4QNSA

Crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
GHKEVQLKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQTLIWPKYEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase GCN5, putative
publication title Crystal structure of bromodomain from Plasmodium faciparum GCN5, PF3D7_0823300
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 40
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qnsA00
4TS8A 2WP2A 2DVRA 4PCIA 5A5NA 5A5RA 5I83A 2G4AA 5CQ8A 4NR9A 5F63A 5DLZA 4QSVA 5E3GA 5CY9A 5E7DA 4KV1A 5EP7A 4UITA 5FE9A 5JI8A 5CPEA 5HRWA 4RVRA 5A5OA 5C89A 4QY4A 5HLSA 5FDZA 5FG4A 5CQ7A 4PY6A 2L85A 4N3WA 4OUFA 5EWDA 4CLBA 5LKTA 4YH3A 5EWWA 5IIDA 4NRAA 4MENA 5EPRA 5EI4A 3DWYA 5F1LA 3O36A 4J0SA 5I89A 3MB4A 5CGPA 2RFJA 5TB6A 5I29A 5ENFA 3MXFA 4QB3A 4YYDA 3LXJA 4UIUA 5KHMA 3DAIA 1WUGA 4QEWA 2I7KA 4YC9A 4UYHA 5EQ1A 3UV5A 5CRZA 1N72A 5FB0A 5CQ4A 5COIA 4YBTA 5CUEA 5IGKA 4PTBA 4QC1A 5FE2A 4E96A 5HENA 4KCXA 4XY8A 4HBYA 2YDWA 5LJ0A 5CZGA 4YYGA 4LZSA 4LZ2A 5II1A 5F5ZA 5A81A 4N4FA 4OGJA 2DWWA 5LUUA 4ALHA 5EPBA 4YY4A 5CU8A 4CURA 4IORA 5CQAA 4FLPA 4UIZA 5FBXA 4UYEA 5HCLA 5KTWA 3LQJA 2F6JA 4MEOA 3QZSA 5D3NA 5HQ5A 3O35A 5G4SA 4IR3A 4O78A 4YK0A 3LQIA 4HXNA 3S92A 2RS9B 4YY6A 5BT3A 5H1TA 5F62A 5FE7A 4HBWA 3O37A 2OO1A 4NUDA 5I88A 2F6NA 3AQAA 4QNSA 5ETBA 5L99A 4O7EA 5HRVA 4Z93A 5ENGA 4MR4A 2YYNA 4Z6IA 5DBMA 4O74A 2LSPB 3AADA 4NR4A 3G0LA 4A9MA 4QSQA 4BW4A 4XUBA 4NR8A 5A5PA 5CQ5A 5HJCA 4YYJA 2YQDA 4XY9A 2R0YA 4HXOA 3K2JA 5FH6A 2RNYA 2L84A 4UYFA 5DW1A 5EICA 5L8UA 2E3KA 4LYIA 4YYMA 5LJ2A 3UV4A 4QYLA 4NQMA 5FE5A 4ZW1A 5ENHA 5LKUA 5CQ6A 3QZVA 4UYDA 3D7CA 4LYWA 4XUAA 5HFQA 4TU6A 5D0CA 4QSWA 4BHWA 5AD3A 5CUDA 3HMHA 2L5EA 4YYKA 5C8GA 4N4GA 5F25A 5H85A 5HQ6A 4TYLA 5F60A 5D3LA 3NXBA 4TZ8A 4TU4A 4QR4A 5FFVA 5CUCA 5EVAA 3U5LA 5D26A 5EWHA 3JVMA 1ZS5A 3UW9A 3MB3A 3JVJA 5H1UA 5CP5A 4NYVA 5CQTA 2MJVB 4TT4A 5A7CA 4UYGA 2FSAA 5EISA 5IGNA 5EPSA 4NRBA 3Q2EA 5D3JA 3MULA 5FE6A 5F2PA 4BJXA 4YAXA 1E6IA 5D24A 4A9KA 4AKNA 5BT5A 5II2A 4GPJA 2OUOA 4NR5A 5EM3A 4J3IA 4NR6A 4CUQA 4YYHA 5EGUA 4MR3A 4CUUA 5K29A 4NXJA 3P1DA 4J1PA 4ALGA 5I7XA 3P1CA 5I80A 5FG6A 2OSSA 4O7BA 4ZQLA 4N4IA 4UIYA 5ACYA 5E74A 4UYFB 4Z1QA 4O7AA 5D3HA 5DLXA 5DYUA 4QC3A 5DKCA 3P1FA 4QYDA 4IOQA 4YH4A 3SVGA 5EWVA 4N4HA 5E9IA 5CS8A 3LJWA 1JSPB 4TT6A 4LZRA 5ENEA 5HM0A 2KTBB 5J0DA 4LDFA 3IU5A 4PCEA 4QSUA 3Q2FA 5G4RA 4Z1SA 5HELA 4HXPA 4CL9A 4HXRA 4HXKA 5I1QA 2N9GA 4A9FA 4QSSA 5DFCA 3UV2A 3U5NA 5D3SA 4CFLA 5C4QA 5I7YA 4Y03A 4A9OA 5HFRA 4ZC9A 5DW2A 3S91A 4MEQA 2H60A 4NYXA 5F1HA 2RI7A 4PS5A 4A9HA 4A9JA 3MUKA 5IGMA 5EV9A 5DY7A 5FE3A 5L97A 5C7NA 5LKXA 3RCWA 4O72A 4WIVA 5KU3A 2DVVA 3HMEA 4PKLA 4IR5A 4HXMA 4MEPA 5E9MA 5HEMA 4C66A 3I3JA 5L96A 5FFWA 5HQ7A 5FG5A 4BW2A 2GRCA 2DVQA 4TT2A 3SVFA 5EU1A 5L98A 4WHUA 5AMEA 4Z6HA 4YYIA 5FE4A 5TCMA 5E9YA 1X0JA 4UIXA 5C85A 4IOOA 5F3AA 4YBMA 4A9LA 3U5KA 5ENBA 5D25A 2I8NA 2R10A 5FE1A 2YELA 3U5MA 5I86A 2DKWA 3TLPA 5C87A 1WUMA 4IR4A 3U5JA 4YYNA 5LKZA 5E9KA 5LVRA 4LR6A 5CFWA 5AMFA 4O7CA 5CTLA 5A83A 5A5SA 4HXLA 4CUTA 3GG3A 3P5OA 5FE0A 4QR3A 5A82A 4QSXA 3LQHA 5DKDA 5FFYA 4O75A 4YADA 4YABA 4YBSA 4O70A 4LRGA 4O77A 4QZSA 2E7NA 5ETDA 5D3PA 5D3RA 1JM4B 4LC2A 2RO1A 4QSTA 5A85A 5IGLA 2RNWA 4UIVA 5CRMA 5E3DA 3UVXA 4WHWA 5FH8A 4NS5A 5A5QA 5DYCA 5DFDA 3IU6A 4DONA 5D7XA 3JVLA 3G0JA 4C67A 5D3TA 5EK9A 4LYSA 4QR5A 5BT4A 4YATA 4CFKA 4X2IA 5EWCA 5KO4A 3HMFA 5FH7A 4NRCA 4A9EA 4O76A 3ONIA 4HBVA 2NXBA 2DATA 4MR5A 5E9LA 5KTUA 4IR6A 5DX4A 5CUGA 4QEUA 4QBMA 5ENJA 