R0Y A;  4QNS A;  5AD2 A;  4ZC9 A;  5CUD A;  4UYF B;  4TS8 A;  3DAI A;  5FBX A;  4UIZ A;  2R10 A;  4N3W A;  4MR3 A;  4FLP A;  4OUF A;  4NUE A;  4O78 A;  5C4Q A;  5FG6 A;  5LUU A;  5D3T A;  5DLX A;  3NXB A;  5HQ7 A;  4C66 A;  4KV4 A;  4UIY A;  4O7A A;  5L98 A;  4CLB A;  4XUB A;  4IR4 A;  3LQI A;  3MUL A;  4NYW A;  4UIX A;  5LKZ A;  4QR3 A;  4NR9 A;  5E9L A;  3IU5 A;  2DWW A;  4QEV A;  5KTU A;  4HBY A;  4NRC A;  4YAT A;  5CTL A;  2YQD A;  5D3H A;  5HM0 A;  5KHM A;  5L96 A;  4QYD A;  4CUP A;  4BW3 A;  2KTB B;  5EIC A;  3P5O A;  4CUU A;  4NUC A;  5F2P A;  4QC3 A;  5KO4 A;  5II1 A;  5A5R A;  5FE5 A;  4LYW A;  4NQN A;  5F36 A;  5C89 A;  4E96 A;  5DYU A;  4OGI A;  5IGL A;  4LRG A;  3O33 A;  5C87 A;  5CZG A;  3MB3 A;  5H1U A;  5A81 A;  5ETB A;  4TZ2 A;  5FE4 A;  4MEQ A;  4QUU A;  5CU8 A;  2I8N A;  4XUA A;  3SVH A;  5CQ6 A;  4QSQ A;  5C8G A;  4NR8 A;  4NRB A;  4IR3 A;  4UYG A;  5F1L A;  2G4A A;  4YBS A;  3MXF A;  5FE7 A;  5A85 A;  1ZS5 A;  5FE2 A;  4O74 A;  5KTW A;  2N9G A;  3LXJ A;  5CQ5 A;  4HBW A;  5D3R A;  3U5K A;  4NQM A;  5AD3 A;  3U5J A;  5EPB A;  5KTX A;  5H1V A;  4QB3 A;  5J0D A;  4IR6 A;  5CS8 A;  4QSR A;  4QSX A;  4WIV A;  2RNW A;  5D3P A;  4YAB A;  4BJX A;  4YY4 A;  4O77 A;  4UIV A;  5FE0 A;  5LKX A;  2FSA A;  5E73 A;  1JSP B;  5G4R A;  2YW5 A;  5IID A;  3HME A;  4J3I A;  4UYE A;  5FG5 A;  5HFQ A;  1WUM A;  3P1C A;  4UYD A;  5CQA A;  4A9H A;  2RNY A;  3DWY A;  5E9M A;  5F3A A;  5HFR A;  5D3N A;  2E3K A;  4O7C A;  4TTE A;  3O34 A;  4XY8 A;  5CUB A;  4YAX A;  4PY6 A;  2L85 A;  4IR5 A;  5FE6 A;  4X2I A;  3U5N A;  4RVR A;  2MJV B;  5EWD A;  4YAD A;  5CRZ A;  4UIU A;  2YYN A;  4DON A;  5D3J A;  4Q0N A;  2DVV A;  1EQF A;  3GG3 A;  5CFW A;  5LJ1 A;  3TLP A;  5IGK A;  4KCX A;  5ENJ A;  4GPJ A;  5F5Z A;  4TZ8 A;  5D3S A;  2WP2 A;  5EPS A;  4QBM A;  4QYL A;  5BT3 A;  4TYL A;  4A9J A;  4IOR A;  4LR6 A;  4Z1S A;  2WP1 A;  3G0J A;  2E7O A;  5DKC A;  2RNX A;  3AAD A;  4TU6 A;  5DBM A;  5EGU A;  4Z93 A;  4UYH A;  4CFL A;  5EU1 A;  2H60 A;  5EM3 A;  1N72 A;  5EK9 A;  4QSW A;  4NR6 A;  4NR4 A;  3UV5 