4QNSA

Crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
GHKEVQLKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQTLIWPKYEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase GCN5, putative
publication title Crystal structure of bromodomain from Plasmodium faciparum GCN5, PF3D7_0823300
rcsb
source organism Plasmodium falciparum
total genus 40
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qnsA00
4HXLA 5DW1A 3UV2A 5E9YA 4YH3A 1F68A 2G4AA 2N9GA 4XY9A 5TCMA 4QSQA 5I7YA 5FE7A 5DKDA 4BW1A 4YYDA 5CY9A 5FE2A 4BW4A 5CUEA 3MXFA 5F1LA 4O72A 5FG5A 4KV4A 3SVGA 5FE0A 4O70A 5DKHA 5I80A 4NUDA 5EWDA 5L98A 5TB6A 5LVRA 5I29A 4YH4A 5BT5A 2YEKA 5HENA 4MR4A 2DVQA 4O75A 5DKCA 5HQ5A 4YYGA 5EV9A 5HJCA 4QNSA 4NR5A 4UYHA 2WP2A 5FE9A 4YYJA 3MB3A 4YBMA 4WHWA 5E7DA 4QBMA 4WIVA 3LQIA 5DFBA 5IBNA 2RS9B 4IR5A 3Q2FA 3G0JA 4CLBA 5D3PA 2R10A 5CQAA 5L99A 5KHMA 4IR3A 5DFCA 4HBVA 2YEMA 5CS8A 5DW2A 3UVYA 1E6IA 5D3NA 5HM0A 4YYMA 4J3IA 4QZSA 3MB4A 5EVAA 2NXBA 5D7XA 5A5NA 3LQJA 2H60A 4TQNA 5ENFA 5D3LA 4TYLA 4HXPA 4NRAA 4QC3A 1JM4B 5F1HA 5E9VA 2OUOA 5CQ5A 4ZC9A 4HBXA 4BW2A 3TLPA 5G4RA 5IGLA 5E3GA 5L96A 5HRWA 4NR4A 4KV1A 5CUAA 3LXJA 4MR3A 5ENCA 5CUCA 4NUCA 5F3AA 3DAIA 5DLZA 3AQAA 3ONIA 5I88A 4IOQA 4CUQA 4LC2A 5C85A 4NRCA 5D3SA 5EPRA 5II2A 5I89A 4OUFA 3P5OA 5F25A 1ZS5A 5CQ4A 4QR3A 4TU4A 5BT4A 3UV5A 4WHUA 4KCXA 4O77A 4UYFB 5DLXA 3QZVA 3S92A 5FFVA 5A5PA 4YK0A 3GG3A 4TT6A 4NYVA 4O7BA 4CUPA 5FFWA 2R0VA 4BJXA 4N3WA 5H1TA 4MENA 2F6JA 1X0JA 2D82A 4HXRA 4UYFA 4YYNA 3P1CA 4O71A 4Z1QA 5CUDA 4MEQA 3IU5A 2OO1A 1WUMA 2YDWA 4QSXA 4HXSA 4XUBA 5G4SA 2YELA 1N72A 4OGJA 5HRXA 3O33A 4YATA 4O7FA 5L97A 4UIUA 4UITA 5E9LA 2L5EA 3UW9A 3HMFA 4NQNA 5EWWA 5EM3A 3SVHA 5KTXA 5AD2A 2LSPB 5DYUA 4Z93A 3U5NA 5C7NA 4QR5A 5F60A 4TZ8A 4HBYA 5D3HA 5HRVA 4OGIA 3UV4A 5FE5A 5KU3A 5ETDA 4LZRA 4PKLA 4QSTA 4O7AA 4QSRA 4HXKA 4TS8A 5CUBA 4LYSA 4TTEA 5F2PA 4NR7A 2RFJA 3UVXA 4NR6A 4CURA 5JI8A 3Q2EA 3D7CA 5I1QA 5E3DA 3JVLA 4C66A 1EQFA 4LYIA 4F3IA 4QSPA 5KTWA 4UIVA 4YAXA 5HQ7A 5AMFA 4J1PA 4PTBA 3QZSA 4QSVA 4BW3A 5KTUA 4J0RA 4NYWA 4Z6IA 5FH7A 4TT4A 4PCEA 5A85A 2YW5A 5FDZA 4YYKA 3U5OA 4MR6A 4YBTA 2E7OA 4HBWA 4IOOA 4QUTA 5EWHA 5ACYA 4X2IA 4FLPA 4ZQLA 2RO1A 5DY7A 5ENIA 5ENJA 5II1A 5LKTA 4UIYA 4N4HA 2KTBB 5F63A 4HXOA 4A9NA 4O7CA 5H1VA 3ZYUA 5CRMA 5HLSA 4QUUA 4YYIA 3O37A 4A9MA 5D3JA 4XUAA 4LDFA 5CQ6A 3K2JA 3P1FA 4NYXA 5LKXA 4HXMA 4RVRA 4E96A 2RI7A 5E9IA 5CUGA 4Z1SA 3UVWA 5CQTA 5CRZA 5D26A 2MJVB 3JVKA 4Z6HA 5EQ1A 5CGPA 4IR4A 2DVRA 3QZTA 5D3TA 5L8UA 4QY4A 5FFYA 3MUKA 5EISA 4LYWA 5H85A 4PCIA 2R0YA 3MQMA 5FB0A 5A5RA 5EPBA 4QSWA 5COIA 2RNWA 5LJ0A 2DWWA 2GRCA 4XYAA 5EK9A 5CTLA 4A9IA 4ALHA 5C8GA 4UYDA 4UIWA 4CFKA 5FE4A 4LR6A 2I8NA 4NRBA 5LKZA 5EICA 5F5ZA 4ALGA 5IIDA 4Q0NA 5EP7A 4O76A 5EI4A 4AKNA 3O34A 5AMEA 4GPJA 5KO4A 5ENBA 5DBMA 5FE8A 4NR9A 4IORA 4MR5A 5CU8A 5JWMA 3UVDA 5I7XA 2DVVA 5C89A 2YQDA 5DX4A 4NUEA 4HXNA 5F36A 3RCWA 4CUTA 5ENGA 4O7EA 4YY6A 5IGMA 4Q0OA 4CFLA 4QSSA 2I7KA 4A9HA 3O35A 5A82A 4O78A 4QYDA 4QB3A 2FSAA 3O36A 4QYLA 5C4QA 5A81A 4LZ2A 5DYCA 5A83A 5HFQA 3U5MA 4YABA 5BT3A 4QEWA 5CQ8A 4A9EA 5HFRA 4UYGA 4YY4A 1WUGA 5D3RA 4YC9A 3P1DA 3AADA 5FBXA 4DONA 5DYAA 2WP1A 4A9JA 4CUSA 3U5LA 5L8TA 4UYEA 4UIZA 5DYXA 5ENEA 3I3JA 5IG6A 2RNYA 4N4GA 5IGNA 2DKWA 4QEVA 5FG6A 4O74A 5LKUA 5HELA 3SVFA 5H1UA 3IU6A 5CQ7A 2L84A 4MEOA 4NXJA 4J0SA 4A9LA 4A9FA 5A5SA 3HMHA 4YADA 2RNXA 5HEMA 4CL9A 4C67A 3P1EA 4NQMA 4QR4A 5CP5A 5F61A 5FE6A 4YYHA 1JSPB 5FE1A 5EU1A 5CFWA 3HMEA 5AD3A 2YYNA 5EGUA 