5L8TA 4HBXA 5E73A 4HXSA 5DKHA 4O7FA 4QUUA 2YEMA 4NR7A 5DFBA 3ZYUA 1EQFA 5E0RA 3P1EA 4J0RA 3QZTA 5KTXA 4CUPA 5F61A 4A9IA 2D9EA 4TTEA 4NUEA 2YEKA 5IG6A 2D82A 4QUTA 4TZ2A 3O33A 4QEVA 5EA1A 5HRXA 5I40A 3SVHA 2DVSA 4BW1A 4QSPA 4O71A 2R0SA 4UIWA 4NYWA 3U5OA 5CUBA 4F3IA 5CUAA 4MR6A 3JVKA 5F36A 3U5PA 2R0VA 3FKMX 4Q0OA 4A9NA 5IBNA 4OGIA 5LVQA 2RNXA 2E7OA 3O34A 4NUCA 4QSRA 2YW5A 4CUSA 4NQNA 5DYXA 3UVYA 5ENIA 1F68A 2WP1A 5E9VA 5FE8A 5JWMA 4KV4A 5H1VA 5AD2A 3UVDA 3MQMA 4Q0NA 3UVWA 4BW3A 4XYAA 5LJ1A 4TQNA 5ENCA 5CQ3A 5DYAA 5FB1A
chains in the Genus database with same CATH superfamily
4TS8A 2WP2A 3D1BA 2DVRA 4PCIA 5A5NA 5A5RA 5I83A 2G4AA 5CQ8A 4NR9A 5F63A 5DLZA 4QSVA 5E3GA 5CY9A 1PUOA 5E7DA 4KV1A 5EP7A 4UITA 5FE9A 5JI8A 3VKGA 5CPEA 5HRWA 4RVRA 5A5OA 5C89A 4QY4A 5HLSA 5FDZA 5FG4A 5CQ7A 4PY6A 2L85A 4N3WA 4OUFA 5EWDA 4CLBA 5LKTA 4YH3A 5EWWA 5IIDA 4NRAA 4MENA 5EPRA 5EI4A 3DWYA 5F1LA 3O36A 4J0SA 5I89A 3MB4A 5CGPA 2RFJA 5TB6A 5I29A 5ENFA 3MXFA 4QB3A 4YYDA 3LXJA 4UIUA 5KHMA 3DAIA 1WUGA 4QEWA 2I7KA 4YC9A 3D1DA 4UYHA 5EQ1A 3UV5A 5CRZA 1N72A 5FB0A 5CQ4A 5COIA 4YBTA 5CUEA 5IGKA 4PTBA 4QC1A 5FE2A 4E96A 5HENA 4KCXA 4XY8A 4HBYA 2YDWA 5LJ0A 5CZGA 4YYGA 4LZSA 4LZ2A 5II1A 5F5ZA 5A81A 4N4FA 4OGJA 2DWWA 5LUUA 4ALHA 5EPBA 4YY4A 5CU8A 4CURA 4IORA 5CQAA 3VKHA 4FLPA 4UIZA 5FBXA 4UYEA 5HCLA 5KTWA 3LQJA 2F6JA 4MEOA 3QZSA 5D3NA 5HQ5A 3O35A 5G4SA 4IR3A 4O78A 4YK0A 3LQIA 4HXNA 3S92A 2RS9B 4YY6A 5BT3A 5H1TA 5F62A 5FE7A 4HBWA 3O37A 2OO1A 4NUDA 5I88A 2F6NA 3AQAA 4QNSA 5ETBA 5L99A 4O7EA 5HRVA 4Z93A 5ENGA 4MR4A 2YYNA 4Z6IA 5DBMA 4O74A 2LSPB 3AADA 4NR4A 3G0LA 4A9MA 4QSQA 4BW4A 4XUBA 4NR8A 5A5PA 5CQ5A 5HJCA 4YYJA 2YQDA 4XY9A 2R0YA 4HXOA 3K2JA 5FH6A 2RNYA 2L84A 4UYFA 5DW1A 5EICA 5L8UA 2E3KA 4LYIA 4YYMA 5LJ2A 3UV4A 4QYLA 4NQMA 5FE5A 4ZW1A 5ENHA 5LKUA 5CQ6A 3QZVA 4UYDA 3D7CA 4LYWA 4XUAA 5HFQA 4TU6A 5D0CA 4QSWA 4BHWA 5AD3A 5CUDA 3HMHA 2L5EA 4YYKA 4AKGA 5C8GA 4N4GA 5F25A 5H85A 5HQ6A 4TYLA 5F60A 5D3LA 3NXBA 4TZ8A 4TU4A 4QR4A 5FFVA 5CUCA 5EVAA 3U5LA 5D26A 5EWHA 3JVMA 1ZS5A 3UW9A 3MB3A 3JVJA 5H1UA 5CP5A 4NYVA 5CQTA 1ZKRA 2MJVB 4TT4A 5A7CA 4UYGA 2FSAA 5EISA 5IGNA 5EPSA 4NRBA 3Q2EA 5D3JA 3MULA 5FE6A 5F2PA 4BJXA 4YAXA 1E6IA 5D24A 4A9KA 4AKNA 5BT5A 5II2A 4GPJA 2OUOA 4NR5A 5EM3A 4J3IA 4NR6A 3ERRA 4CUQA 4YYHA 5EGUA 4MR3A 4CUUA 5K29A 4NXJA 3P1DA 4J1PA 4ALGA 5I7XA 3P1CA 5I80A 5FG6A 2OSSA 4O7BA 4ZQLA 4N4IA 4UIYA 5ACYA 5E74A 4UYFB 4Z1QA 4O7AA 5D3HA 5DLXA 5DYUA 4QC3A 5DKCA 3P1FA 4QYDA 4IOQA 4YH4A 3SVGA 5EWVA 4N4HA 5E9IA 5CS8A 3LJWA 1JSPB 4TT6A 4LZRA 5ENEA 5HM0A 2KTBB 5J0DA 4LDFA 3IU5A 4PCEA 4QSUA 3Q2FA 5G4RA 4Z1SA 5HELA 4AKIA 4HXPA 4CL9A 4HXRA 4HXKA 5I1QA 2N9GA 4A9FA 4QSSA 4AKHA 5DFCA 3UV2A 3U5NA 5D3SA 4CFLA 5C4QA 5I7YA 4Y03A 4A9OA 5HFRA 4ZC9A 5DW2A 3S91A 4MEQA 2H60A 4NYXA 5F1HA 2RI7A 4PS5A 4A9HA 4A9JA 3MUKA 5IGMA 5EV9A 5DY7A 5FE3A 5L97A 5C7NA 5LKXA 3RCWA 4O72A 4WIVA 5KU3A 2DVVA 3HMEA 4PKLA 4IR5A 4HXMA 4MEPA 5E9MA 5HEMA 4C66A 3I3JA 5L96A 5FFWA 5HQ7A 5FG5A 4BW2A 2GRCA 2DVQA 4TT2A 3SVFA 5EU1A 5L98A 4WHUA 5AMEA 4Z6HA 4YYIA 5FE4A 5TCMA 5E9YA 1X0JA 4UIXA 5C85A 4IOOA 5F3AA 4YBMA 4A9LA 3U5KA 5ENBA 5D25A 2I8NA 2R10A 5FE1A 2YELA 3U5MA 5I86A 2DKWA 3TLPA 5C87A 1WUMA 4IR4A 3U5JA 4YYNA 5LKZA 5E9KA 5LVRA 4LR6A 5CFWA 5AMFA 4O7CA 5CTLA 5A83A 5A5SA 4HXLA 4CUTA 3GG3A 3P5OA 5FE0A 4QR3A 5A82A 4QSXA 3LQHA 5DKDA 5FFYA 4O75A 4YADA 4YABA 4YBSA 4O70A 4LRGA 4O77A 4QZSA 2E7NA 5ETDA 5D3PA 5D3RA 1JM4B 4LC2A 2RO1A 4AI6A 4QSTA 5A85A 5IGLA 2RNWA 4UIVA 5CRMA 5E3DA 3UVXA 4WHWA 5FH8A 4NS5A 