A;  5D3L A;  4A9M A;  5DFD A;  5DFC A;  4PS5 A;  4YYN A;  5F25 A;  4LYI A;  4O72 A;  4LZ2 A;  3O36 A;  4Q0O A;  4YYI A;  5BT5 A;  3MQM A;  4A9K A;  5A5O A;  4ALH A;  2GRC A;  3K2J A;  4O71 A;  4O7B A;  4UYF A;  4LZS A;  4QZS A;  4TT6 A;  5FG4 A;  5EWV A;  4TQN A;  5A82 A;  5E7D A;  3UVY A;  4XYA A;  2RS9 B;  5LKT A;  3U5L A;  4PCE A;  4CUS A;  3QZT A;  4MEN A;  5FB1 A;  2L84 A;  5COI A;  5CQ8 A;  4LC2 A;  5ENC A;  5FH6 A;  5CGP A;  5L8T A;  4YYG A;  4N4F A;  5ETD A;  3UW9 A;  4O70 A;  5E3D A;  4A9I A;  5HRX A;  5TB6 A;  3LJW A;  5IGM A;  3MUK A;  4O76 A;  4J0R A;  2DVR A;  4NXJ A;  5EPR A;  3UVX A;  5EP7 A;  5C7N A;  2D82 A;  5AMF A;  5E9K A;  4NYV A;  2YDW A;  4HXS A;  5FFW A;  5A5P A;  5DFB A;  4Z6I A;  2YEM A;  4HBV A;  4O7F A;  5IBN A;  5HLS A;  4HXN A;  4YYJ A;  5IG6 A;  4TU4 A;  5ENH A;  2DKW A;  5D0C A;  2DAT A;  5FB0 A;  4A9E A;  3Q2E A;  5FH7 A;  5LKU A;  4LYS A;  5HRW A;  4QC1 A;  4QSV A;  4AKN A;  5ENB A;  5ENF A;  5IGN A;  2YEK A;  3ZYU A;  3U5O A;  4NS5 A;  3G0L A;  3JVJ A;  4CUT A;  4MR4 A;  4WHU A;  4O75 A;  2E7N A;  4ALG A;  3QZS A;  2DVQ A;  2L5E A;  2F6N A;  5HCL A;  4MR6 A;  3O37 A;  3FKM X;  5C85 A;  5CUG A;  4QSS A;  3U5M A;  4UIW A;  5KU3 A;  3P1F A;  5JWM A;  5L99 A;  4XY9 A;  4C67 A;  4YYK A;  5A5Q A;  4YBT A;  5EIS A;  5EQ1 A;  2F6J A;  3JVK A;  4A9L A;  2RI7 A;  5ENI A;  4QSU A;  4NR7 A;  4PKL A;  3LQJ A;  5DYA A;  4TT4 A;  5FE8 A;  4A9N A;  5FDZ A;  3UVW A;  3P1E A;  5CUA A;  3P1D A;  4CL9 A;  3HMF A;  5F63 A;  5L97 A;  5I83 A;  4YYD A; 
#chains in the Genus database with same CATH topology
 4LDF A;  5I89 A;  3D7C A;  3U5P A;  5HJC A;  4MEO A;  3JVM A;  5H85 A;  5F62 A;  4QSP A;  3UVD A;  3D1D A;  4KV1 A;  3QZV A;  5HQ5 A;  3I3J A;  5DKD A;  5A7C A;  5I29 A;  5LJ0 A;  5DX4 A;  5HRV A;  3VKH A;  5CUE A;  5D7X A;  5CPE A;  5TCM A;  2OUO A;  2OSS A;  4YK0 A;  3RCW A;  5F1H A;  5DYX A;  5AME A;  5HEM A;  5L8U A;  5FFY A;  4HXM A;  2RFJ A;  4J1P A;  1ZKR A;  4YH3 A;  4LZR A;  5A5N A;  5E74 A;  5HEL A;  4MR5 A;  1E6I A;  5D24 A;  5CQ3 A;  3JVL A;  5ACY A;  5CQT