2DVRA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvrA00
4QSTA 2E3KA 4PCIA 5D26A 5LVQA 5ENJA 3U5OA 4NR8A 4LYSA 5LJ1A 3JVLA 4QR3A 4NR5A 5DY7A 4YYGA 5KTWA 3SVFA 5H1TA 3U5NA 4Z6HA 5CQ5A 3MB3A 2G4AA 5AMFA 5BT5A 4WHUA 4AKNA 3U5MA 4ALGA 4YYNA 2OO1A 4HXOA 5JI8A 4YY4A 4WIVA 5H1UA 4QNSA 5A5RA 5HELA 4TT2A 4FLPA 4CFKA 4NS5A 4QR4A 5CS8A 2L84A 5CP5A 5A83A 5A5NA 1WUGA 5I86A 5L8TA 4Q0NA 5COIA 5CUBA 5KU3A 3IU5A 5FH8A 3LJWA 2RNWA 4A9EA 5CFWA 5EK9A 4QEUA 5C85A 4TTEA 3P1CA 5EP7A 5EU1A 5ENFA 5EWCA 3RCWA 5HFRA 4HBXA 4YYDA 2L85A 4KV1A 3UVXA 4YATA 5ACYA 4PKLA 4IR5A 5FE7A 5CU8A 4O7BA 5I29A 5F25A 3LQHA 4A9LA 5DLXA 5F61A 2I8NA 4MEPA 4QC3A 5CQTA 4YADA 3P1EA 4YYJA 5L98A 3UVYA 4BHWA 4LC2A 5FG6A 4O7EA 4IORA 5CY9A 4NRBA 5F62A 3UV4A 1ZS5A 2F6NA 2YW5A 5AD2A 2DVRA 2YELA 2H60A 4IR3A 5CTLA 5CUDA 5DKDA 4UYHA 3MULA 4CURA 3Q2FA 4HXNA 5D3LA 3UVDA 4YBMA 1JSPB 4QUUA 4QYLA 4QBMA 5LUUA 4RVRA 4IR6A 4C66A 5D3SA 4O70A 4TYLA 4LRGA 5CPEA 3LQJA 4HXKA 4YH3A 4N4IA 2R0YA 5I40A 5LJ0A 4UYFA 2D9EA 5D3RA 2L5EA 4Z6IA 3NXBA 5FE4A 2OSSA 3HMFA 4J0SA 5D25A 5FDZA 5ENGA 5DX4A 2YYNA 5DYXA 5EISA 4Q0OA 3UV2A 1WUMA 4UIYA 4O77A 2R0SA 5FB0A 5IGNA 4QYDA 5D3PA 5EGUA 2RFJA 4UYGA 5DKCA 5EPBA 3ZYUA 5J0DA 1JM4B 4QSQA 5EQ1A 5A85A 2R0VA 5F2PA 4MEOA 5HCLA 3HMHA 5I1QA 2YEKA 5C89A 4TZ8A 4UIXA 3DWYA 2RNXA 2YQDA 5CZGA 4LYWA 5EVAA 3GG3A 4NXJA 5DW1A 5KHMA 5FE8A 5L99A 2RO1A 4O7CA 5IG6A 2DWWA 4HXPA 5ENIA 4NR6A 4QSVA 4MR6A 5I88A 5DKHA 4CL9A 4ZC9A 5E3GA 5A82A 5A5QA 4QSUA 5II1A 1F68A 4TZ2A 5FB1A 4CUSA 4UIVA 4HBVA 3MXFA 4O7FA 4QSXA 5FH7A 5FH6A 3HMEA 4J1PA 5TB6A 4O75A 5AMEA 2E7OA 2RS9B 5KO4A 5LKUA 4N4FA 2KTBB 5I80A 4Z93A 5EWVA 5HENA 5A5SA 5E9IA 4QEVA 5F1LA 5DFCA 2GRCA 5DYCA 4Z1QA 2WP2A 5A81A 1N72A 4WHWA 5CQ3A 5IIDA 5EWDA 5EPSA 4CUPA 4MR3A 4E96A 3QZTA 5DYAA 5II2A 5IGMA 4F3IA 4O71A 5CQ4A 3U5LA 5C8GA 5HQ6A 4XY8A 2OUOA 4PCEA 2MJVB 4A9KA 5EWWA 4BW4A 5DBMA 4TU4A 4NQNA 5LKTA 5EA1A 5F5ZA 3MB4A 4OUFA 5HRWA 5F60A 4HXRA 4XUBA 4TS8A 5C7NA 5CQ7A 3O37A 4LR6A 2WP1A 3Q2EA 4NYXA 4UITA 5FE5A 4QSPA 5ENCA 4UIWA 