5A5QA 5DYCA 5DFDA 3IU6A 4DONA 5D7XA 3JVLA 3G0JA 4C67A 5D3TA 5EK9A 4LYSA 2EJNA 4QR5A 5BT4A 4YATA 4CFKA 4X2IA 5EWCA 5KO4A 3HMFA 5FH7A 4NRCA 4A9EA 4O76A 3ONIA 4HBVA 2NXBA 2DATA 4MR5A 5E9LA 5KTUA 4IR6A 5DX4A 5CUGA 4QEUA 4QBMA 5ENJA 5L8TA 4HBXA 5E73A 4HXSA 5DKHA 4O7FA 4QUUA 2YEMA 4NR7A 5DFBA 3ZYUA 1EQFA 5E0RA 3P1EA 4J0RA 3QZTA 5KTXA 4CUPA 5F61A 4A9IA 2D9EA 4TTEA 4NUEA 2YEKA 5IG6A 2D82A 4QUTA 4TZ2A 3O33A 4QEVA 5EA1A 5HRXA 5I40A 3SVHA 2DVSA 4BW1A 4QSPA 4O71A 2R0SA 4UIWA 4NYWA 3U5OA 5CUBA 4F3IA 5CUAA 4MR6A 3JVKA 5F36A 3U5PA 2R0VA 3FKMX 4Q0OA 4A9NA 5IBNA 4OGIA 5LVQA 2RNXA 2E7OA 3O34A 4NUCA 4QSRA 2YW5A 4CUSA 4NQNA 5DYXA 3UVYA 5ENIA 1F68A 2WP1A 5E9VA 5FE8A 5JWMA 4KV4A 5H1VA 5AD2A 3UVDA 3MQMA 4Q0NA 3UVWA 4BW3A 4XYAA 5LJ1A 4TQNA 5ENCA 5CQ3A 5DYAA 5FB1A
chains in the Genus database with same CATH topology
4TS8A 2WP2A 2DVRA 4PCIA 5A5NA 5A5RA 5I83A 2G4AA 5CQ8A 4NR9A 5F63A 5DLZA 4QSVA 5E3GA 5CY9A 5E7DA 4KV1A 5EP7A 4UITA 5FE9A 5JI8A 5CPEA 5HRWA 4RVRA 5A5OA 5C89A 4QY4A 5HLSA 5FDZA 5FG4A 5CQ7A 4PY6A 2L85A 4N3WA 4OUFA 5EWDA 4CLBA 5LKTA 4YH3A 5EWWA 5IIDA 4NRAA 4MENA 5EPRA 5EI4A 3DWYA 5F1LA 3O36A 4J0SA 5I89A 3MB4A 5CGPA 2RFJA 5TB6A 5I29A 5ENFA 3MXFA 4QB3A 4YYDA 3LXJA 4UIUA 5KHMA 3DAIA 1WUGA 4QEWA 2I7KA 4YC9A 4UYHA 5EQ1A 3UV5A 5CRZA 1N72A 5FB0A 5CQ4A 5COIA 4YBTA 5CUEA 5IGKA 4PTBA 4QC1A 5FE2A 4E96A 5HENA 4KCXA 4XY8A 4HBYA 2YDWA 5LJ0A 5CZGA 4YYGA 4LZSA 4LZ2A 5II1A 5F5ZA 5A81A 4N4FA 4OGJA 2DWWA 5LUUA 4ALHA 5EPBA 4YY4A 5CU8A 4CURA 4IORA 5CQAA 4FLPA 4UIZA 5FBXA 4UYEA 5HCLA 5KTWA 3LQJA 2F6JA 4MEOA 3QZSA 5D3NA 5HQ5A 3O35A 5G4SA 4IR3A 4O78A 4YK0A 3LQIA 4HXNA 3S92A 2RS9B 4YY6A 5BT3A 5H1TA 5F62A 5FE7A 4HBWA 3O37A 2OO1A 4NUDA 5I88A 2F6NA 3AQAA 4QNSA 5ETBA 5L99A 4O7EA 5HRVA 4Z93A 5ENGA 4MR4A 2YYNA 4Z6IA 5DBMA 4O74A 2LSPB 3AADA 4NR4A 3G0LA 4A9MA 4QSQA 4BW4A 4XUBA 4NR8A 5A5PA 5CQ5A 5HJCA 4YYJA 2YQDA 4XY9A 2R0YA 4HXOA 3K2JA 5FH6A 2RNYA 2L84A 4UYFA 5DW1A 5EICA 5L8UA 2E3KA 4LYIA 4YYMA 5LJ2A 3UV4A 4QYLA 4NQMA 5FE5A 4ZW1A 5ENHA 5LKUA 5CQ6A 3QZVA 4UYDA 3D7CA 4LYWA 4XUAA 5HFQA 4TU6A 5D0CA 4QSWA 4BHWA 5AD3A 5CUDA 3HMHA 2L5EA 4YYKA 5C8GA 4N4GA 5F25A 5H85A 5HQ6A 4TYLA 5F60A 5D3LA 3NXBA 4TZ8A 4TU4A 4QR4A 5FFVA 5CUCA 5EVAA 3U5LA 5D26A 5EWHA 3JVMA 1ZS5A 3UW9A 3MB3A 3JVJA 5H1UA 5CP5A 4NYVA 5CQTA 2MJVB 4TT4A 5A7CA 4UYGA 2FSAA 5EISA 5IGNA 5EPSA 4NRBA 3Q2EA 5D3JA 3MULA 5FE6A 5F2PA 4BJXA 4YAXA 1E6IA 5D24A 4A9KA 4AKNA 5BT5A 5II2A 4GPJA 2OUOA 4NR5A 5EM3A 4J3IA 4NR6A 4CUQA 4YYHA 5EGUA 4MR3A 4CUUA 5K29A 4NXJA 3P1DA 4J1PA 4ALGA 5I7XA 3P1CA 5I80A 5FG6A 2OSSA 4O7BA 4ZQLA 4N4IA 4UIYA 5ACYA 5E74A 4UYFB 4Z1QA 4O7AA 5D3HA 5DLXA 5DYUA 4QC3A 5DKCA 3P1FA 4QYDA 4IOQA 4YH4A 3SVGA 5EWVA 4N4HA 5E9IA 5CS8A 3LJWA 1JSPB 4TT6A 4LZRA 5ENEA 5HM0A 2KTBB 5J0DA 4LDFA 3IU5A 4PCEA 4QSUA 3Q2FA 5G4RA 4Z1SA 5HELA 4HXPA 4CL9A 4HXRA 4HXKA 5I1QA 2N9GA 4A9FA 4QSSA 5DFCA 3UV2A 3U5NA 5D3SA 4CFLA 5C4QA 5I7YA 4Y03A 4A9OA 5HFRA 4ZC9A 5DW2A 3S91A 4MEQA 2H60A 4NYXA 5F1HA 2RI7A 4PS5A 4A9HA 4A9JA 3MUKA 5IGMA 5EV9A 5DY7A 5FE3A 5L97A 5C7NA 5LKXA 3RCWA 4O72A 4WIVA 5KU3A 2DVVA 3HMEA 4PKLA 4IR5A 4HXMA 4MEPA 5E9MA 5HEMA 4C66A 3I3JA 5L96A 5FFWA 5HQ7A 5FG5A 4BW2A 2GRCA 2DVQA 4TT2A 3SVFA 5EU1A 5L98A 4WHUA 5AMEA 4Z6HA 4YYIA 5FE4A 5TCMA 5E9YA 1X0JA 4UIXA 5C85A 4IOOA 5F3AA 4YBMA 4A9LA 3U5KA 5ENBA 5D25A 2I8NA 2R10A 5FE1A 2YELA 3U5MA 5I86A 2DKWA 3TLPA 5C87A 1WUMA 4IR4A 3U5JA 4YYNA 5LKZA 5E9KA 5LVRA 4LR6A 5CFWA 5AMFA 4O7CA 5CTLA 5A83A 5A5SA 4HXLA 4CUTA 3GG3A 3P5OA 5FE0A 4QR3A 5A82A 4QSXA 3LQHA 5DKDA 