A;  4QST A;  4BW1 A;  4CFK A;  5HEN A;  4N4I A;  3SVF A;  1F68 A;  4IOQ A;  4QR5 A;  4IOO A;  2LSP B;  5DLZ A;  5DKH A;  4YY6 A;  4YBM A;  3ONI A;  5I7Y A;  4YC9 A;  5CQ4 A;  5FE1 A;  4A9O A;  4BW4 A;  4HXK A;  5CQ7 A;  4PCI A;  5EWH A;  3SVG A;  5II2 A;  5I1Q A;  4YH4 A;  4HXL A;  3LQH A;  2R0V A;  3HMH A;  5A5S A;  4QY4 A;  4N4G A;  4MEP A;  3IU6 A;  4A9F A;  5E9Y A;  4YYM A;  5DW2 A;  4Y03 A;  5EWW A;  4Z1Q A;  4CUR A;  3UV4 A;  4ZW1 A;  4N4H A;  5CUC A;  4QR4 A;  4BW2 A;  3D1B A;  5I86 A;  5LVQ A;  4ZQL A;  1X0J A;  5FFV A;  4QEW A;  5BT4 A;  3AQA A;  4TT2 A;  4BHW A;  5DYC A;  5EA1 A;  4OGJ A;  2OO1 A;  2NXB A;  5A83 A;  5CP5 A;  5E3G A;  5I88 A;  5EV9 A;  5ENE A;  5LVR A;  4YYH A;  4NR5 A;  5FE3 A;  5D26 A;  5E9V A;  1JM4 B;  5LJ2 A;  4Z6H A;  5ENG A;  4QEU A;  5H1T A;  4HXP A;  5FE9 A;  4HXR A;  5D25 A;  3Q2F A;  2I7K A;  5EVA A;  2YEL A;  5DY7 A;  4QUT A;  5E0R A;  5I80 A;  2DVS A;  2D9E A;  4HBX A;  5F61 A;  5I40 A;  2RO1 A;  5CY9 A;  3MB4 A;  5F60 A;  4J0S A;  4NYX A;  4O7E A;  5EWC A;  3UV2 A;  4F3I A;  4WHW A;  4HXO A;  5HQ6 A;  5JI8 A;  4NUD A;  5E9I A;  5K29 A;  3S91 A;  2R0S A;  5FH8 A;  5DW1 A;  5EI4 A;  3S92 A;  3O35 A;  4NRA A;  5CRM A;  4PTB A;  5G4S A;  1WUG A;  5I7X A;  4CUQ A;  4UIT A;  2R0Y A;  4QNS A;  5AD2 A;  4ZC9 A;  5CUD A;  4UYF B;  4TS8 A;  3DAI A;  5FBX A;  4UIZ A;  2R10 A;  4N3W A;  4MR3 A;  4FLP A;  4OUF A;  4NUE A;  4O78 A;  5C4Q A;  5FG6 A;  5LUU A;  5D3T A;  5DLX A;  3NXB A;  5HQ7 A;  4C66 A;  4KV4 A;  4UIY A;  4O7A A;  5L98 A;  4CLB A;  4XUB A;  4IR4 A;  3LQI A;  3MUL A;  4NYW A;  4UIX A;  5LKZ A;  4QR3 A;  4NR9 A;  5E9L A;  3IU5 A;  2DWW A;  4QEV A;  5KTU A;  4HBY A;  4NRC A;  4YAT A;  5CTL A;  2YQD A;  5D3H A;  5HM0 A;  5KHM A;  5L96 A;  4QYD A;  4CUP A;  4BW3 A;  2KTB B;  5EIC A;  3P5O A;  4CUU A;  4NUC A;  5F2P A;  4QC3 A;  5KO4 A;  5II1 A;  5A5R A;  5FE5 A;  4LYW A;  4NQN A;  3VKG A;  5F36 A;  5C89 A;  4E96 A;  5DYU A;  4OGI A;  5IGL A;  4LRG A;  3O33 A;  5C87 A;  5CZG A;  3MB3 A;  5H1U A;  5A81 A;  5ETB A;  4TZ2 A;  5FE4 A;  4MEQ A;  4QUU