4UYFB 5HM0A 2YDWA 2DATA 5FFVA 4NUDA 2NXBA 4LZRA 3O36A 4BW3A 5I7YA 4UYEA 3JVMA 5FFWA 4A9OA 4QZSA 5ENBA 4YBSA 4HXSA 4YAXA 4UIZA 4XY9A 4ALHA 4CLBA 4O72A 4A9JA 3O33A 4TQNA 4QSWA 4NRCA 4LYIA 5H1VA 4MR4A 3SVHA 5CUAA 3U5PA 4MR5A 5EM3A 5A5PA 5FFYA 5D24A 5DW2A 4CUTA 3O34A 5DYUA 4IOOA 5EICA 5BT3A 5JWMA 5E7DA 2I7KA 5DFBA 4J3IA 5HJCA 4NRAA 5L96A 3MUKA 4MENA 5F1HA 5F63A 4A9HA 5EPRA 4ZW1A 2RI7A 5I83A 5E9LA 5FE0A 4YK0A 2DVQA 2F6JA 4QR5A 2RNYA 4HXLA 5CRMA 5H85A 4PTBA 5AD3A 4QEWA 1E6IA 5E9VA 3DAIA 5F36A 4BJXA 4YYIA 4N3WA 3G0JA 5LVRA 4YABA 5IGLA 4LZSA 5D3JA 3JVKA 3I3JA 4ZQLA 5G4RA 4CUUA 3QZSA 4KCXA 4J0RA 4PY6A 4QY4A 5K29A 5FG4A 5E3DA 3S91A 5BT4A 5C4QA 5E9YA 4HXMA 2E7NA 5G4SA 5CGPA 4YY6A 4XYAA 3LXJA 5EV9A 5D0CA 5D3NA 3P1FA 5ETBA 4LDFA 4BW2A 4LZ2A 4QSRA 3QZVA 4QC1A 5CQAA 5LKZA 2FSAA 4UIUA 4A9NA 3UW9A 5F3AA 4DONA 2DVVA 5HRXA 4NYVA 4YH4A 2R10A 3K2JA 4PS5A 5EWHA 3U5JA 4TU6A 5D3TA 5FBXA 5HQ7A 5D7XA 5LJ2A 5ENEA 5E9KA 4OGIA 5E73A 5HRVA 4CUQA 4NR7A 4TT4A 5E74A 3JVJA 5CQ8A 3IU6A 2N9GA 5ETDA 5HEMA 4O76A 4NYWA 4QSSA 4KV4A 4A9FA 4X2IA 5DFDA 5IGKA 5FE9A 3UVWA 4O7AA 5D3HA 2DKWA 4UYDA 5L97A 3O35A 5FE3A 4N4GA 5HQ5A 5FG5A 2DVSA 4NUEA 4Y03A 5CQ6A 5FE1A 5L8UA 5KTXA 5KTUA 4IR4A 4A9MA 3S92A 4YYKA 4YBTA 4NR4A 4YYMA 5HFQA 4Z1SA 1X0JA 4HBYA 5CUEA 5DLZA 3P1DA 5IBNA 5FE2A 5A5OA 5EI4A 5I89A 4O74A 5E9MA 3FKMX 5I7XA 1EQFA 5TCMA 2LSPB 4BW1A 4CFLA 4QB3A 4OGJA 5A7CA 5FE6A 4NUCA 5HLSA 3D7CA 5ENHA 4YYHA 3LQIA 4MEQA 4NQMA 3MQMA 4O78A 3AQAA 5CRZA 5CUGA 2D82A 3AADA 5LKXA 4GPJA 3G0LA 4NR9A 3P5OA 4QUTA 4YC9A 3TLPA 4TT6A 3U5KA 3ONIA 5E0RA 4IOQA 2YEMA 3UV5A 4HBWA 4XUAA 5C87A 4N4HA 3SVGA 4C67A 5CUCA 4A9IA
chains in the Genus database with same CATH superfamily
4QSTA 2E3KA 4PCIA 5D26A 5LVQA 5ENJA 3U5OA 4NR8A 4LYSA 5LJ1A 3JVLA 4QR3A 4NR5A 5DY7A 4YYGA 5KTWA 3SVFA 5H1TA 3U5NA 4Z6HA 5CQ5A 3MB3A 2G4AA 5AMFA 5BT5A 4WHUA 4AKNA 3U5MA 4ALGA 4YYNA 2OO1A 4HXOA 5JI8A 4YY4A 4WIVA 5H1UA 4QNSA 5A5RA 5HELA 4TT2A 4FLPA 4CFKA 4NS5A 4QR4A 5CS8A 2L84A 5CP5A 5A83A 5A5NA 1WUGA 5I86A 5L8TA 