5FFYA 4O75A 4YADA 4YABA 4YBSA 4O70A 4LRGA 4O77A 4QZSA 2E7NA 5ETDA 5D3PA 5D3RA 1JM4B 4LC2A 2RO1A 4QSTA 5A85A 5IGLA 2RNWA 4UIVA 5CRMA 5E3DA 3UVXA 4WHWA 5FH8A 4NS5A 5A5QA 5DYCA 5DFDA 3IU6A 4DONA 5D7XA 3JVLA 3G0JA 4C67A 5D3TA 5EK9A 4LYSA 4QR5A 5BT4A 4YATA 4CFKA 4X2IA 5EWCA 5KO4A 3HMFA 5FH7A 4NRCA 4A9EA 4O76A 3ONIA 4HBVA 2NXBA 2DATA 4MR5A 5E9LA 5KTUA 4IR6A 5DX4A 5CUGA 4QEUA 4QBMA 5ENJA 5L8TA 4HBXA 5E73A 4HXSA 5DKHA 4O7FA 4QUUA 2YEMA 4NR7A 5DFBA 3ZYUA 1EQFA 5E0RA 3P1EA 4J0RA 3QZTA 5KTXA 4CUPA 5F61A 4A9IA 2D9EA 4TTEA 4NUEA 2YEKA 5IG6A 2D82A 4QUTA 4TZ2A 3O33A 4QEVA 5EA1A 5HRXA 5I40A 3SVHA 2DVSA 4BW1A 4QSPA 4O71A 2R0SA 4UIWA 4NYWA 3U5OA 5CUBA 4F3IA 5CUAA 4MR6A 3JVKA 5F36A 3U5PA 2R0VA 3FKMX 4Q0OA 4A9NA 5IBNA 4OGIA 5LVQA 2RNXA 2E7OA 3O34A 4NUCA 4QSRA 2YW5A 4CUSA 4NQNA 5DYXA 3UVYA 5ENIA 1F68A 2WP1A 5E9VA 5FE8A 5JWMA 4KV4A 5H1VA 5AD2A 3UVDA 3MQMA 4Q0NA 3UVWA 4BW3A 4XYAA 5LJ1A 4TQNA 5ENCA 5CQ3A 5DYAA 5FB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TS8 A;  2WP2 A;  2DVR A;  4PCI A;  5A5N A;  5A5R A;  5I83 A;  2G4A A;  5CQ8 A;  4NR9 A;  5F63 A;  5DLZ A;  4QSV A;  5E3G A;  5CY9 A;  5E7D A;  4KV1 A;  5EP7 A;  4UIT A;  5FE9 A;  5JI8 A;  5CPE A;  5HRW A;  4RVR A;  5A5O A;  5C89 A;  4QY4 A;  5HLS A;  5FDZ A;  5FG4 A;  5CQ7 A;  4PY6 A;  2L85 A;  4N3W A;  4OUF A;  5EWD A;  4CLB A;  5LKT A;  4YH3 A;  5EWW A;  5IID A;  4NRA A;  4MEN A;  5EPR A;  5EI4 A;  3DWY A;  5F1L A;  3O36 A;  4J0S A;  5I89 A;  3MB4 A;  5CGP A;  2RFJ A;  5TB6 A;  5I29 A;  5ENF A;  3MXF A;  4QB3 A;  4YYD A;  3LXJ A;  4UIU A;  5KHM A;  3DAI A;  1WUG A;  4QEW A;  2I7K A;  4YC9 A;  4UYH A;  5EQ1 A;  3UV5 A;  5CRZ A;  1N72 A;  5FB0 A;  5CQ4 A;  5COI A;  4YBT A;  5CUE A;  5IGK A;  4PTB A;  4QC1 A;  5FE2 A;  4E96 A;  5HEN A;  4KCX A;  4XY8 A;  4HBY A;  2YDW A;  5LJ0 A;  5CZG A;  4YYG A;  4LZS A;  4LZ2 A;  5II1 A;  5F5Z A;  5A81 A;  4N4F A;  4OGJ A;  2DWW A;  5LUU A;  4ALH A;  5EPB A;  4YY4 A;  5CU8 A;  4CUR A;  4IOR A;  5CQA A;  4FLP A;  4UIZ A;  5FBX A;  4UYE A;  5HCL A;  5KTW A;  3LQJ A;  2F6J A;  4MEO A;  3QZS A;  5D3N A;  5HQ5 A;  3O35 A;  5G4S A;  4IR3 A;  4O78 A;  4YK0 A;  3LQI A;  4HXN A;  3S92 A;  2RS9 B;  4YY6 A;  5BT3 A;  5H1T A;  5F62 A;  5FE7 A;  4HBW A;  3O37 A;  2OO1 A;  4NUD A;  5I88 A;  2F6N A;  3AQA A;  4QNS A;  5ETB A;  5L99 A;  4O7E A;  5HRV A;  4Z93 A;  5ENG A;  4MR4 A;  2YYN A;  4Z6I A;  5DBM A;  4O74 A;  2LSP B;  3AAD A;  4NR4 A;  3G0L A;  4A9M A;  4QSQ A;  4BW4 A;  4XUB A;  4NR8 A;  5A5P A;  5CQ5 A;  5HJC A;  4YYJ A;  2YQD A;  4XY9 A;  2R0Y A;  4HXO A;  3K2J A;  5FH6 A;  2RNY A;  2L84 A;  4UYF A;  5DW1 A;  5EIC A;  5L8U A;  2E3K A;  4LYI A;  4YYM A;  5LJ2 A;  3UV4 A;  4QYL A;  4NQM A;  5FE5 A;  4ZW1 A;  5ENH A;  5LKU A;  5CQ6 A;  3QZV A;  4UYD A;  3D7C A;  4LYW A;  4XUA A;  5HFQ A;  4TU6 A;  5D0C A;  4QSW A;  4BHW A;  5AD3 A;  5CUD A;  3HMH A;  2L5E A;  4YYK A;  5C8G A;  4N4G A;  5F25 A;  5H85 A;  5HQ6 A;  4TYL A;  5F60 A;  5D3L A;  3NXB A;  4TZ8 A;  4TU4 A;  4QR4 A;  5FFV A;  5CUC A;  5EVA A;  3U5L A;  5D26 A;  5EWH A;  3JVM A;  1ZS5 A;  3UW9 A;  3MB3 A;  3JVJ A;  5H1U A;  5CP5 A;  4NYV A;  5CQT A;  2MJV B;  4TT4 A;  5A7C A;  4UYG A;  2FSA A;  5EIS A;  5IGN A;  5EPS A;  4NRB A;  3Q2E A;  5D3J A;  3MUL A;  5FE6 A;  5F2P A;  4BJX A;  4YAX A;  1E6I A;  5D24 A;  4A9K A;  4AKN A;  5BT5 A;  5II2 A;  4GPJ A;  2OUO A;  4NR5 A;  5EM3 A;  4J3I A;  4NR6 A;  4CUQ A;  4YYH A;  5EGU A;  4MR3 A;  4CUU A;  5K29 A;  4NXJ A;  3P1D A;  4J1P