A;  5CU8 A;  2I8N A;  4XUA A;  3SVH A;  5CQ6 A;  4AKI A;  4QSQ A;  5C8G A;  4NR8 A;  4NRB A;  4IR3 A;  4UYG A;  5F1L A;  2G4A A;  4YBS A;  3MXF A;  5FE7 A;  5A85 A;  1ZS5 A;  5FE2 A;  4O74 A;  5KTW A;  4AI6 A;  2N9G A;  3LXJ A;  5CQ5 A;  4HBW A;  5D3R A;  3U5K A;  4NQM A;  5AD3 A;  3U5J A;  5EPB A;  5KTX A;  5H1V A;  4QB3 A;  5J0D A;  4IR6 A;  5CS8 A;  4QSR A;  4QSX A;  4WIV A;  2RNW A;  5D3P A;  4YAB A;  4BJX A;  4YY4 A;  4O77 A;  4UIV A;  5FE0 A;  5LKX A;  2FSA A;  5E73 A;  1JSP B;  5G4R A;  2YW5 A;  5IID A;  3HME A;  4J3I A;  4UYE A;  5FG5 A;  5HFQ A;  1WUM A;  3P1C A;  4UYD A;  5CQA A;  4A9H A;  2RNY A;  3DWY A;  5E9M A;  5F3A A;  5HFR A;  5D3N A;  2E3K A;  4O7C A;  4TTE A;  3O34 A;  4XY8 A;  5CUB A;  4YAX A;  4PY6 A;  2L85 A;  4IR5 A;  5FE6 A;  4X2I A;  3U5N A;  4RVR A;  2MJV B;  5EWD A;  4YAD A;  2EJN A;  5CRZ A;  4UIU A;  4AKG A;  2YYN A;  4DON A;  5D3J A;  4Q0N A;  2DVV A;  1EQF A;  3GG3 A;  5CFW A;  5LJ1 A;  3TLP A;  5IGK A;  4KCX A;  5ENJ A;  4GPJ A;  5F5Z A;  4TZ8 A;  5D3S A;  2WP2 A;  5EPS A;  4QBM A;  4QYL A;  5BT3 A;  4TYL A;  4A9J A;  4IOR A;  4LR6 A;  4Z1S A;  2WP1 A;  3G0J A;  2E7O A;  5DKC A;  2RNX A;  3AAD A;  4TU6 A;  5DBM A;  5EGU A;  4Z93 A;  4UYH A;  4CFL A;  5EU1 A;  2H60 A;  5EM3 A;  1N72 A;  5EK9 A;  4QSW A;  4NR6 A;  4NR4 A;  3UV5 A;  5D3L A;  4A9M A;  5DFD A;  5DFC A;  4PS5 A;  4YYN A;  5F25 A;  4LYI A;  4O72 A;  4LZ2 A;  3O36 A;  4Q0O A;  4YYI A;  5BT5 A;  3MQM A;  4A9K A;  5A5O A;  4ALH A;  2GRC A;  3K2J A;  4O71 A;  4O7B A;  4UYF A;  4LZS A;  4QZS A;  4TT6 A;  5FG4 A;  5EWV A;  4TQN A;  5A82 A;  5E7D A;  3UVY A;  4XYA A;  2RS9 B;  5LKT A;  3U5L A;  4PCE A;  4CUS A;  3QZT A;  4MEN A;  5FB1 A;  2L84 A;  5COI A;  5CQ8 A;  4LC2 A;  5ENC A;  5FH6 A;  5CGP A;  5L8T A;  4YYG A;  4N4F A;  5ETD A;  3UW9 A;  4O70 A;  5E3D A;  4A9I A;  5HRX A;  5TB6 A;  3LJW A;  5IGM A;  3MUK A;  4O76 A;  4J0R A;  2DVR A;  4NXJ A;  5EPR A;  3UVX A;  5EP7 A;  5C7N A;  2D82 A;  5AMF A;  5E9K A;  4NYV A;  2YDW A;  4HXS A;  1PUO A;  5FFW A;  5A5P A;  5DFB A;  4Z6I A;  2YEM A;  4HBV A;  