4Q0NA 5COIA 5CUBA 5KU3A 3IU5A 5FH8A 3LJWA 2RNWA 4A9EA 5CFWA 5EK9A 4QEUA 5C85A 4TTEA 3P1CA 5EP7A 5EU1A 5ENFA 5EWCA 3RCWA 5HFRA 4HBXA 4YYDA 2L85A 4KV1A 3UVXA 4YATA 5ACYA 4PKLA 4IR5A 5FE7A 5CU8A 4O7BA 5I29A 5F25A 3LQHA 4A9LA 5DLXA 5F61A 2I8NA 4MEPA 4QC3A 5CQTA 4YADA 3P1EA 4YYJA 5L98A 3UVYA 4BHWA 4LC2A 5FG6A 3VKGA 4O7EA 4IORA 5CY9A 4NRBA 5F62A 3UV4A 1ZS5A 2F6NA 2YW5A 5AD2A 2DVRA 2YELA 2H60A 4IR3A 5CTLA 5CUDA 5DKDA 4UYHA 3MULA 4CURA 3Q2FA 4HXNA 5D3LA 3UVDA 4YBMA 1JSPB 4QUUA 4QYLA 4QBMA 5LUUA 4RVRA 4IR6A 4C66A 5D3SA 4O70A 4TYLA 4LRGA 5CPEA 3LQJA 4HXKA 4YH3A 4N4IA 2R0YA 5I40A 5LJ0A 4UYFA 2D9EA 5D3RA 2L5EA 4Z6IA 2EJNA 3NXBA 5FE4A 2OSSA 3HMFA 4J0SA 5D25A 5FDZA 5ENGA 5DX4A 2YYNA 5DYXA 5EISA 4Q0OA 3UV2A 4AKIA 1WUMA 4UIYA 4O77A 2R0SA 5FB0A 5IGNA 4QYDA 5D3PA 5EGUA 2RFJA 4UYGA 5DKCA 5EPBA 3ZYUA 5J0DA 1JM4B 4QSQA 5EQ1A 5A85A 2R0VA 5F2PA 4MEOA 5HCLA 3HMHA 5I1QA 1PUOA 2YEKA 5C89A 4TZ8A 4UIXA 3DWYA 2RNXA 2YQDA 5CZGA 4LYWA 3D1DA 3GG3A 4NXJA 5DW1A 5EVAA 5KHMA 5FE8A 5L99A 2RO1A 4O7CA 5IG6A 2DWWA 4HXPA 5ENIA 4NR6A 4QSVA 4MR6A 5I88A 5DKHA 4CL9A 4ZC9A 5E3GA 5A82A 5A5QA 4QSUA 5II1A 1F68A 4TZ2A 5FB1A 4CUSA 4UIVA 4HBVA 3MXFA 4O7FA 4QSXA 5FH7A 5FH6A 3HMEA 4J1PA 5TB6A 4O75A 5AMEA 2E7OA 2RS9B 5KO4A 5LKUA 4N4FA 2KTBB 5I80A 4Z93A 5EWVA 5HENA 5A5SA 5E9IA 4QEVA 5F1LA 5DFCA 2GRCA 5DYCA 4Z1QA 2WP2A 5A81A 1N72A 4WHWA 5CQ3A 5IIDA 5EWDA 5EPSA 4CUPA 4MR3A 4E96A 3QZTA 5DYAA 5II2A 5IGMA 4F3IA 4O71A 5CQ4A 3U5LA 5C8GA 5HQ6A 4XY8A 2OUOA 4PCEA 2MJVB 4A9KA 5EWWA 4BW4A 3D1BA 5DBMA 4TU4A 4NQNA 5LKTA 5EA1A 5F5ZA 3MB4A 4OUFA 5HRWA 5F60A 4HXRA 4XUBA 4TS8A 5C7NA 5CQ7A 3O37A 4LR6A 2WP1A 3Q2EA 4NYXA 4UITA 5FE5A 4QSPA 5ENCA 4UIWA 4UYFB 5HM0A 2YDWA 2DATA 5FFVA 4NUDA 2NXBA 4LZRA 3O36A 4BW3A 5I7YA 4UYEA 3JVMA 5FFWA 4A9OA 4QZSA 5ENBA 4YBSA 4HXSA 4YAXA 3VKHA 4UIZA 4XY9A 4ALHA 4CLBA 4O72A 4A9JA 3O33A 4TQNA 4QSWA 4NRCA 4LYIA 5H1VA 4MR4A 3SVHA 5CUAA 3U5PA 4AKHA 4MR5A 5EM3A 5A5PA 5FFYA 5D24A 5DW2A 4CUTA 3O34A 4AI6A 5DYUA 4IOOA 5EICA 5BT3A 5JWMA 5E7DA 2I7KA 5DFBA 4J3IA 5HJCA 