A;  4ALG A;  5I7X A;  3P1C A;  5I80 A;  5FG6 A;  2OSS A;  4O7B A;  4ZQL A;  4N4I A;  4UIY A;  5ACY A;  5E74 A;  4UYF B;  4Z1Q A;  4O7A A;  5D3H A;  5DLX A;  5DYU A;  4QC3 A;  5DKC A;  3P1F A;  4QYD A;  4IOQ A;  4YH4 A;  3SVG A;  5EWV A;  4N4H A;  5E9I A;  5CS8 A;  3LJW A;  1JSP B;  4TT6 A;  4LZR A;  5ENE A;  5HM0 A;  2KTB B;  5J0D A;  4LDF A;  3IU5 A;  4PCE A;  4QSU A;  3Q2F A;  5G4R A;  4Z1S A;  5HEL A;  4HXP A;  4CL9 A;  4HXR A;  4HXK A;  5I1Q A;  2N9G A;  4A9F A;  4QSS A;  5DFC A;  3UV2 A;  3U5N A;  5D3S A;  4CFL A;  5C4Q A;  5I7Y A;  4Y03 A;  4A9O A;  5HFR A;  4ZC9 A;  5DW2 A;  3S91 A;  4MEQ A;  2H60 A;  4NYX A;  5F1H A;  2RI7 A;  4PS5 A;  4A9H A;  4A9J A;  3MUK A;  5IGM A;  5EV9 A;  5DY7 A;  5FE3 A;  5L97 A;  5C7N A;  5LKX A;  3RCW A;  4O72 A;  4WIV A;  5KU3 A;  2DVV A;  3HME A;  4PKL A;  4IR5 A;  4HXM A;  4MEP A;  5E9M A;  5HEM A;  4C66 A;  3I3J A;  5L96 A;  5FFW A;  5HQ7 A;  5FG5 A;  4BW2 A;  2GRC A;  2DVQ A;  4TT2 A;  3SVF A;  5EU1 A;  5L98 A;  4WHU A;  5AME A;  4Z6H A;  4YYI A;  5FE4 A;  5TCM A;  5E9Y A;  1X0J A;  4UIX A;  5C85 A;  4IOO A;  5F3A A;  4YBM A;  4A9L A;  3U5K A;  5ENB A;  5D25 A;  2I8N A;  2R10 A;  5FE1 A;  2YEL A;  3U5M A;  5I86 A;  2DKW A;  3TLP A;  5C87 A;  1WUM A;  4IR4 A;  3U5J A;  4YYN A;  5LKZ A;  5E9K A;  5LVR A;  4LR6 A;  5CFW A;  5AMF A;  4O7C A;  5CTL A;  5A83 A;  5A5S A;  4HXL A;  4CUT A;  3GG3 A;  3P5O A;  5FE0 A;  4QR3 A;  5A82 A;  4QSX A;  3LQH A;  5DKD A;  5FFY A;  4O75 A;  4YAD A;  4YAB A;  4YBS A;  4O70 A;  4LRG A;  4O77 A;  4QZS A;  2E7N A;  5ETD A;  5D3P A;  5D3R A;  1JM4 B;  4LC2 A;  2RO1 A;  4QST A;  5A85 A;  5IGL A;  2RNW A;  4UIV A;  5CRM A;  5E3D A;  3UVX A;  4WHW A;  5FH8 A;  4NS5 A;  5A5Q A;  5DYC A;  5DFD A;  3IU6 A;  4DON A;  5D7X A;  3JVL A;  3G0J A;  4C67 A;  5D3T A;  5EK9 A;  4LYS A;  4QR5 A;  5BT4 A;  4YAT A;  4CFK A;  4X2I A;  5EWC A;  5KO4 A;  3HMF A;  5FH7 A;  4NRC A;  4A9E A;  4O76 A;  3ONI A;  4HBV A;  2NXB A;  2DAT A;  4MR5 A;  5E9L A;  5KTU A;  4IR6 A;  5DX4 A;  5CUG A;  4QEU A;  4QBM A;  5ENJ A;  5L8T A;  4HBX A;  5E73 A;  4HXS A;  5DKH A;  4O7F A;  4QUU A;  2YEM A;  4NR7 A;  5DFB A;  3ZYU A;  1EQF A;  5E0R A;  3P1E A;  4J0R A;  3QZT A;  5KTX A;  4CUP A;  5F61 A;  4A9I A;  2D9E A;  4TTE A;  4NUE A;  2YEK A;  5IG6 A;  2D82 A;  4QUT A;  4TZ2 A;  3O33 A;  4QEV A;  5EA1 A;  5HRX A;  5I40 A;  3SVH A;  2DVS A;  4BW1 A;  4QSP A;  4O71 A;  2R0S A;  4UIW A;  4NYW A;  3U5O A;  5CUB A;  4F3I A;  5CUA A;  4MR6 A;  3JVK A;  5F36 A;  3U5P A;  2R0V A;  3FKM X;  4Q0O A;  4A9N A;  5IBN A;  4OGI A;  5LVQ A;  2RNX A;  2E7O A;  3O34 A;  4NUC A;  4QSR A;  2YW5 A;  4CUS A;  4NQN A;  5DYX A;  3UVY A;  5ENI A;  1F68 A;  2WP1 A;  5E9V A;  5FE8 A;  5JWM A;  4KV4 A;  5H1V A;  5AD2 A;  3UVD A;  3MQM A;  4Q0N A;  3UVW A;  4BW3 A;  4XYA A;  5LJ1 A;  4TQN A;  5ENC A;  5CQ3 A;  5DYA A;  5FB1 A; 
#chains in the Genus database with same CATH topology
 4TS8 A;  2WP2 A;  3D1B A;  2DVR A;  4PCI A;  5A5N A;  5A5R A;  5I83 A;  2G4A A;  5CQ8 A;  4NR9 A;  5F63 A;  5DLZ A;  4QSV A;  5E3G A;  5CY9 A;  1PUO A;  5E7D A;  4KV1 A;  5EP7 A;  4UIT A;  5FE9 A;  5JI8 A;  3VKG A;  5CPE A;  5HRW A;  4RVR A;  5A5O A;  5C89 A;  4QY4 A;  5HLS A;  5FDZ A;  5FG4 A;  5CQ7 A;  4PY6 A;  2L85 A;  4N3W A;  4OUF A;  5EWD A;  4CLB A;  5LKT A;  4YH3 A;  5EWW A;  5IID A;  4NRA A;  4MEN A;  5EPR A;  5EI4 A;  3DWY A;  5F1L A;  3O36 A;  4J0S A;  5I89 A;  3MB4 A;  5CGP A;  2RFJ A;  5TB6 A;  5I29 