5D25A 4IR6A 4ZW1A 5HCLA 5C87A 5J0DA 4NR8A 4A9OA 5ETBA 2E3KA 4XY8A 4PY6A 3DWYA 5DFDA 4A9KA 5IGKA 4Y03A 5FE3A 4TZ2A 5E74A 5FH8A 5D0CA 2DATA 5EPSA 3G0LA 3U5KA 3NXBA 5I40A 3FKMX 4PS5A 5EWCA 2OSSA 5CZGA 3JVJA 5ENHA 3S91A 5I83A 5LUUA 3JVMA 5FB1A 5A7CA 5CPEA 4CUUA 5K29A 4BHWA 5CQ3A 2R0SA 5E9KA 5EWVA 5LJ2A 3LQHA 2DVSA 3MULA 2D9EA 4N4FA 5FG4A 5HQ6A 4MEPA 4TU6A 5LJ1A 5EA1A 4LZSA 3U5PA 5I86A 4QSUA 4LRGA 5D24A 5A5QA 2E7NA 3U5JA 2F6NA 4UIXA 3LJWA 4TT2A 4YBSA 5FH6A 4NS5A 5F62A 5E73A 4QC1A 4N4IA 5E0RA 5A5OA 2L85A 4QEUA 5E9MA 5LVQA
chains in the Genus database with same CATH superfamily
4HXLA 5DW1A 3UV2A 5E9YA 4YH3A 1F68A 2G4AA 2N9GA 4XY9A 5TCMA 4QSQA 5I7YA 5FE7A 5DKDA 4BW1A 4YYDA 5CY9A 5FE2A 4BW4A 5CUEA 3MXFA 5F1LA 4O72A 5FG5A 4KV4A 3SVGA 5FE0A 4O70A 5DKHA 5I80A 4NUDA 5EWDA 5L98A 4AKHA 5TB6A 5LVRA 5I29A 4YH4A 5BT5A 2YEKA 5HENA 4MR4A 2DVQA 4O75A 5DKCA 5HQ5A 4YYGA 5EV9A 5HJCA 4QNSA 4NR5A 4UYHA 2WP2A 5FE9A 4YYJA 3MB3A 4YBMA 4WHWA 5E7DA 4QBMA 4WIVA 3LQIA 5DFBA 5IBNA 2RS9B 4IR5A 3Q2FA 3G0JA 4CLBA 5D3PA 2R10A 5CQAA 5L99A 5KHMA 4IR3A 5DFCA 4HBVA 2YEMA 4AI6A 5CS8A 5DW2A 3UVYA 1E6IA 5D3NA 5HM0A 4YYMA 4J3IA 4QZSA 3MB4A 5EVAA 2NXBA 5D7XA 5A5NA 3LQJA 2H60A 4TQNA 5ENFA 3D1BA 5D3LA 4TYLA 4HXPA 4NRAA 4QC3A 1JM4B 5F1HA 5E9VA 2OUOA 5CQ5A 4ZC9A 4HBXA 4BW2A 3TLPA 5G4RA 5IGLA 5E3GA 5L96A 5HRWA 4NR4A 4KV1A 5CUAA 3LXJA 4MR3A 5ENCA 5CUCA 4NUCA 5F3AA 3DAIA 5DLZA 3AQAA 3ONIA 5I88A 4IOQA 4CUQA 4LC2A 5C85A 4NRCA 5D3SA 5EPRA 5II2A 5I89A 4OUFA 3P5OA 5F25A 1ZS5A 5CQ4A 4QR3A 4TU4A 5BT4A 3UV5A 4WHUA 4KCXA 4O77A 4UYFB 5DLXA 3QZVA 3S92A 5FFVA 5A5PA 4YK0A 3GG3A 4TT6A 4NYVA 4O7BA 4CUPA 5FFWA 2R0VA 3ERRA 4BJXA 4N3WA 5H1TA 4MENA 2F6JA 1X0JA 2D82A 4HXRA 4UYFA 4YYNA 3P1CA 4O71A 4Z1QA 5CUDA 4MEQA 3IU5A 2OO1A 1WUMA 2YDWA 4QSXA 4HXSA 4XUBA 5G4SA 2YELA 1N72A 4OGJA 5HRXA 3O33A 4YATA 4O7FA 5L97A 4UIUA 4UITA 5E9LA 2L5EA 3UW9A 3HMFA 4NQNA 5EWWA 5EM3A 3SVHA 5KTXA 3VKGA 5AD2A 2LSPB 5DYUA 4Z93A 3U5NA 5C7NA 4QR5A 5F60A 4TZ8A 4HBYA 5D3HA 5HRVA 4OGIA 3UV4A 5FE5A 5KU3A 5ETDA 4LZRA 4PKLA 4QSTA 4O7AA 4QSRA 4HXKA 4TS8A 5CUBA 4LYSA 4TTEA 5F2PA 4NR7A 2RFJA 3UVXA 4NR6A 4CURA 5JI8A 3Q2EA 3D7CA 5I1QA 5E3DA 3JVLA 4C66A 1EQFA 4LYIA 4F3IA 4QSPA 5KTWA 4UIVA 4YAXA 5HQ7A 5AMFA 4J1PA 4PTBA 3QZSA 4QSVA 4BW3A 5KTUA 4J0RA 4NYWA 4Z6IA 5FH7A 4TT4A 4PCEA 5A85A 2YW5A 5FDZA 4YYKA 3U5OA 4MR6A 4YBTA 2E7OA 4HBWA 4IOOA 4QUTA 5EWHA 5ACYA 4X2IA 4FLPA 4ZQLA 2RO1A 5DY7A 5ENIA 5ENJA 5II1A 5LKTA 4UIYA 4N4HA 2KTBB 5F63A 4HXOA 4A9NA 4O7CA 5H1VA 3ZYUA 5CRMA 5HLSA 4QUUA 4YYIA 3O37A 4AKIA 4A9MA 5D3JA 4XUAA 4LDFA 5CQ6A 3K2JA 3P1FA 4NYXA 5LKXA 4HXMA 4RVRA 4E96A 2RI7A 5E9IA 5CUGA 4Z1SA 3UVWA 5CQTA 5CRZA 5D26A 2MJVB 3JVKA 4Z6HA 5EQ1A 5CGPA 4IR4A 2DVRA 3QZTA 5D3TA 5L8UA 4QY4A 5FFYA 3MUKA 5EISA 4LYWA 5H85A 4PCIA 1PUOA 2R0YA 3MQMA 5FB0A 5A5RA 2EJNA 5EPBA 1ZKRA 4QSWA 5COIA 2RNWA 5LJ0A 2DWWA 2GRCA 4XYAA 5EK9A 5CTLA 4A9IA 4ALHA 5C8GA 4UYDA 4UIWA 4CFKA 5FE4A 4LR6A 2I8NA 4NRBA 5LKZA 5EICA 5F5ZA 4ALGA 5IIDA 4Q0NA 5EP7A 4O76A 5EI4A 4AKNA 3O34A 5AMEA 4GPJA 5KO4A 5ENBA 5DBMA 5FE8A 4NR9A 4IORA 4MR5A 5CU8A 5JWMA 3UVDA 5I7XA 2DVVA 5C89A 2YQDA 5DX4A 4NUEA 4HXNA 5F36A 3RCWA 4CUTA 5ENGA 4O7EA 4YY6A 5IGMA 4Q0OA 4CFLA 4QSSA 2I7KA 4A9HA 3O35A 5A82A 4O78A 4QYDA 4QB3A 2FSAA 3O36A 4QYLA 5C4QA 5A81A 4AKGA 4LZ2A 5DYCA 5A83A 5HFQA 3U5MA 4YABA 5BT3A 4QEWA 5CQ8A 4A9EA 5HFRA 4UYGA 4YY4A 1WUGA 5D3RA 4YC9A 3P1DA 3AADA 5FBXA 4DONA 5DYAA 2WP1A 4A9JA 4CUSA 3U5LA 5L8TA 4UYEA 4UIZA 5DYXA 5ENEA 3I3JA 5IG6A 2RNYA 4N4GA 5IGNA 2DKWA 4QEVA 