4NRAA 5L96A 3MUKA 4MENA 5F1HA 5F63A 4A9HA 5EPRA 4ZW1A 2RI7A 5I83A 5E9LA 5FE0A 4YK0A 2DVQA 2F6JA 4QR5A 2RNYA 4HXLA 5CRMA 5H85A 4PTBA 5AD3A 4QEWA 1E6IA 5E9VA 3DAIA 5F36A 4BJXA 1ZKRA 4YYIA 4N3WA 3G0JA 5LVRA 4YABA 5IGLA 4LZSA 5D3JA 3JVKA 3I3JA 4ZQLA 5G4RA 4CUUA 3QZSA 4KCXA 4J0RA 4PY6A 4QY4A 4AKGA 5K29A 5FG4A 5E3DA 3S91A 5BT4A 5C4QA 5E9YA 4HXMA 2E7NA 5G4SA 5CGPA 4YY6A 4XYAA 3LXJA 5EV9A 5D0CA 5D3NA 3P1FA 5ETBA 4LDFA 4BW2A 4LZ2A 4QSRA 3QZVA 4QC1A 5CQAA 5LKZA 2FSAA 4UIUA 4A9NA 3UW9A 5F3AA 4DONA 2DVVA 5HRXA 4NYVA 4YH4A 2R10A 3K2JA 4PS5A 5EWHA 3U5JA 4TU6A 5D3TA 5FBXA 5HQ7A 5D7XA 5LJ2A 5ENEA 5E9KA 4OGIA 5E73A 5HRVA 4CUQA 4NR7A 4TT4A 5E74A 3JVJA 5CQ8A 3IU6A 2N9GA 5ETDA 5HEMA 4O76A 4NYWA 4QSSA 4KV4A 4A9FA 4X2IA 5DFDA 5IGKA 5FE9A 3UVWA 4O7AA 5D3HA 2DKWA 4UYDA 5L97A 3O35A 5FE3A 4N4GA 5HQ5A 5FG5A 2DVSA 4NUEA 4Y03A 5CQ6A 5FE1A 5L8UA 5KTXA 5KTUA 4IR4A 4A9MA 3S92A 4YYKA 4YBTA 4NR4A 4YYMA 5HFQA 4Z1SA 1X0JA 4HBYA 5CUEA 5DLZA 3P1DA 5IBNA 5FE2A 5A5OA 5EI4A 5I89A 4O74A 5E9MA 3FKMX 5I7XA 1EQFA 5TCMA 2LSPB 4BW1A 4CFLA 4QB3A 4OGJA 5A7CA 5FE6A 4NUCA 5HLSA 3D7CA 5ENHA 4YYHA 3LQIA 4MEQA 4NQMA 3MQMA 4O78A 3AQAA 5CRZA 3ERRA 5CUGA 2D82A 3AADA 5LKXA 4GPJA 3G0LA 4NR9A 3P5OA 4QUTA 4YC9A 3TLPA 4TT6A 3U5KA 3ONIA 5E0RA 4IOQA 2YEMA 3UV5A 4HBWA 4XUAA 5C87A 4N4HA 3SVGA 4C67A 5CUCA 4A9IA
chains in the Genus database with same CATH topology
4QSTA 2E3KA 4PCIA 5D26A 5LVQA 5ENJA 3U5OA 4NR8A 4LYSA 5LJ1A 3JVLA 4QR3A 4NR5A 5DY7A 4YYGA 5KTWA 3SVFA 5H1TA 3U5NA 4Z6HA 5CQ5A 3MB3A 2G4AA 5AMFA 5BT5A 4WHUA 4AKNA 3U5MA 4ALGA 4YYNA 2OO1A 4HXOA 5JI8A 4YY4A 4WIVA 5H1UA 4QNSA 5A5RA 5HELA 4TT2A 4FLPA 4CFKA 4NS5A 4QR4A 5CS8A 2L84A 5CP5A 5A83A 5A5NA 1WUGA 5I86A 5L8TA 4Q0NA 5COIA 5CUBA 5KU3A 3IU5A 5FH8A 3LJWA 2RNWA 4A9EA 5CFWA 5EK9A 4QEUA 5C85A 4TTEA 3P1CA 5EP7A 5EU1A 5ENFA 5EWCA 3RCWA 5HFRA 4HBXA 4YYDA 2L85A 4KV1A 3UVXA 4YATA 5ACYA 4PKLA 4IR5A 5FE7A 5CU8A 4O7BA 5I29A 5F25A 3LQHA 4A9LA 5DLXA 5F61A 2I8NA 4MEPA 4QC3A 5CQTA 4YADA 3P1EA 4YYJA 5L98A 3UVYA 4BHWA 4LC2A 5FG6A 4O7EA 