A;  5ENF A;  3MXF A;  4QB3 A;  4YYD A;  3LXJ A;  4UIU A;  5KHM A;  3DAI A;  1WUG A;  4QEW A;  2I7K A;  4YC9 A;  3D1D A;  4UYH A;  5EQ1 A;  3UV5 A;  5CRZ A;  1N72 A;  5FB0 A;  5CQ4 A;  5COI A;  4YBT A;  5CUE A;  5IGK A;  4PTB A;  4QC1 A;  5FE2 A;  4E96 A;  5HEN A;  4KCX A;  4XY8 A;  4HBY A;  2YDW A;  5LJ0 A;  5CZG A;  4YYG A;  4LZS A;  4LZ2 A;  5II1 A;  5F5Z A;  5A81 A;  4N4F A;  4OGJ A;  2DWW A;  5LUU A;  4ALH A;  5EPB A;  4YY4 A;  5CU8 A;  4CUR A;  4IOR A;  5CQA A;  3VKH A;  4FLP A;  4UIZ A;  5FBX A;  4UYE A;  5HCL A;  5KTW A;  3LQJ A;  2F6J A;  4MEO A;  3QZS A;  5D3N A;  5HQ5 A;  3O35 A;  5G4S A;  4IR3 A;  4O78 A;  4YK0 A;  3LQI A;  4HXN A;  3S92 A;  2RS9 B;  4YY6 A;  5BT3 A;  5H1T A;  5F62 A;  5FE7 A;  4HBW A;  3O37 A;  2OO1 A;  4NUD A;  5I88 A;  2F6N A;  3AQA A;  4QNS A;  5ETB A;  5L99 A;  4O7E A;  5HRV A;  4Z93 A;  5ENG A;  4MR4 A;  2YYN A;  4Z6I A;  5DBM A;  4O74 A;  2LSP B;  3AAD A;  4NR4 A;  3G0L A;  4A9M A;  4QSQ A;  4BW4 A;  4XUB A;  4NR8 A;  5A5P A;  5CQ5 A;  5HJC A;  4YYJ A;  2YQD A;  4XY9 A;  2R0Y A;  4HXO A;  3K2J A;  5FH6 A;  2RNY A;  2L84 A;  4UYF A;  5DW1 A;  5EIC A;  5L8U A;  2E3K A;  4LYI A;  4YYM A;  5LJ2 A;  3UV4 A;  4QYL A;  4NQM A;  5FE5 A;  4ZW1 A;  5ENH A;  5LKU A;  5CQ6 A;  3QZV A;  4UYD A;  3D7C A;  4LYW A;  4XUA A;  5HFQ A;  4TU6 A;  5D0C A;  4QSW A;  4BHW A;  5AD3 A;  5CUD A;  3HMH A;  2L5E A;  4YYK A;  4AKG A;  5C8G A;  4N4G A;  5F25 A;  5H85 A;  5HQ6 A;  4TYL A;  5F60 A;  5D3L A;  3NXB A;  4TZ8 A;  4TU4 A;  4QR4 A;  5FFV A;  5CUC A;  5EVA A;  3U5L A;  5D26 A;  5EWH A;  3JVM A;  1ZS5 A;  3UW9 A;  3MB3 A;  3JVJ A;  5H1U A;  5CP5 A;  4NYV A;  5CQT A;  1ZKR A;  2MJV B;  4TT4 A;  5A7C A;  4UYG A;  2FSA A;  5EIS A;  5IGN A;  5EPS A;  4NRB A;  3Q2E A;  5D3J A;  3MUL A;  5FE6 A;  5F2P A;  4BJX A;  4YAX A;  1E6I A;  5D24 A;  4A9K A;  4AKN A;  5BT5 A;  5II2 A;  4GPJ A;  2OUO A;  4NR5 A;  5EM3 A;  4J3I A;  4NR6 A;  3ERR A;  4CUQ A;  4YYH A;  5EGU A;  4MR3 A;  4CUU A;  5K29 A;  4NXJ A;  3P1D A;  4J1P A;  4ALG A;  5I7X A;  3P1C A;  5I80 A;  5FG6 A;  2OSS A;  4O7B A;  4ZQL A;  4N4I A;  4UIY A;  5ACY A;  5E74 A;  4UYF B;  4Z1Q A;  4O7A A;  5D3H A;  5DLX A;  5DYU A;  4QC3 A;  5DKC A;  3P1F A;  4QYD A;  4IOQ A;  4YH4 A;  3SVG A;  5EWV A;  4N4H A;  5E9I A;  5CS8 A;  3LJW A;  1JSP B;  4TT6 A;  4LZR A;  5ENE A;  5HM0 A;  2KTB B;  5J0D A;  4LDF A;  3IU5 A;  4PCE A;  4QSU A;  3Q2F A;  5G4R A;  4Z1S A;  5HEL A;  4AKI A;  4HXP A;  4CL9 A;  4HXR A;  4HXK A;  5I1Q A;  2N9G A;  4A9F A;  4QSS A;  4AKH A;  5DFC A;  3UV2 A;  3U5N A;  5D3S A;  4CFL A;  5C4Q A;  5I7Y A;  4Y03 A;  4A9O A;  5HFR A;  4ZC9 A;  5DW2 A;  3S91 A;  4MEQ A;  2H60 A;  4NYX A;  5F1H A;  2RI7 A;  4PS5 A;  4A9H A;  4A9J A;  3MUK A;  5IGM A;  5EV9 A;  5DY7 A;  5FE3 A;  5L97 A;  5C7N A;  5LKX A;  3RCW A;  4O72 A;  4WIV A;  5KU3 A;  2DVV A;  3HME A;  4PKL A;  4IR5 A;  4HXM A;  4MEP A;  5E9M A;  5HEM A;  4C66 A;  3I3J A;  5L96 A;  5FFW A;  5HQ7 A;  5FG5 A;  4BW2 A;  2GRC A;  2DVQ A;  4TT2 A;  3SVF A;  5EU1 A;  5L98 A;  4WHU A;  5AME A;  4Z6H A;  4YYI A;  5FE4 A;  5TCM A;  5E9Y A;  1X0J A;  4UIX A;  5C85 A;  4IOO A;  5F3A A;  4YBM A;  4A9L A;  3U5K A;  5ENB A;  5D25 A;  2I8N A;  2R10 A;  5FE1 A;  2YEL A;  3U5M A;  5I86 A;  2DKW A;  3TLP A;  5C87 A;  1WUM A;  4IR4 A;  3U5J A;  4YYN A;  5LKZ A;  5E9K A;  5LVR A;  4LR6 A;  5CFW A;  5AMF A;  4O7C A;  5CTL A;  5A83 A;  5A5S A;  4HXL A;  4CUT A;  3GG3 A;  3P5O A;  5FE0 A;  4QR3 