5FG6A 4O74A 5LKUA 5HELA 3SVFA 5H1UA 3IU6A 5CQ7A 2L84A 4MEOA 4NXJA 4J0SA 4A9LA 4A9FA 5A5SA 3HMHA 4YADA 2RNXA 5HEMA 4CL9A 4C67A 3P1EA 4NQMA 4QR4A 5CP5A 5F61A 5FE6A 4YYHA 1JSPB 5FE1A 5EU1A 5CFWA 3HMEA 5AD3A 2YYNA 5EGUA 5D25A 4IR6A 4ZW1A 5HCLA 5C87A 5J0DA 4NR8A 4A9OA 5ETBA 2E3KA 4XY8A 4PY6A 3DWYA 5DFDA 4A9KA 5IGKA 4Y03A 5FE3A 4TZ2A 5E74A 5FH8A 5D0CA 2DATA 5EPSA 3G0LA 3U5KA 3NXBA 5I40A 3FKMX 4PS5A 5EWCA 2OSSA 5CZGA 3JVJA 5ENHA 3S91A 5I83A 5LUUA 3JVMA 5FB1A 5A7CA 5CPEA 4CUUA 5K29A 4BHWA 5CQ3A 2R0SA 5E9KA 3D1DA 5EWVA 5LJ2A 3LQHA 2DVSA 3MULA 2D9EA 4N4FA 5FG4A 5HQ6A 4MEPA 4TU6A 5LJ1A 5EA1A 4LZSA 3U5PA 5I86A 4QSUA 4LRGA 5D24A 5A5QA 2E7NA 3U5JA 2F6NA 4UIXA 3LJWA 4TT2A 4YBSA 5FH6A 4NS5A 5F62A 5E73A 3VKHA 4QC1A 4N4IA 5E0RA 5A5OA 2L85A 4QEUA 5E9MA 5LVQA
chains in the Genus database with same CATH topology
4HXLA 5DW1A 3UV2A 5E9YA 4YH3A 1F68A 2G4AA 2N9GA 4XY9A 5TCMA 4QSQA 5I7YA 5FE7A 5DKDA 4BW1A 4YYDA 5CY9A 5FE2A 4BW4A 5CUEA 3MXFA 5F1LA 4O72A 5FG5A 4KV4A 3SVGA 5FE0A 4O70A 5DKHA 5I80A 4NUDA 5EWDA 5L98A 5TB6A 5LVRA 5I29A 4YH4A 5BT5A 2YEKA 5HENA 4MR4A 2DVQA 4O75A 5DKCA 5HQ5A 4YYGA 5EV9A 5HJCA 4QNSA 4NR5A 4UYHA 2WP2A 5FE9A 4YYJA 3MB3A 4YBMA 4WHWA 5E7DA 4QBMA 4WIVA 3LQIA 5DFBA 5IBNA 2RS9B 4IR5A 3Q2FA 3G0JA 4CLBA 5D3PA 2R10A 5CQAA 5L99A 5KHMA 4IR3A 5DFCA 4HBVA 2YEMA 5CS8A 5DW2A 3UVYA 1E6IA 5D3NA 5HM0A 4YYMA 4J3IA 4QZSA 3MB4A 5EVAA 2NXBA 5D7XA 5A5NA 3LQJA 2H60A 4TQNA 5ENFA 5D3LA 4TYLA 4HXPA 4NRAA 4QC3A 1JM4B 5F1HA 5E9VA 2OUOA 5CQ5A 4ZC9A 4HBXA 4BW2A 3TLPA 5G4RA 5IGLA 5E3GA 5L96A 5HRWA 4NR4A 4KV1A 5CUAA 3LXJA 4MR3A 5ENCA 5CUCA 4NUCA 5F3AA 3DAIA 5DLZA 3AQAA 3ONIA 5I88A 4IOQA 4CUQA 4LC2A 5C85A 4NRCA 5D3SA 5EPRA 5II2A 5I89A 4OUFA 3P5OA 5F25A 1ZS5A 5CQ4A 4QR3A 4TU4A 5BT4A 3UV5A 4WHUA 4KCXA 4O77A 4UYFB 5DLXA 3QZVA 3S92A 5FFVA 5A5PA 4YK0A 3GG3A 4TT6A 4NYVA 4O7BA 4CUPA 5FFWA 2R0VA 4BJXA 4N3WA 5H1TA 4MENA 2F6JA 1X0JA 2D82A 4HXRA 4UYFA 4YYNA 3P1CA 4O71A 4Z1QA 5CUDA 4MEQA 3IU5A 2OO1A 1WUMA 2YDWA 4QSXA 4HXSA 4XUBA 5G4SA 2YELA 1N72A 4OGJA 5HRXA 3O33A 4YATA 4O7FA 5L97A 4UIUA 4UITA 5E9LA 2L5EA 3UW9A 3HMFA 4NQNA 5EWWA 5EM3A 3SVHA 5KTXA 5AD2A 2LSPB 5DYUA 4Z93A 3U5NA 5C7NA 4QR5A 5F60A 4TZ8A 4HBYA 5D3HA 5HRVA 4OGIA 3UV4A 5FE5A 5KU3A 5ETDA 4LZRA 4PKLA 4QSTA 4O7AA 4QSRA 4HXKA 4TS8A 5CUBA 4LYSA 4TTEA 5F2PA 4NR7A 2RFJA 3UVXA 4NR6A 4CURA 5JI8A 3Q2EA 3D7CA 5I1QA 5E3DA 3JVLA 4C66A 1EQFA 4LYIA 4F3IA 4QSPA 5KTWA 4UIVA 4YAXA 5HQ7A 5AMFA 4J1PA 4PTBA 3QZSA 4QSVA 4BW3A 5KTUA 4J0RA 4NYWA 4Z6IA 5FH7A 4TT4A 4PCEA 5A85A 2YW5A 5FDZA 4YYKA 3U5OA 4MR6A 4YBTA 2E7OA 4HBWA 4IOOA 4QUTA 5EWHA 5ACYA 4X2IA 4FLPA 4ZQLA 2RO1A 5DY7A 5ENIA 5ENJA 5II1A 5LKTA 4UIYA 4N4HA 2KTBB 5F63A 4HXOA 4A9NA 4O7CA 5H1VA 3ZYUA 5CRMA 5HLSA 4QUUA 4YYIA 3O37A 4A9MA 5D3JA 4XUAA 4LDFA 5CQ6A 3K2JA 3P1FA 4NYXA 5LKXA 4HXMA 4RVRA 4E96A 2RI7A 5E9IA 5CUGA 4Z1SA 3UVWA 5CQTA 5CRZA 5D26A 2MJVB 3JVKA 4Z6HA 5EQ1A 5CGPA 4IR4A 2DVRA 3QZTA 5D3TA 5L8UA 4QY4A 5FFYA 3MUKA 5EISA 4LYWA 5H85A 4PCIA 2R0YA 3MQMA 5FB0A 5A5RA 5EPBA 4QSWA 5COIA 2RNWA 5LJ0A 2DWWA 2GRCA 4XYAA 5EK9A 5CTLA 4A9IA 4ALHA 5C8GA 4UYDA 4UIWA 4CFKA 5FE4A 4LR6A 2I8NA 4NRBA 5LKZA 5EICA 5F5ZA 4ALGA 5IIDA 4Q0NA 5EP7A 4O76A 5EI4A 4AKNA 3O34A 5AMEA 4GPJA 5KO4A 5ENBA 5DBMA 5FE8A 4NR9A 4IORA 4MR5A 5CU8A 5JWMA 3UVDA 5I7XA 2DVVA 5C89A 2YQDA 5DX4A 4NUEA 4HXNA 5F36A 3RCWA 4CUTA 5ENGA 4O7EA 4YY6A 5IGMA 4Q0OA 4CFLA 4QSSA 2I7KA 4A9HA 3O35A 5A82A 4O78A 4QYDA 4QB3A 2FSAA 3O36A 4QYLA 5C4QA 5A81A 4LZ2A 5DYCA 5A83A 5HFQA 3U5MA 4YABA 5BT3A 4QEWA 5CQ8A 