4IORA 5CY9A 4NRBA 5F62A 3UV4A 1ZS5A 2F6NA 2YW5A 5AD2A 2DVRA 2YELA 2H60A 4IR3A 5CTLA 5CUDA 5DKDA 4UYHA 3MULA 4CURA 3Q2FA 4HXNA 5D3LA 3UVDA 4YBMA 1JSPB 4QUUA 4QYLA 4QBMA 5LUUA 4RVRA 4IR6A 4C66A 5D3SA 4O70A 4TYLA 4LRGA 5CPEA 3LQJA 4HXKA 4YH3A 4N4IA 2R0YA 5I40A 5LJ0A 4UYFA 2D9EA 5D3RA 2L5EA 4Z6IA 3NXBA 5FE4A 2OSSA 3HMFA 4J0SA 5D25A 5FDZA 5ENGA 5DX4A 2YYNA 5DYXA 5EISA 4Q0OA 3UV2A 1WUMA 4UIYA 4O77A 2R0SA 5FB0A 5IGNA 4QYDA 5D3PA 5EGUA 2RFJA 4UYGA 5DKCA 5EPBA 3ZYUA 5J0DA 1JM4B 4QSQA 5EQ1A 5A85A 2R0VA 5F2PA 4MEOA 5HCLA 3HMHA 5I1QA 2YEKA 5C89A 4TZ8A 4UIXA 3DWYA 2RNXA 2YQDA 5CZGA 4LYWA 5EVAA 3GG3A 4NXJA 5DW1A 5KHMA 5FE8A 5L99A 2RO1A 4O7CA 5IG6A 2DWWA 4HXPA 5ENIA 4NR6A 4QSVA 4MR6A 5I88A 5DKHA 4CL9A 4ZC9A 5E3GA 5A82A 5A5QA 4QSUA 5II1A 1F68A 4TZ2A 5FB1A 4CUSA 4UIVA 4HBVA 3MXFA 4O7FA 4QSXA 5FH7A 5FH6A 3HMEA 4J1PA 5TB6A 4O75A 5AMEA 2E7OA 2RS9B 5KO4A 5LKUA 4N4FA 2KTBB 5I80A 4Z93A 5EWVA 5HENA 5A5SA 5E9IA 4QEVA 5F1LA 5DFCA 2GRCA 5DYCA 4Z1QA 2WP2A 5A81A 1N72A 4WHWA 5CQ3A 5IIDA 5EWDA 5EPSA 4CUPA 4MR3A 4E96A 3QZTA 5DYAA 5II2A 5IGMA 4F3IA 4O71A 5CQ4A 3U5LA 5C8GA 5HQ6A 4XY8A 2OUOA 4PCEA 2MJVB 4A9KA 5EWWA 4BW4A 5DBMA 4TU4A 4NQNA 5LKTA 5EA1A 5F5ZA 3MB4A 4OUFA 5HRWA 5F60A 4HXRA 4XUBA 4TS8A 5C7NA 5CQ7A 3O37A 4LR6A 2WP1A 3Q2EA 4NYXA 4UITA 5FE5A 4QSPA 5ENCA 4UIWA 4UYFB 5HM0A 2YDWA 2DATA 5FFVA 4NUDA 2NXBA 4LZRA 3O36A 4BW3A 5I7YA 4UYEA 3JVMA 5FFWA 4A9OA 4QZSA 5ENBA 4YBSA 4HXSA 4YAXA 4UIZA 4XY9A 4ALHA 4CLBA 4O72A 4A9JA 3O33A 4TQNA 4QSWA 4NRCA 4LYIA 5H1VA 4MR4A 3SVHA 5CUAA 3U5PA 4MR5A 5EM3A 5A5PA 5FFYA 5D24A 5DW2A 4CUTA 3O34A 5DYUA 4IOOA 5EICA 5BT3A 5JWMA 5E7DA 2I7KA 5DFBA 4J3IA 5HJCA 4NRAA 5L96A 3MUKA 4MENA 5F1HA 5F63A 4A9HA 5EPRA 4ZW1A 2RI7A 5I83A 5E9LA 5FE0A 4YK0A 2DVQA 2F6JA 4QR5A 2RNYA 4HXLA 5CRMA 5H85A 4PTBA 5AD3A 4QEWA 1E6IA 5E9VA 3DAIA 5F36A 4BJXA 4YYIA 4N3WA 3G0JA 5LVRA 4YABA 5IGLA 4LZSA 5D3JA 3JVKA 3I3JA 4ZQLA 5G4RA 4CUUA 3QZSA 4KCXA 4J0RA 4PY6A 4QY4A 5K29A 5FG4A 5E3DA 3S91A 5BT4A 5C4QA 5E9YA 4HXMA 2E7NA 5G4SA 5CGPA 4YY6A 4XYAA 