A;  5A82 A;  4QSX A;  3LQH A;  5DKD A;  5FFY A;  4O75 A;  4YAD A;  4YAB A;  4YBS A;  4O70 A;  4LRG A;  4O77 A;  4QZS A;  2E7N A;  5ETD A;  5D3P A;  5D3R A;  1JM4 B;  4LC2 A;  2RO1 A;  4AI6 A;  4QST A;  5A85 A;  5IGL A;  2RNW A;  4UIV A;  5CRM A;  5E3D A;  3UVX A;  4WHW A;  5FH8 A;  4NS5 A;  5A5Q A;  5DYC A;  5DFD A;  3IU6 A;  4DON A;  5D7X A;  3JVL A;  3G0J A;  4C67 A;  5D3T A;  5EK9 A;  4LYS A;  2EJN A;  4QR5 A;  5BT4 A;  4YAT A;  4CFK A;  4X2I A;  5EWC A;  5KO4 A;  3HMF A;  5FH7 A;  4NRC A;  4A9E A;  4O76 A;  3ONI A;  4HBV A;  2NXB A;  2DAT A;  4MR5 A;  5E9L A;  5KTU A;  4IR6 A;  5DX4 A;  5CUG A;  4QEU A;  4QBM A;  5ENJ A;  5L8T A;  4HBX A;  5E73 A;  4HXS A;  5DKH A;  4O7F A;  4QUU A;  2YEM A;  4NR7 A;  5DFB A;  3ZYU A;  1EQF A;  5E0R A;  3P1E A;  4J0R A;  3QZT A;  5KTX A;  4CUP A;  5F61 A;  4A9I A;  2D9E A;  4TTE A;  4NUE A;  2YEK A;  5IG6 A;  2D82 A;  4QUT A;  4TZ2 A;  3O33 A;  4QEV A;  5EA1 A;  5HRX A;  5I40 A;  3SVH A;  2DVS A;  4BW1 A;  4QSP A;  4O71 A;  2R0S A;  4UIW A;  4NYW A;  3U5O A;  5CUB A;  4F3I A;  5CUA A;  4MR6 A;  3JVK A;  5F36 A;  3U5P A;  2R0V A;  3FKM X;  4Q0O A;  4A9N A;  5IBN A;  4OGI A;  5LVQ A;  2RNX A;  2E7O A;  3O34 A;  4NUC A;  4QSR A;  2YW5 A;  4CUS A;  4NQN A;  5DYX A;  3UVY A;  5ENI A;  1F68 A;  2WP1 A;  5E9V A;  5FE8 A;  5JWM A;  4KV4 A;  5H1V A;  5AD2 A;  3UVD A;  3MQM A;  4Q0N A;  3UVW A;  4BW3 A;  4XYA A;  5LJ1 A;  4TQN A;  5ENC A;  5CQ3 A;  5DYA A;  5FB1 A; 
#chains in the Genus database with same CATH homology
 4TS8 A;  2WP2 A;  2DVR A;  4PCI A;  5A5N A;  5A5R A;  5I83 A;  2G4A A;  5CQ8 A;  4NR9 A;  5F63 A;  5DLZ A;  4QSV A;  5E3G A;  5CY9 A;  5E7D A;  4KV1 A;  5EP7 A;  4UIT A;  5FE9 A;  5JI8 A;  5CPE A;  5HRW A;  4RVR A;  5A5O A;  5C89 A;  4QY4 A;  5HLS A;  5FDZ A;  5FG4 A;  5CQ7 A;  4PY6 A;  2L85 A;  4N3W A;  4OUF A;  5EWD A;  4CLB A;  5LKT A;  4YH3 A;  5EWW A;  5IID A;  4NRA A;  4MEN A;  5EPR A;  5EI4 A;  3DWY A;  5F1L A;  3O36 A;  4J0S A;  5I89 A;  3MB4 A;  5CGP A;  2RFJ A;  5TB6 A;  5I29 A;  5ENF A;  3MXF A;  4QB3 A;  4YYD A;  3LXJ A;  4UIU A;  5KHM A;  3DAI A;  1WUG A;  4QEW A;  2I7K A;  4YC9 A;  4UYH A;  5EQ1 A;  3UV5 A;  5CRZ A;  1N72 A;  5FB0 A;  5CQ4 A;  5COI A;  4YBT A;  5CUE A;  5IGK A;  4PTB A;  4QC1 A;  5FE2 A;  4E96 A;  5HEN A;  4KCX A;  4XY8 A;  4HBY A;  2YDW A;  5LJ0 A;  5CZG A;  4YYG A;  4LZS A;  4LZ2 A;  5II1 A;  5F5Z A;  5A81 A;  4N4F A;  4OGJ A;  2DWW A;  5LUU A;  4ALH A;  5EPB A;  4YY4 A;  5CU8 A;  4CUR A;  4IOR A;  5CQA A;  4FLP A;  4UIZ A;  5FBX A;  4UYE A;  5HCL A;  5KTW A;  3LQJ A;  2F6J A;  4MEO A;  3QZS A;  5D3N A;  5HQ5 A;  3O35 A;  5G4S A;  4IR3 A;  4O78 A;  4YK0 A;  3LQI A;  4HXN A;  3S92 A;  2RS9 B;  4YY6 A;  5BT3 A;  5H1T A;  5F62 A;  5FE7 A;  4HBW A;  3O37 A;  2OO1 A;  4NUD A;  5I88 A;  2F6N A;  3AQA A;  4QNS A;  5ETB A;  5L99 A;  4O7E A;  5HRV A;  4Z93 A;  5ENG A;  4MR4 A;  2YYN A;  4Z6I A;  5DBM A;  4O74 A;  2LSP B;  3AAD A;  4NR4 A;  3G0L A;  4A9M A;  4QSQ A;  4BW4 A;  4XUB A;  4NR8 A;  5A5P A;  5CQ5 A;  5HJC A;  4YYJ A;  2YQD A;  4XY9 A;  2R0Y A;  4HXO A;  3K2J A;  5FH6 A;  2RNY A;  2L84 A;  4UYF A;  5DW1 A;  5EIC A;  5L8U A;  2E3K A;  4LYI A;  4YYM A;  5LJ2 A;  3UV4 A;  4QYL A;  4NQM A;  5FE5 A;  4ZW1 A;  5ENH A;  5LKU A;  5CQ6 A;  3QZV A;  4UYD A;  3D7C A;  4LYW A;  4XUA A;  5HFQ A;  4TU6 A;  5D0C A;  4QSW A;  4BHW A;  5AD3 A;  5CUD A;  3HMH A;  2L5E A;  4YYK A;  5C8G A;  4N4G A;  5F25 A;  5H85 A;  5HQ6 A;  4TYL