4A9EA 5HFRA 4UYGA 4YY4A 1WUGA 5D3RA 4YC9A 3P1DA 3AADA 5FBXA 4DONA 5DYAA 2WP1A 4A9JA 4CUSA 3U5LA 5L8TA 4UYEA 4UIZA 5DYXA 5ENEA 3I3JA 5IG6A 2RNYA 4N4GA 5IGNA 2DKWA 4QEVA 5FG6A 4O74A 5LKUA 5HELA 3SVFA 5H1UA 3IU6A 5CQ7A 2L84A 4MEOA 4NXJA 4J0SA 4A9LA 4A9FA 5A5SA 3HMHA 4YADA 2RNXA 5HEMA 4CL9A 4C67A 3P1EA 4NQMA 4QR4A 5CP5A 5F61A 5FE6A 4YYHA 1JSPB 5FE1A 5EU1A 5CFWA 3HMEA 5AD3A 2YYNA 5EGUA 5D25A 4IR6A 4ZW1A 5HCLA 5C87A 5J0DA 4NR8A 4A9OA 5ETBA 2E3KA 4XY8A 4PY6A 3DWYA 5DFDA 4A9KA 5IGKA 4Y03A 5FE3A 4TZ2A 5E74A 5FH8A 5D0CA 2DATA 5EPSA 3G0LA 3U5KA 3NXBA 5I40A 3FKMX 4PS5A 5EWCA 2OSSA 5CZGA 3JVJA 5ENHA 3S91A 5I83A 5LUUA 3JVMA 5FB1A 5A7CA 5CPEA 4CUUA 5K29A 4BHWA 5CQ3A 2R0SA 5E9KA 5EWVA 5LJ2A 3LQHA 2DVSA 3MULA 2D9EA 4N4FA 5FG4A 5HQ6A 4MEPA 4TU6A 5LJ1A 5EA1A 4LZSA 3U5PA 5I86A 4QSUA 4LRGA 5D24A 5A5QA 2E7NA 3U5JA 2F6NA 4UIXA 3LJWA 4TT2A 4YBSA 5FH6A 4NS5A 5F62A 5E73A 4QC1A 4N4IA 5E0RA 5A5OA 2L85A 4QEUA 5E9MA 5LVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXL A;  5DW1 A;  3UV2 A;  5E9Y A;  4YH3 A;  1F68 A;  2G4A A;  2N9G A;  4XY9 A;  5TCM A;  4QSQ A;  5I7Y A;  5FE7 A;  5DKD A;  4BW1 A;  4YYD A;  5CY9 A;  5FE2 A;  4BW4 A;  5CUE A;  3MXF A;  5F1L A;  4O72 A;  5FG5 A;  4KV4 A;  3SVG A;  5FE0 A;  4O70 A;  5DKH A;  5I80 A;  4NUD A;  5EWD A;  5L98 A;  5TB6 A;  5LVR A;  5I29 A;  4YH4 A;  5BT5 A;  2YEK A;  5HEN A;  4MR4 A;  2DVQ A;  4O75 A;  5DKC A;  5HQ5 A;  4YYG A;  5EV9 A;  5HJC A;  4QNS A;  4NR5 A;  4UYH A;  2WP2 A;  5FE9 A;  4YYJ A;  3MB3 A;  4YBM A;  4WHW A;  5E7D A;  4QBM A;  4WIV A;  3LQI A;  5DFB A;  5IBN A;  2RS9 B;  4IR5 A;  3Q2F A;  3G0J A;  4CLB A;  5D3P A;  2R10 A;  5CQA A;  5L99 A;  5KHM A;  4IR3 A;  5DFC A;  4HBV A;  2YEM A;  5CS8 A;  5DW2 A;  3UVY A;  1E6I A;  5D3N A;  5HM0 A;  4YYM A;  4J3I A;  4QZS A;  3MB4 A;  5EVA A;  2NXB A;  5D7X A;  5A5N A;  3LQJ A;  2H60 A;  4TQN A;  5ENF A;  5D3L A;  4TYL A;  4HXP A;  4NRA A;  4QC3 A;  1JM4 B;  5F1H A;  5E9V A;  2OUO A;  5CQ5 A;  4ZC9 A;  4HBX A;  4BW2 A;  3TLP A;  5G4R A;  5IGL A;  5E3G A;  5L96 A;  5HRW A;  4NR4 A;  4KV1 A;  5CUA A;  3LXJ A;  4MR3 A;  5ENC A;  5CUC A;  4NUC A;  5F3A A;  3DAI A;  5DLZ A;  3AQA A;  3ONI A;  5I88 A;  4IOQ A;  4CUQ A;  4LC2 A;  5C85 A;  4NRC A;  5D3S A;  5EPR A;  5II2 A;  5I89 A;  4OUF A;  3P5O A;  5F25 A;  1ZS5 A;  5CQ4 A;  4QR3 A;  4TU4 A;  5BT4 A;  3UV5 A;  4WHU A;  4KCX A;  4O77 A;  4UYF B;  5DLX A;  3QZV A;  3S92 A;  5FFV A;  5A5P A;  4YK0 A;  3GG3 A;  4TT6 A;  4NYV A;  4O7B A;  4CUP A;  5FFW A;  2R0V A;  4BJX A;  4N3W A;  5H1T A;  4MEN A;  2F6J A;  1X0J A;  2D82 A;  4HXR A;  4UYF A;  4YYN A;  3P1C A;  4O71 A;  4Z1Q A;  5CUD A;  4MEQ A;  3IU5 A;  2OO1 A;  1WUM A;  2YDW A;  4QSX A;  4HXS A;  4XUB A;  5G4S A;  2YEL A;  1N72 A;  4OGJ A;  5HRX A;  3O33 A;  4YAT A;  4O7F A;  5L97 A;  4UIU A;  4UIT A;  5E9L A;  2L5E A;  3UW9 A;  3HMF A;  4NQN A;  5EWW A;  5EM3 A;  3SVH A;  5KTX A;  5AD2 A;  2LSP B;  5DYU A;  4Z93 A;  3U5N A;  5C7N A;  4QR5 A;  5F60 A;  4TZ8 A;  4HBY A;  5D3H A;  5HRV A;  4OGI A;  3UV4 A;  5FE5 A;  5KU3 A;  5ETD A;  4LZR A;  4PKL A;  4QST A;  4O7A A;  4QSR A;  4HXK A;  4TS8 A;  5CUB A;  4LYS A;  4TTE A;  5F2P A;  4NR7 A;  2RFJ A;  3UVX A;  4NR6 A;  4CUR A;  5JI8 A;  3Q2E A;  3D7C A;  5I1Q A;  5E3D A;  3JVL A;  4C66 A;  1EQF A;  4LYI A;  4F3I A;  4QSP A;  5KTW A;  4UIV A;  4YAX A;  5HQ7 A;  5AMF A;  4J1P A;  4PTB A;  3QZS A;  4QSV A;  4BW3 A;  5KTU A;  4J0R A;  4NYW A;  4Z6I A;  5FH7 A;  4TT4 A;  4PCE A;  5A85 