4O7F A;  5IBN A;  5HLS A;  4HXN A;  4YYJ A;  5IG6 A;  3ERR A;  4TU4 A;  5ENH A;  2DKW A;  5D0C A;  2DAT A;  5FB0 A;  4A9E A;  3Q2E A;  5FH7 A;  5LKU A;  4LYS A;  5HRW A;  4QC1 A;  4QSV A;  4AKN A;  5ENB A;  5ENF A;  5IGN A;  2YEK A;  3ZYU A;  3U5O A;  4NS5 A;  3G0L A;  3JVJ A;  4CUT A;  4MR4 A;  4WHU A;  4O75 A;  2E7N A;  4ALG A;  3QZS A;  2DVQ A;  2L5E A;  2F6N A;  5HCL A;  4MR6 A;  3O37 A;  3FKM X;  5C85 A;  5CUG A;  4QSS A;  3U5M A;  4UIW A;  5KU3 A;  3P1F A;  5JWM A;  5L99 A;  4XY9 A;  4C67 A;  4YYK A;  5A5Q A;  4YBT A;  5EIS A;  5EQ1 A;  2F6J A;  3JVK A;  4A9L A;  2RI7 A;  5ENI A;  4QSU A;  4NR7 A;  4PKL A;  4AKH A;  3LQJ A;  5DYA A;  4TT4 A;  5FE8 A;  4A9N A;  5FDZ A;  3UVW A;  3P1E A;  5CUA A;  3P1D A;  4CL9 A;  3HMF A;  5F63 A;  5L97 A;  5I83 A;  4YYD A; 
#chains in the Genus database with same CATH homology
 4LDF A;  5I89 A;  3D7C A;  3U5P A;  5HJC A;  4MEO A;  3JVM A;  5H85 A;  5F62 A;  4QSP A;  3UVD A;  4KV1 A;  3QZV A;  5HQ5 A;  3I3J A;  5DKD A;  5A7C A;  5I29 A;  5LJ0 A;  5DX4 A;  5HRV A;  5CUE A;  5D7X A;  5CPE A;  5TCM A;  2OUO A;  2OSS A;  4YK0 A;  3RCW A;  5F1H A;  5DYX A;  5AME A;  5HEM A;  5L8U A;  5FFY A;  4HXM A;  2RFJ A;  4J1P A;  4YH3 A;  4LZR A;  5A5N A;  5E74 A;  5HEL A;  4MR5 A;  1E6I A;  5D24 A;  5CQ3 A;  3JVL A;  5ACY A;  5CQT A;  4QST A;  4BW1 A;  4CFK A;  5HEN A;  4N4I A;  3SVF A;  1F68 A;  4IOQ A;  4QR5 A;  4IOO A;  2LSP B;  5DLZ A;  5DKH A;  4YY6 A;  4YBM A;  3ONI A;  5I7Y A;  4YC9 A;  5CQ4 A;  5FE1 A;  4A9O A;  4BW4 A;  4HXK A;  5CQ7 A;  4PCI A;  5EWH A;  3SVG A;  5II2 A;  5I1Q A;  4YH4 A;  4HXL A;  3LQH A;  2R0V A;  3HMH A;  5A5S A;  4QY4 A;  4N4G A;  4MEP A;  3IU6 A;  4A9F A;  5E9Y A;  4YYM A;  5DW2 A;  4Y03 A;  5EWW A;  4Z1Q A;  4CUR A;  3UV4 A;  4ZW1 A;  4N4H A;  5CUC A;  4QR4 A;  4BW2 A;  5I86 A;  5LVQ A;  4ZQL A;  1X0J A;  5FFV A;  4QEW A;  5BT4 A;  3AQA A;  4TT2 A;  4BHW A;  5DYC A;  5EA1 A;  4OGJ A;  2OO1 A;  2NXB A;  5A83 A;  5CP5 A;  5E3G A;  5I88 A;  5EV9 A;  5ENE A;  5LVR A;  4YYH A;  4NR5 A;  5FE3 A;  5D26 A;  5E9V A;  1JM4 B;  5LJ2 A;  