A;  5F60 A;  5D3L A;  3NXB A;  4TZ8 A;  4TU4 A;  4QR4 A;  5FFV A;  5CUC A;  5EVA A;  3U5L A;  5D26 A;  5EWH A;  3JVM A;  1ZS5 A;  3UW9 A;  3MB3 A;  3JVJ A;  5H1U A;  5CP5 A;  4NYV A;  5CQT A;  2MJV B;  4TT4 A;  5A7C A;  4UYG A;  2FSA A;  5EIS A;  5IGN A;  5EPS A;  4NRB A;  3Q2E A;  5D3J A;  3MUL A;  5FE6 A;  5F2P A;  4BJX A;  4YAX A;  1E6I A;  5D24 A;  4A9K A;  4AKN A;  5BT5 A;  5II2 A;  4GPJ A;  2OUO A;  4NR5 A;  5EM3 A;  4J3I A;  4NR6 A;  4CUQ A;  4YYH A;  5EGU A;  4MR3 A;  4CUU A;  5K29 A;  4NXJ A;  3P1D A;  4J1P A;  4ALG A;  5I7X A;  3P1C A;  5I80 A;  5FG6 A;  2OSS A;  4O7B A;  4ZQL A;  4N4I A;  4UIY A;  5ACY A;  5E74 A;  4UYF B;  4Z1Q A;  4O7A A;  5D3H A;  5DLX A;  5DYU A;  4QC3 A;  5DKC A;  3P1F A;  4QYD A;  4IOQ A;  4YH4 A;  3SVG A;  5EWV A;  4N4H A;  5E9I A;  5CS8 A;  3LJW A;  1JSP B;  4TT6 A;  4LZR A;  5ENE A;  5HM0 A;  2KTB B;  5J0D A;  4LDF A;  3IU5 A;  4PCE A;  4QSU A;  3Q2F A;  5G4R A;  4Z1S A;  5HEL A;  4HXP A;  4CL9 A;  4HXR A;  4HXK A;  5I1Q A;  2N9G A;  4A9F A;  4QSS A;  5DFC A;  3UV2 A;  3U5N A;  5D3S A;  4CFL A;  5C4Q A;  5I7Y A;  4Y03 A;  4A9O A;  5HFR A;  4ZC9 A;  5DW2 A;  3S91 A;  4MEQ A;  2H60 A;  4NYX A;  5F1H A;  2RI7 A;  4PS5 A;  4A9H A;  4A9J A;  3MUK A;  5IGM A;  5EV9 A;  5DY7 A;  5FE3 A;  5L97 A;  5C7N A;  5LKX A;  3RCW A;  4O72 A;  4WIV A;  5KU3 A;  2DVV A;  3HME A;  4PKL A;  4IR5 A;  4HXM A;  4MEP A;  5E9M A;  5HEM A;  4C66 A;  3I3J A;  5L96 A;  5FFW A;  5HQ7 A;  5FG5 A;  4BW2 A;  2GRC A;  2DVQ A;  4TT2 A;  3SVF A;  5EU1 A;  5L98 A;  4WHU A;  5AME A;  4Z6H A;  4YYI A;  5FE4 A;  5TCM A;  5E9Y A;  1X0J A;  4UIX A;  5C85 A;  4IOO A;  5F3A A;  4YBM A;  4A9L A;  3U5K A;  5ENB A;  5D25 A;  2I8N A;  2R10 A;  5FE1 A;  2YEL A;  3U5M A;  5I86 A;  2DKW A;  3TLP A;  5C87 A;  1WUM A;  4IR4 A;  3U5J A;  4YYN A;  5LKZ A;  5E9K A;  5LVR A;  4LR6 A;  5CFW A;  5AMF A;  4O7C A;  5CTL A;  5A83 A;  5A5S A;  4HXL A;  4CUT A;  3GG3 A;  3P5O A;  5FE0 A;  4QR3 A;  5A82 A;  4QSX A;  3LQH A;  5DKD A;  5FFY A;  4O75 A;  4YAD A;  4YAB A;  4YBS A;  4O70 A;  4LRG A;  4O77 A;  4QZS A;  2E7N A;  5ETD A;  5D3P A;  5D3R A;  1JM4 B;  4LC2 A;  2RO1 A;  4QST A;  5A85 A;  5IGL A;  2RNW A;  4UIV A;  5CRM A;  5E3D A;  3UVX A;  4WHW A;  5FH8 A;  4NS5 A;  5A5Q A;  5DYC A;  5DFD A;  3IU6 A;  4DON A;  5D7X A;  3JVL A;  3G0J A;  4C67 A;  5D3T A;  5EK9 A;  4LYS A;  4QR5 A;  5BT4 A;  4YAT A;  4CFK A;  4X2I A;  5EWC A;  5KO4 A;  3HMF A;  5FH7 A;  4NRC A;  4A9E A;  4O76 A;  3ONI A;  4HBV A;  2NXB A;  2DAT A;  4MR5 A;  5E9L A;  5KTU A;  4IR6 A;  5DX4 A;  5CUG A;  4QEU A;  4QBM A;  5ENJ A;  5L8T A;  4HBX A;  5E73 A;  4HXS A;  5DKH A;  4O7F A;  4QUU A;  2YEM A;  4NR7 A;  5DFB A;  3ZYU A;  1EQF A;  5E0R A;  3P1E A;  4J0R A;  3QZT A;  5KTX A;  4CUP A;  5F61 A;  4A9I A;  2D9E A;  4TTE A;  4NUE A;  2YEK A;  5IG6 A;  2D82 A;  4QUT A;  4TZ2 A;  3O33 A;  4QEV A;  5EA1 A;  5HRX A;  5I40 A;  3SVH A;  2DVS A;  4BW1 A;  4QSP A;  4O71 A;  2R0S A;  4UIW A;  4NYW A;  3U5O A;  5CUB A;  4F3I A;  5CUA A;  4MR6 A;  3JVK A;  5F36 A;  3U5P A;  2R0V A;  3FKM X;  4Q0O A;  4A9N A;  5IBN A;  4OGI A;  5LVQ A;  2RNX A;  2E7O A;  3O34 A;  4NUC A;  4QSR A;  2YW5 A;  4CUS A;  4NQN A;  5DYX A;  3UVY A;  5ENI A;  1F68 A;  2WP1 A;  5E9V A;  5FE8 A;  5JWM A;  4KV4 A;  5H1V A;  5AD2 A;  3UVD A;  3MQM A;  4Q0N A;  3UVW A;  4BW3 A;  4XYA A;  5LJ1 A;  4TQN A;  5ENC A;  5CQ3 A;  5DYA A;  5FB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...