A;  2YW5 A;  5FDZ A;  4YYK A;  3U5O A;  4MR6 A;  4YBT A;  2E7O A;  4HBW A;  4IOO A;  4QUT A;  5EWH A;  5ACY A;  4X2I A;  4FLP A;  4ZQL A;  2RO1 A;  5DY7 A;  5ENI A;  5ENJ A;  5II1 A;  5LKT A;  4UIY A;  4N4H A;  2KTB B;  5F63 A;  4HXO A;  4A9N A;  4O7C A;  5H1V A;  3ZYU A;  5CRM A;  5HLS A;  4QUU A;  4YYI A;  3O37 A;  4A9M A;  5D3J A;  4XUA A;  4LDF A;  5CQ6 A;  3K2J A;  3P1F A;  4NYX A;  5LKX A;  4HXM A;  4RVR A;  4E96 A;  2RI7 A;  5E9I A;  5CUG A;  4Z1S A;  3UVW A;  5CQT A;  5CRZ A;  5D26 A;  2MJV B;  3JVK A;  4Z6H A;  5EQ1 A;  5CGP A;  4IR4 A;  2DVR A;  3QZT A;  5D3T A;  5L8U A;  4QY4 A;  5FFY A;  3MUK A;  5EIS A;  4LYW A;  5H85 A;  4PCI A;  2R0Y A;  3MQM A;  5FB0 A;  5A5R A;  5EPB A;  4QSW A;  5COI A;  2RNW A;  5LJ0 A;  2DWW A;  2GRC A;  4XYA A;  5EK9 A;  5CTL A;  4A9I A;  4ALH A;  5C8G A;  4UYD A;  4UIW A;  4CFK A;  5FE4 A;  4LR6 A;  2I8N A;  4NRB A;  5LKZ A;  5EIC A;  5F5Z A;  4ALG A;  5IID A;  4Q0N A;  5EP7 A;  4O76 A;  5EI4 A;  4AKN A;  3O34 A;  5AME A;  4GPJ A;  5KO4 A;  5ENB A;  5DBM A;  5FE8 A;  4NR9 A;  4IOR A;  4MR5 A;  5CU8 A;  5JWM A;  3UVD A;  5I7X A;  2DVV A;  5C89 A;  2YQD A;  5DX4 A;  4NUE A;  4HXN A;  5F36 A;  3RCW A;  4CUT A;  5ENG A;  4O7E A;  4YY6 A;  5IGM A;  4Q0O A;  4CFL A;  4QSS A;  2I7K A;  4A9H A;  3O35 A;  5A82 A;  4O78 A;  4QYD A;  4QB3 A;  2FSA A;  3O36 A;  4QYL A;  5C4Q A;  5A81 A;  4LZ2 A;  5DYC A;  5A83 A;  5HFQ A;  3U5M A;  4YAB A;  5BT3 A;  4QEW A;  5CQ8 A;  4A9E A;  5HFR A;  4UYG A;  4YY4 A;  1WUG A;  5D3R A;  4YC9 A;  3P1D A;  3AAD A;  5FBX A;  4DON A;  5DYA A;  2WP1 A;  4A9J A;  4CUS A;  3U5L A;  5L8T A;  4UYE A;  4UIZ A;  5DYX A;  5ENE A;  3I3J A;  5IG6 A;  2RNY A;  4N4G A;  5IGN A;  2DKW A;  4QEV A;  5FG6 A;  4O74 A;  5LKU A;  5HEL A;  3SVF A;  5H1U A;  3IU6 A;  5CQ7 A;  2L84 A;  4MEO A;  4NXJ A;  4J0S A;  4A9L A;  4A9F A;  5A5S A;  3HMH A;  4YAD A;  2RNX A;  5HEM A;  4CL9 A;  4C67 A;  3P1E A;  4NQM A;  4QR4 A;  5CP5 A;  5F61 A;  5FE6 A;  4YYH A;  1JSP B;  5FE1 A;  5EU1 A;  5CFW A;  3HME A;  5AD3 A;  2YYN A;  5EGU A;  5D25 A;  4IR6 A;  4ZW1 A;  5HCL A;  5C87 A;  5J0D A;  4NR8 A;  4A9O A;  5ETB A;  2E3K A;  4XY8 A;  4PY6 A;  3DWY A;  5DFD A;  4A9K A;  5IGK A;  4Y03 A;  5FE3 A;  4TZ2 A;  5E74 A;  5FH8 A;  5D0C A;  2DAT A;  5EPS A;  3G0L A;  3U5K A;  3NXB A;  5I40 A;  3FKM X;  4PS5 A;  5EWC A;  2OSS A;  5CZG A;  3JVJ A;  5ENH A;  3S91 A;  5I83 A;  5LUU A;  3JVM A;  5FB1 A;  5A7C A;  5CPE A;  4CUU A;  5K29 A;  4BHW A;  5CQ3 A;  2R0S A;  5E9K A;  5EWV A;  5LJ2 A;  3LQH A;  2DVS A;  3MUL A;  2D9E A;  4N4F A;  5FG4 A;  5HQ6 A;  4MEP A;  4TU6 A;  5LJ1 A;  5EA1 A;  4LZS A;  3U5P A;  5I86 A;  4QSU A;  4LRG A;  5D24 A;  5A5Q A;  2E7N A;  3U5J A;  2F6N A;  4UIX A;  3LJW A;  4TT2 A;  4YBS A;  5FH6 A;  4NS5 A;  5F62 A;  5E73 A;  4QC1 A;  4N4I A;  5E0R A;  5A5O A;  2L85 A;  4QEU A;  5E9M A;  5LVQ A; 
#chains in the Genus database with same CATH topology
 4HXL A;  5DW1 A;  3UV2 A;  5E9Y A;  4YH3 A;  1F68 A;  2G4A A;  2N9G A;  4XY9 A;  5TCM A;  4QSQ A;  5I7Y A;  5FE7 A;  5DKD A;  4BW1 A;  4YYD A;  5CY9 A;  5FE2 A;  4BW4 A;  5CUE A;  3MXF A;  5F1L A;  4O72 A;  5FG5 A;  4KV4 A;  3SVG A;  5FE0 A;  4O70 A;  5DKH A;  5I80 A;  4NUD A;  5EWD A;  5L98 A;  4AKH A;  5TB6 A;  5LVR A;  5I29 A;  4YH4 A;  5BT5 A;  2YEK A;  5HEN A;  4MR4 A;  2DVQ A;  4O75 A;  5DKC A;  5HQ5 A;  4YYG A;  5EV9 A;  5HJC A;  4QNS A;  4NR5 A;  4UYH A;  2WP2 A;  5FE9 A;  4YYJ A;  3MB3 A;  4YBM A;  4WHW