3LXJA 5EV9A 5D0CA 5D3NA 3P1FA 5ETBA 4LDFA 4BW2A 4LZ2A 4QSRA 3QZVA 4QC1A 5CQAA 5LKZA 2FSAA 4UIUA 4A9NA 3UW9A 5F3AA 4DONA 2DVVA 5HRXA 4NYVA 4YH4A 2R10A 3K2JA 4PS5A 5EWHA 3U5JA 4TU6A 5D3TA 5FBXA 5HQ7A 5D7XA 5LJ2A 5ENEA 5E9KA 4OGIA 5E73A 5HRVA 4CUQA 4NR7A 4TT4A 5E74A 3JVJA 5CQ8A 3IU6A 2N9GA 5ETDA 5HEMA 4O76A 4NYWA 4QSSA 4KV4A 4A9FA 4X2IA 5DFDA 5IGKA 5FE9A 3UVWA 4O7AA 5D3HA 2DKWA 4UYDA 5L97A 3O35A 5FE3A 4N4GA 5HQ5A 5FG5A 2DVSA 4NUEA 4Y03A 5CQ6A 5FE1A 5L8UA 5KTXA 5KTUA 4IR4A 4A9MA 3S92A 4YYKA 4YBTA 4NR4A 4YYMA 5HFQA 4Z1SA 1X0JA 4HBYA 5CUEA 5DLZA 3P1DA 5IBNA 5FE2A 5A5OA 5EI4A 5I89A 4O74A 5E9MA 3FKMX 5I7XA 1EQFA 5TCMA 2LSPB 4BW1A 4CFLA 4QB3A 4OGJA 5A7CA 5FE6A 4NUCA 5HLSA 3D7CA 5ENHA 4YYHA 3LQIA 4MEQA 4NQMA 3MQMA 4O78A 3AQAA 5CRZA 5CUGA 2D82A 3AADA 5LKXA 4GPJA 3G0LA 4NR9A 3P5OA 4QUTA 4YC9A 3TLPA 4TT6A 3U5KA 3ONIA 5E0RA 4IOQA 2YEMA 3UV5A 4HBWA 4XUAA 5C87A 4N4HA 3SVGA 4C67A 5CUCA 4A9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QST A;  2E3K A;  4PCI A;  5D26 A;  5LVQ A;  5ENJ A;  3U5O A;  4NR8 A;  4LYS A;  5LJ1 A;  3JVL A;  4QR3 A;  4NR5 A;  5DY7 A;  4YYG A;  5KTW A;  3SVF A;  5H1T A;  3U5N A;  4Z6H A;  5CQ5 A;  3MB3 A;  2G4A A;  5AMF A;  5BT5 A;  4WHU A;  4AKN A;  3U5M A;  4ALG A;  4YYN A;  2OO1 A;  4HXO A;  5JI8 A;  4YY4 A;  4WIV A;  5H1U A;  4QNS A;  5A5R A;  5HEL A;  4TT2 A;  4FLP A;  4CFK A;  4NS5 A;  4QR4 A;  5CS8 A;  2L84 A;  5CP5 A;  5A83 A;  5A5N A;  1WUG A;  5I86 A;  5L8T A;  4Q0N A;  5COI A;  5CUB A;  5KU3 A;  3IU5 A;  5FH8 A;  3LJW A;  2RNW A;  4A9E A;  5CFW A;  5EK9 A;  4QEU A;  5C85 A;  4TTE A;  3P1C A;  5EP7 A;  5EU1 A;  5ENF A;  5EWC A;  3RCW A;  5HFR A;  4HBX A;  4YYD A;  2L85 A;  4KV1 A;  3UVX A;  4YAT A;  5ACY A;  4PKL A;  4IR5 A;  5FE7 A;  5CU8 A;  4O7B A;  5I29 A;  5F25 A;  3LQH A;  4A9L A;  5DLX A;  5F61 A;  2I8N A;  4MEP A;  4QC3 A;  5CQT A;  4YAD A;  3P1E A;  4YYJ A;  5L98 A;  3UVY A;  4BHW A;  4LC2 A;  5FG6 A;  4O7E A;  4IOR A;  5CY9 A;  4NRB A;  5F62 A;  3UV4 A;  1ZS5 A;  2F6N A;  2YW5 A;  