4Z6H A;  5ENG A;  4QEU A;  5H1T A;  4HXP A;  5FE9 A;  4HXR A;  5D25 A;  3Q2F A;  2I7K A;  5EVA A;  2YEL A;  5DY7 A;  4QUT A;  5E0R A;  5I80 A;  2DVS A;  2D9E A;  4HBX A;  5F61 A;  5I40 A;  2RO1 A;  5CY9 A;  3MB4 A;  5F60 A;  4J0S A;  4NYX A;  4O7E A;  5EWC A;  3UV2 A;  4F3I A;  4WHW A;  4HXO A;  5HQ6 A;  5JI8 A;  4NUD A;  5E9I A;  5K29 A;  3S91 A;  2R0S A;  5FH8 A;  5DW1 A;  5EI4 A;  3S92 A;  3O35 A;  4NRA A;  5CRM A;  4PTB A;  5G4S A;  1WUG A;  5I7X A;  4CUQ A;  4UIT A;  2R0Y A;  4QNS A;  5AD2 A;  4ZC9 A;  5CUD A;  4UYF B;  4TS8 A;  3DAI A;  5FBX A;  4UIZ A;  2R10 A;  4N3W A;  4MR3 A;  4FLP A;  4OUF A;  4NUE A;  4O78 A;  5C4Q A;  5FG6 A;  5LUU A;  5D3T A;  5DLX A;  3NXB A;  5HQ7 A;  4C66 A;  4KV4 A;  4UIY A;  4O7A A;  5L98 A;  4CLB A;  4XUB A;  4IR4 A;  3LQI A;  3MUL A;  4NYW A;  4UIX A;  5LKZ A;  4QR3 A;  4NR9 A;  5E9L A;  3IU5 A;  2DWW A;  4QEV A;  5KTU A;  4HBY A;  4NRC A;  4YAT A;  5CTL A;  2YQD A;  5D3H A;  5HM0 A;  5KHM A;  5L96 A;  4QYD A;  4CUP A;  4BW3 A;  2KTB B;  5EIC A;  3P5O A;  4CUU A;  4NUC A;  5F2P A;  4QC3 A;  5KO4 A;  5II1 A;  5A5R A;  5FE5 A;  4LYW A;  4NQN A;  5F36 A;  5C89 A;  4E96 A;  5DYU A;  4OGI A;  5IGL A;  4LRG A;  3O33 A;  5C87 A;  5CZG A;  3MB3 A;  5H1U A;  5A81 A;  5ETB A;  4TZ2 A;  5FE4 A;  4MEQ A;  4QUU A;  5CU8 A;  2I8N A;  4XUA A;  3SVH A;  5CQ6 A;  4QSQ A;  5C8G A;  4NR8 A;  4NRB A;  4IR3 A;  4UYG A;  5F1L A;  2G4A A;  4YBS A;  3MXF A;  5FE7 A;  5A85 A;  1ZS5 A;  5FE2 A;  4O74 A;  5KTW A;  2N9G A;  3LXJ A;  5CQ5 A;  4HBW A;  5D3R A;  3U5K A;  4NQM A;  5AD3 A;  3U5J A;  5EPB A;  5KTX A;  5H1V A;  4QB3 A;  5J0D A;  4IR6 A;  5CS8 A;  4QSR A;  4QSX A;  4WIV A;  2RNW A;  5D3P A;  4YAB A;  4BJX A;  4YY4 A;  4O77 A;  4UIV A;  5FE0 A;  5LKX A;  2FSA A;  5E73 A;  1JSP B;  5G4R A;  2YW5 A;  5IID A;  3HME A;  4J3I A;  4UYE A;  5FG5 A;  5HFQ A;  1WUM A;  3P1C A;  4UYD A;  5CQA A;  4A9H A;  2RNY A;  3DWY A;  5E9M A;  5F3A A;  5HFR A;  5D3N A;  2E3K A;  4O7C A;  4TTE A;  3O34 A;  4XY8 A;  5CUB A;  4YAX A;  4PY6 A;  2L85 A;  4IR5 A;  5FE6 A;  4X2I A;  3U5N A;  4RVR