A;  5E7D A;  4QBM A;  4WIV A;  3LQI A;  5DFB A;  5IBN A;  2RS9 B;  4IR5 A;  3Q2F A;  3G0J A;  4CLB A;  5D3P A;  2R10 A;  5CQA A;  5L99 A;  5KHM A;  4IR3 A;  5DFC A;  4HBV A;  2YEM A;  4AI6 A;  5CS8 A;  5DW2 A;  3UVY A;  1E6I A;  5D3N A;  5HM0 A;  4YYM A;  4J3I A;  4QZS A;  3MB4 A;  5EVA A;  2NXB A;  5D7X A;  5A5N A;  3LQJ A;  2H60 A;  4TQN A;  5ENF A;  3D1B A;  5D3L A;  4TYL A;  4HXP A;  4NRA A;  4QC3 A;  1JM4 B;  5F1H A;  5E9V A;  2OUO A;  5CQ5 A;  4ZC9 A;  4HBX A;  4BW2 A;  3TLP A;  5G4R A;  5IGL A;  5E3G A;  5L96 A;  5HRW A;  4NR4 A;  4KV1 A;  5CUA A;  3LXJ A;  4MR3 A;  5ENC A;  5CUC A;  4NUC A;  5F3A A;  3DAI A;  5DLZ A;  3AQA A;  3ONI A;  5I88 A;  4IOQ A;  4CUQ A;  4LC2 A;  5C85 A;  4NRC A;  5D3S A;  5EPR A;  5II2 A;  5I89 A;  4OUF A;  3P5O A;  5F25 A;  1ZS5 A;  5CQ4 A;  4QR3 A;  4TU4 A;  5BT4 A;  3UV5 A;  4WHU A;  4KCX A;  4O77 A;  4UYF B;  5DLX A;  3QZV A;  3S92 A;  5FFV A;  5A5P A;  4YK0 A;  3GG3 A;  4TT6 A;  4NYV A;  4O7B A;  4CUP A;  5FFW A;  2R0V A;  3ERR A;  4BJX A;  4N3W A;  5H1T A;  4MEN A;  2F6J A;  1X0J A;  2D82 A;  4HXR A;  4UYF A;  4YYN A;  3P1C A;  4O71 A;  4Z1Q A;  5CUD A;  4MEQ A;  3IU5 A;  2OO1 A;  1WUM A;  2YDW A;  4QSX A;  4HXS A;  4XUB A;  5G4S A;  2YEL A;  1N72 A;  4OGJ A;  5HRX A;  3O33 A;  4YAT A;  4O7F A;  5L97 A;  4UIU A;  4UIT A;  5E9L A;  2L5E A;  3UW9 A;  3HMF A;  4NQN A;  5EWW A;  5EM3 A;  3SVH A;  5KTX A;  3VKG A;  5AD2 A;  2LSP B;  5DYU A;  4Z93 A;  3U5N A;  5C7N A;  4QR5 A;  5F60 A;  4TZ8 A;  4HBY A;  5D3H A;  5HRV A;  4OGI A;  3UV4 A;  5FE5 A;  5KU3 A;  5ETD A;  4LZR A;  4PKL A;  4QST A;  4O7A A;  4QSR A;  4HXK A;  4TS8 A;  5CUB A;  4LYS A;  4TTE A;  5F2P A;  4NR7 A;  2RFJ A;  3UVX A;  4NR6 A;  4CUR A;  5JI8 A;  3Q2E A;  3D7C A;  5I1Q A;  5E3D A;  3JVL A;  4C66 A;  1EQF A;  4LYI A;  4F3I A;  4QSP A;  5KTW A;  4UIV A;  4YAX A;  5HQ7 A;  5AMF A;  4J1P A;  4PTB A;  3QZS A;  4QSV A;  4BW3 A;  5KTU A;  4J0R A;  4NYW A;  4Z6I A;  5FH7 A;  4TT4 A;  4PCE A;  5A85 A;  2YW5 A;  5FDZ A;  4YYK A;  3U5O A;  4MR6 A;  4YBT A;  2E7O A;  4HBW A;  4IOO A;  4QUT A;  5EWH A;  5ACY A;  4X2I A;  4FLP A;  4ZQL A;  2RO1 A;  5DY7 A;  5ENI A;  5ENJ A;  5II1 A;  5LKT A;  4UIY A;  4N4H A;  2KTB B;  5F63 A;  4HXO A;  4A9N A;  4O7C A;  5H1V A;  3ZYU A;  5CRM A;  5HLS A;  4QUU A;  4YYI A;  3O37 A;  4AKI A;  4A9M A;  5D3J A;  4XUA A;  4LDF A;  5CQ6 A;  3K2J A;  3P1F A;  4NYX A;  5LKX A;  4HXM A;  4RVR A;  4E96 A;  2RI7 A;  5E9I A;  5CUG A;  4Z1S A;  3UVW A;  5CQT A;  5CRZ A;  5D26 A;  2MJV B;  3JVK A;  4Z6H A;  5EQ1 A;  5CGP A;  4IR4 A;  2DVR A;  3QZT A;  5D3T A;  5L8U A;  4QY4 A;  5FFY A;  3MUK A;  5EIS A;  4LYW A;  5H85 A;  4PCI A;  1PUO A;  2R0Y A;  3MQM A;  5FB0 A;  5A5R A;  2EJN A;  5EPB A;  1ZKR A;  4QSW A;  5COI A;  2RNW A;  5LJ0 A;  2DWW A;  2GRC A;  4XYA A;  5EK9 A;  5CTL A;  4A9I A;  4ALH A;  5C8G A;  4UYD A;  4UIW A;  4CFK A;  5FE4 A;  4LR6 A;  2I8N A;  4NRB A;  5LKZ A;  5EIC A;  5F5Z A;  4ALG A;  5IID A;  4Q0N A;  5EP7 A;  4O76 A;  5EI4 A;  4AKN A;  3O34 A;  5AME A;  4GPJ A;  5KO4 A;  5ENB A;  5DBM A;  5FE8 A;  4NR9 A;  4IOR A;  4MR5 A;  5CU8 A;  5JWM A;  3UVD A;  5I7X A;  2DVV A;  5C89 A;  2YQD A;  5DX4 A;  4NUE A;  4HXN A;  5F36 A;  3RCW A;  4CUT A;  5ENG A;  4O7E A;  4YY6 A;  5IGM A;  4Q0O A;  4CFL A;  4QSS A;  2I7K A;  4A9H A;  3O35 A;  5A82 A;  4O78 A;  4QYD A;  4QB3 A;  2FSA A;  3O36 A;  4QYL A;  5C4Q A;  5A81 A;  4AKG A;  4LZ2 A;  5DYC A;  5A83 A;  5HFQ A;  3U5M