5AD2 A;  2DVR A;  2YEL A;  2H60 A;  4IR3 A;  5CTL A;  5CUD A;  5DKD A;  4UYH A;  3MUL A;  4CUR A;  3Q2F A;  4HXN A;  5D3L A;  3UVD A;  4YBM A;  1JSP B;  4QUU A;  4QYL A;  4QBM A;  5LUU A;  4RVR A;  4IR6 A;  4C66 A;  5D3S A;  4O70 A;  4TYL A;  4LRG A;  5CPE A;  3LQJ A;  4HXK A;  4YH3 A;  4N4I A;  2R0Y A;  5I40 A;  5LJ0 A;  4UYF A;  2D9E A;  5D3R A;  2L5E A;  4Z6I A;  3NXB A;  5FE4 A;  2OSS A;  3HMF A;  4J0S A;  5D25 A;  5FDZ A;  5ENG A;  5DX4 A;  2YYN A;  5DYX A;  5EIS A;  4Q0O A;  3UV2 A;  1WUM A;  4UIY A;  4O77 A;  2R0S A;  5FB0 A;  5IGN A;  4QYD A;  5D3P A;  5EGU A;  2RFJ A;  4UYG A;  5DKC A;  5EPB A;  3ZYU A;  5J0D A;  1JM4 B;  4QSQ A;  5EQ1 A;  5A85 A;  2R0V A;  5F2P A;  4MEO A;  5HCL A;  3HMH A;  5I1Q A;  2YEK A;  5C89 A;  4TZ8 A;  4UIX A;  3DWY A;  2RNX A;  2YQD A;  5CZG A;  4LYW A;  5EVA A;  3GG3 A;  4NXJ A;  5DW1 A;  5KHM A;  5FE8 A;  5L99 A;  2RO1 A;  4O7C A;  5IG6 A;  2DWW A;  4HXP A;  5ENI A;  4NR6 A;  4QSV A;  4MR6 A;  5I88 A;  5DKH A;  4CL9 A;  4ZC9 A;  5E3G A;  5A82 A;  5A5Q A;  4QSU A;  5II1 A;  1F68 A;  4TZ2 A;  5FB1 A;  4CUS A;  4UIV A;  4HBV A;  3MXF A;  4O7F A;  4QSX A;  5FH7 A;  5FH6 A;  3HME A;  4J1P A;  5TB6 A;  4O75 A;  5AME A;  2E7O A;  2RS9 B;  5KO4 A;  5LKU A;  4N4F A;  2KTB B;  5I80 A;  4Z93 A;  5EWV A;  5HEN A;  5A5S A;  5E9I A;  4QEV A;  5F1L A;  5DFC A;  2GRC A;  5DYC A;  4Z1Q A;  2WP2 A;  5A81 A;  1N72 A;  4WHW A;  5CQ3 A;  5IID A;  5EWD A;  5EPS A;  4CUP A;  4MR3 A;  4E96 A;  3QZT A;  5DYA A;  5II2 A;  5IGM A;  4F3I A;  4O71 A;  5CQ4 A;  3U5L A;  5C8G A;  5HQ6 A;  4XY8 A;  2OUO A;  4PCE A;  2MJV B;  4A9K A;  5EWW A;  4BW4 A;  5DBM A;  4TU4 A;  4NQN A;  5LKT A;  5EA1 A;  5F5Z A;  3MB4 A;  4OUF A;  5HRW A;  5F60 A;  4HXR A;  4XUB A;  4TS8 A;  5C7N A;  5CQ7 A;  3O37 A;  4LR6 A;  2WP1 A;  3Q2E A;  4NYX A;  4UIT A;  5FE5 A;  4QSP A;  5ENC A;  4UIW A;  4UYF B;  5HM0 A;  2YDW A;  2DAT A;  5FFV A;  4NUD A;  2NXB A;  4LZR A;  3O36 A;  4BW3 A;  5I7Y A;  4UYE A;  3JVM A;  5FFW A;  4A9O