A;  2MJV B;  5EWD A;  4YAD A;  5CRZ A;  4UIU A;  2YYN A;  4DON A;  5D3J A;  4Q0N A;  2DVV A;  1EQF A;  3GG3 A;  5CFW A;  5LJ1 A;  3TLP A;  5IGK A;  4KCX A;  5ENJ A;  4GPJ A;  5F5Z A;  4TZ8 A;  5D3S A;  2WP2 A;  5EPS A;  4QBM A;  4QYL A;  5BT3 A;  4TYL A;  4A9J A;  4IOR A;  4LR6 A;  4Z1S A;  2WP1 A;  3G0J A;  2E7O A;  5DKC A;  2RNX A;  3AAD A;  4TU6 A;  5DBM A;  5EGU A;  4Z93 A;  4UYH A;  4CFL A;  5EU1 A;  2H60 A;  5EM3 A;  1N72 A;  5EK9 A;  4QSW A;  4NR6 A;  4NR4 A;  3UV5 A;  5D3L A;  4A9M A;  5DFD A;  5DFC A;  4PS5 A;  4YYN A;  5F25 A;  4LYI A;  4O72 A;  4LZ2 A;  3O36 A;  4Q0O A;  4YYI A;  5BT5 A;  3MQM A;  4A9K A;  5A5O A;  4ALH A;  2GRC A;  3K2J A;  4O71 A;  4O7B A;  4UYF A;  4LZS A;  4QZS A;  4TT6 A;  5FG4 A;  5EWV A;  4TQN A;  5A82 A;  5E7D A;  3UVY A;  4XYA A;  2RS9 B;  5LKT A;  3U5L A;  4PCE A;  4CUS A;  3QZT A;  4MEN A;  5FB1 A;  2L84 A;  5COI A;  5CQ8 A;  4LC2 A;  5ENC A;  5FH6 A;  5CGP A;  5L8T A;  4YYG A;  4N4F A;  5ETD A;  3UW9 A;  4O70 A;  5E3D A;  4A9I A;  5HRX A;  5TB6 A;  3LJW A;  5IGM A;  3MUK A;  4O76 A;  4J0R A;  2DVR A;  4NXJ A;  5EPR A;  3UVX A;  5EP7 A;  5C7N A;  2D82 A;  5AMF A;  5E9K A;  4NYV A;  2YDW A;  4HXS A;  5FFW A;  5A5P A;  5DFB A;  4Z6I A;  2YEM A;  4HBV A;  4O7F A;  5IBN A;  5HLS A;  4HXN A;  4YYJ A;  5IG6 A;  4TU4 A;  5ENH A;  2DKW A;  5D0C A;  2DAT A;  5FB0 A;  4A9E A;  3Q2E A;  5FH7 A;  5LKU A;  4LYS A;  5HRW A;  4QC1 A;  4QSV A;  4AKN A;  5ENB A;  5ENF A;  5IGN A;  2YEK A;  3ZYU A;  3U5O A;  4NS5 A;  3G0L A;  3JVJ A;  4CUT A;  4MR4 A;  4WHU A;  4O75 A;  2E7N A;  4ALG A;  3QZS A;  2DVQ A;  2L5E A;  2F6N A;  5HCL A;  4MR6 A;  3O37 A;  3FKM X;  5C85 A;  5CUG A;  4QSS A;  3U5M A;  4UIW A;  5KU3 A;  3P1F A;  5JWM A;  5L99 A;  4XY9 A;  4C67 A;  4YYK A;  5A5Q A;  4YBT A;  5EIS A;  5EQ1 A;  2F6J A;  3JVK A;  4A9L A;  2RI7 A;  5ENI A;  4QSU A;  4NR7 A;  4PKL A;  3LQJ A;  5DYA A;  4TT4 A;  5FE8 A;  4A9N A;  5FDZ A;  3UVW A;  3P1E A;  5CUA A;  3P1D A;  4CL9 A;  3HMF A;  5F63 A;  5L97 A;  5I83 A;  4YYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...