A;  4YAB A;  5BT3 A;  4QEW A;  5CQ8 A;  4A9E A;  5HFR A;  4UYG A;  4YY4 A;  1WUG A;  5D3R A;  4YC9 A;  3P1D A;  3AAD A;  5FBX A;  4DON A;  5DYA A;  2WP1 A;  4A9J A;  4CUS A;  3U5L A;  5L8T A;  4UYE A;  4UIZ A;  5DYX A;  5ENE A;  3I3J A;  5IG6 A;  2RNY A;  4N4G A;  5IGN A;  2DKW A;  4QEV A;  5FG6 A;  4O74 A;  5LKU A;  5HEL A;  3SVF A;  5H1U A;  3IU6 A;  5CQ7 A;  2L84 A;  4MEO A;  4NXJ A;  4J0S A;  4A9L A;  4A9F A;  5A5S A;  3HMH A;  4YAD A;  2RNX A;  5HEM A;  4CL9 A;  4C67 A;  3P1E A;  4NQM A;  4QR4 A;  5CP5 A;  5F61 A;  5FE6 A;  4YYH A;  1JSP B;  5FE1 A;  5EU1 A;  5CFW A;  3HME A;  5AD3 A;  2YYN A;  5EGU A;  5D25 A;  4IR6 A;  4ZW1 A;  5HCL A;  5C87 A;  5J0D A;  4NR8 A;  4A9O A;  5ETB A;  2E3K A;  4XY8 A;  4PY6 A;  3DWY A;  5DFD A;  4A9K A;  5IGK A;  4Y03 A;  5FE3 A;  4TZ2 A;  5E74 A;  5FH8 A;  5D0C A;  2DAT A;  5EPS A;  3G0L A;  3U5K A;  3NXB A;  5I40 A;  3FKM X;  4PS5 A;  5EWC A;  2OSS A;  5CZG A;  3JVJ A;  5ENH A;  3S91 A;  5I83 A;  5LUU A;  3JVM A;  5FB1 A;  5A7C A;  5CPE A;  4CUU A;  5K29 A;  4BHW A;  5CQ3 A;  2R0S A;  5E9K A;  3D1D A;  5EWV A;  5LJ2 A;  3LQH A;  2DVS A;  3MUL A;  2D9E A;  4N4F A;  5FG4 A;  5HQ6 A;  4MEP A;  4TU6 A;  5LJ1 A;  5EA1 A;  4LZS A;  3U5P A;  5I86 A;  4QSU A;  4LRG A;  5D24 A;  5A5Q A;  2E7N A;  3U5J A;  2F6N A;  4UIX A;  3LJW A;  4TT2 A;  4YBS A;  5FH6 A;  4NS5 A;  5F62 A;  5E73 A;  3VKH A;  4QC1 A;  4N4I A;  5E0R A;  5A5O A;  2L85 A;  4QEU A;  5E9M A;  5LVQ A; 
#chains in the Genus database with same CATH homology
 4HXL A;  5DW1 A;  3UV2 A;  5E9Y A;  4YH3 A;  1F68 A;  2G4A A;  2N9G A;  4XY9 A;  5TCM A;  4QSQ A;  5I7Y A;  5FE7 A;  5DKD A;  4BW1 A;  4YYD A;  5CY9 A;  5FE2 A;  4BW4 A;  5CUE A;  3MXF A;  5F1L A;  4O72 A;  5FG5 A;  4KV4 A;  3SVG A;  5FE0 A;  4O70 A;  5DKH A;  5I80 A;  4NUD A;  5EWD A;  5L98 A;  5TB6 A;  5LVR A;  5I29 A;  4YH4 A;  5BT5 A;  2YEK A;  5HEN A;  4MR4 A;  2DVQ A;  4O75 A;  5DKC A;  5HQ5 A;  4YYG A;  5EV9 A;  5HJC A;  4QNS A;  4NR5 A;  4UYH A;  2WP2 A;  5FE9 A;  4YYJ A;  3MB3 A;  4YBM A;  4WHW A;  5E7D A;  4QBM A;  4WIV A;  3LQI A;  5DFB A;  5IBN A;  2RS9 B;  4IR5 A;  3Q2F A;  3G0J A;  4CLB A;  5D3P A;  2R10 A;  5CQA A;  5L99 A;  5KHM A;  4IR3 A;  5DFC A;  4HBV A;  2YEM A;  5CS8 A;  5DW2 A;  3UVY A;  1E6I A;  5D3N A;  5HM0 A;  4YYM A;  4J3I A;  4QZS A;  3MB4 A;  5EVA A;  2NXB A;  5D7X A;  5A5N A;  3LQJ A;  2H60 A;  4TQN A;  5ENF A;  5D3L A;  4TYL A;  4HXP A;  4NRA A;  4QC3 A;  1JM4 B;  5F1H A;  5E9V A;  2OUO A;  5CQ5 A;  4ZC9 A;  4HBX A;  4BW2 A;  3TLP A;  5G4R A;  5IGL A;  5E3G A;  5L96 A;  5HRW A;  4NR4 A;  4KV1 A;  5CUA A;  3LXJ A;  4MR3 A;  5ENC A;  5CUC A;  4NUC A;  5F3A A;  3DAI A;  5DLZ A;  3AQA A;  3ONI A;  5I88 A;  4IOQ A;  4CUQ A;  4LC2 A;  5C85 A;  4NRC A;  5D3S A;  5EPR A;  5II2 A;  5I89 A;  4OUF A;  3P5O A;  5F25 A;  1ZS5 A;  5CQ4 A;  4QR3 A;  4TU4 A;  5BT4 A;  3UV5 A;  4WHU A;  4KCX A;  4O77 A;  4UYF B;  5DLX A;  3QZV A;  3S92 A;  5FFV A;  5A5P A;  4YK0 A;  3GG3 A;  4TT6 A;  4NYV A;  4O7B A;  4CUP A;  5FFW A;  2R0V A;  4BJX A;  4N3W A;  5H1T A;  4MEN A;  2F6J A;  1X0J A;  2D82 A;  4HXR A;  4UYF A;  4YYN A;  3P1C A;  4O71 A;  4Z1Q A;  5CUD A;  4MEQ A;  3IU5 A;  2OO1 A;  1WUM A;  2YDW A;  4QSX A;  4HXS A;  4XUB A;  5G4S A;  2YEL A;  1N72 A;  4OGJ A;  5HRX A;  3O33 A;  4YAT A;  4O7F A;  5L97 A;  4UIU A;  4UIT A;  5E9L A;  2L5E A;  3UW9 A;  3HMF A;  4NQN A;  5EWW A;  5EM3 A;  3SVH A;  5KTX A;  5AD2 A;  2LSP B;  5DYU A;  4Z93 A;  3U5N A;  5C7N A;  4QR5 A;  5F60 A;  4TZ8 A;  4HBY A;  5D3H A;  5HRV A;  4OGI A;  3UV4 A;  5FE5 A;  5KU3 A;  5ETD A;  4LZR A;  4PKL A;  4QST A;  4O7A A;  4QSR A;  4HXK A;  4TS8 A;  5CUB A;  4LYS A;  4TTE A;  5F2P A;  4NR7 A;  2RFJ A;  3UVX A;  4NR6 A;  4CUR A;  5JI8 A;  3Q2E A;  3D7C A;  5I1Q A;  5E3D A;  3JVL A;  4C66 A;  1EQF A;  4LYI A;  4F3I A;  4QSP A;  5KTW A;  4UIV A;  4YAX A;  5HQ7 A;  5AMF A;  4J1P A;  4PTB A;  3QZS A;  4QSV A;  4BW3 A;  5KTU A;  4J0R A;  4NYW A;  4Z6I A;  5FH7 A;  4TT4 A;  4PCE A;  5A85 A;  2YW5 A;  5FDZ A;  4YYK A;  3U5O A;  4MR6 A;  4YBT A;  2E7O A;  4HBW A;  4IOO A;  4QUT A;  5EWH A;  5ACY A;  4X2I A;  4FLP A;  4ZQL A;  2RO1 A;  5DY7 A;  5ENI A;  5ENJ A;  5II1 A;  5LKT A;  4UIY A;  4N4H A;  2KTB B;  5F63 A;  4HXO A;  4A9N A;  4O7C A;  5H1V A;  3ZYU A;  5CRM A;  5HLS A;  4QUU A;  4YYI A;  3O37 A;  4A9M A;  5D3J A;  4XUA A;  4LDF A;  5CQ6 A;  3K2J A;  3P1F A;  4NYX A;  5LKX A;  4HXM A;  4RVR A;  4E96 A;  2RI7 A;  5E9I A;  5CUG A;  4Z1S A;  3UVW A;  5CQT A;  5CRZ A;  5D26 A;  2MJV B;  3JVK A;  4Z6H A;  5EQ1 A;  5CGP A;  4IR4 A;  2DVR A;  3QZT A;  5D3T A;  5L8U A;  4QY4 A;  5FFY A;  3MUK A;  5EIS A;  4LYW A;  5H85 A;  4PCI A;  2R0Y A;  3MQM A;  5FB0 A;  5A5R A;  5EPB A;  4QSW A;  5COI A;  2RNW A;  5LJ0 A;  2DWW A;  2GRC A;  4XYA A;  5EK9 A;  5CTL A;  4A9I A;  4ALH A;  5C8G A;  4UYD A;  4UIW A;  4CFK A;  5FE4 A;  4LR6 A;  2I8N A;  4NRB A;  5LKZ A;  5EIC A;  5F5Z A;  4ALG A;  5IID A;  4Q0N A;  5EP7 A;  4O76 A;  5EI4 A;  4AKN A;  3O34 A;  5AME A;  4GPJ A;  5KO4 A;  5ENB A;  5DBM A;  5FE8 A;  4NR9 A;  4IOR A;  4MR5 A;  5CU8 A;  5JWM A;  3UVD A;  5I7X A;  2DVV A;  5C89 A;  2YQD A;  5DX4 A;  4NUE A;  4HXN A;  5F36 A;  3RCW A;  4CUT A;  5ENG A;  4O7E A;  4YY6 A;  5IGM A;  4Q0O A;  4CFL A;  4QSS A;  2I7K A;  4A9H A;  3O35 A;  5A82 A;  4O78 A;  4QYD A;  4QB3 A;  2FSA A;  3O36 A;  4QYL A;  5C4Q A;  5A81 A;  4LZ2 A;  5DYC A;  5A83 A;  5HFQ A;  3U5M A;  4YAB A;  5BT3 A;  4QEW A;  5CQ8 A;  4A9E A;  5HFR A;  4UYG A;  4YY4 A;  1WUG A;  5D3R A;  4YC9 A;  3P1D A;  3AAD A;  5FBX A;  4DON A;  5DYA A;  2WP1 A;  4A9J A;  4CUS A;  3U5L A;  5L8T A;  4UYE A;  4UIZ A;  5DYX A;  5ENE A;  3I3J A;  5IG6 A;  2RNY A;  4N4G A;  5IGN A;  2DKW A;  4QEV A;  5FG6 A;  4O74 A;  5LKU A;  5HEL A;  3SVF A;  5H1U A;  3IU6 A;  5CQ7 A;  2L84 A;  4MEO A;  4NXJ A;  4J0S A;  4A9L A;  4A9F A;  5A5S A;  3HMH A;  4YAD A;  2RNX A;  5HEM A;  4CL9 A;  4C67 A;  3P1E A;  4NQM A;  4QR4 A;  5CP5 A;  5F61 A;  5FE6 A;  4YYH A;  1JSP B;  5FE1 A;  5EU1 A;  5CFW A;  3HME A;  5AD3 A;  2YYN A;  5EGU A;  5D25 A;  4IR6 A;  4ZW1 A;  5HCL A;  5C87 A;  5J0D A;  4NR8 A;  4A9O A;  5ETB A;  2E3K A;  4XY8 A;  4PY6 A;  3DWY A;  5DFD A;  4A9K A;  5IGK A;  4Y03 A;  5FE3 A;  4TZ2 A;  5E74 A;  5FH8 A;  5D0C A;  2DAT A;  5EPS A;  3G0L A;  3U5K A;  3NXB A;  5I40 A;  3FKM X;  4PS5 A;  5EWC A;  2OSS A;  5CZG A;  3JVJ A;  5ENH A;  3S91 A;  5I83 A;  5LUU A;  3JVM A;  5FB1 A;  5A7C A;  5CPE A;  4CUU A;  5K29 A;  4BHW A;  5CQ3 A;  2R0S A;  5E9K A;  5EWV A;  5LJ2 A;  3LQH A;  2DVS A;  3MUL A;  2D9E A;  4N4F A;  5FG4 A;  5HQ6 A;  4MEP A;  4TU6 A;  5LJ1 A;  5EA1 A;  4LZS A;  3U5P A;  5I86 A;  4QSU A;  4LRG A;  5D24 A;  5A5Q A;  2E7N A;  3U5J A;  2F6N A;  4UIX A;  3LJW A;  4TT2 A;  4YBS A;  5FH6 A;  4NS5 A;  5F62 A;  5E73 A;  4QC1 A;  4N4I A;  5E0R A;  5A5O A;  2L85 A;  4QEU A;  5E9M A;  5LVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...