A;  4QZS A;  5ENB A;  4YBS A;  4HXS A;  4YAX A;  4UIZ A;  4XY9 A;  4ALH A;  4CLB A;  4O72 A;  4A9J A;  3O33 A;  4TQN A;  4QSW A;  4NRC A;  4LYI A;  5H1V A;  4MR4 A;  3SVH A;  5CUA A;  3U5P A;  4MR5 A;  5EM3 A;  5A5P A;  5FFY A;  5D24 A;  5DW2 A;  4CUT A;  3O34 A;  5DYU A;  4IOO A;  5EIC A;  5BT3 A;  5JWM A;  5E7D A;  2I7K A;  5DFB A;  4J3I A;  5HJC A;  4NRA A;  5L96 A;  3MUK A;  4MEN A;  5F1H A;  5F63 A;  4A9H A;  5EPR A;  4ZW1 A;  2RI7 A;  5I83 A;  5E9L A;  5FE0 A;  4YK0 A;  2DVQ A;  2F6J A;  4QR5 A;  2RNY A;  4HXL A;  5CRM A;  5H85 A;  4PTB A;  5AD3 A;  4QEW A;  1E6I A;  5E9V A;  3DAI A;  5F36 A;  4BJX A;  4YYI A;  4N3W A;  3G0J A;  5LVR A;  4YAB A;  5IGL A;  4LZS A;  5D3J A;  3JVK A;  3I3J A;  4ZQL A;  5G4R A;  4CUU A;  3QZS A;  4KCX A;  4J0R A;  4PY6 A;  4QY4 A;  5K29 A;  5FG4 A;  5E3D A;  3S91 A;  5BT4 A;  5C4Q A;  5E9Y A;  4HXM A;  2E7N A;  5G4S A;  5CGP A;  4YY6 A;  4XYA A;  3LXJ A;  5EV9 A;  5D0C A;  5D3N A;  3P1F A;  5ETB A;  4LDF A;  4BW2 A;  4LZ2 A;  4QSR A;  3QZV A;  4QC1 A;  5CQA A;  5LKZ A;  2FSA A;  4UIU A;  4A9N A;  3UW9 A;  5F3A A;  4DON A;  2DVV A;  5HRX A;  4NYV A;  4YH4 A;  2R10 A;  3K2J A;  4PS5 A;  5EWH A;  3U5J A;  4TU6 A;  5D3T A;  5FBX A;  5HQ7 A;  5D7X A;  5LJ2 A;  5ENE A;  5E9K A;  4OGI A;  5E73 A;  5HRV A;  4CUQ A;  4NR7 A;  4TT4 A;  5E74 A;  3JVJ A;  5CQ8 A;  3IU6 A;  2N9G A;  5ETD A;  5HEM A;  4O76 A;  4NYW A;  4QSS A;  4KV4 A;  4A9F A;  4X2I A;  5DFD A;  5IGK A;  5FE9 A;  3UVW A;  4O7A A;  5D3H A;  2DKW A;  4UYD A;  5L97 A;  3O35 A;  5FE3 A;  4N4G A;  5HQ5 A;  5FG5 A;  2DVS A;  4NUE A;  4Y03 A;  5CQ6 A;  5FE1 A;  5L8U A;  5KTX A;  5KTU A;  4IR4 A;  4A9M A;  3S92 A;  4YYK A;  4YBT A;  4NR4 A;  4YYM A;  5HFQ A;  4Z1S A;  1X0J A;  4HBY A;  5CUE A;  5DLZ A;  3P1D A;  5IBN A;  5FE2 A;  5A5O A;  5EI4 A;  5I89 A;  4O74 A;  5E9M A;  3FKM X;  5I7X A;  1EQF A;  5TCM A;  2LSP B;  4BW1 A;  4CFL A;  4QB3 A;  4OGJ A;  5A7C A;  5FE6 A;  4NUC A;  5HLS A;  3D7C A;  5ENH A;  4YYH A;  3LQI A;  4MEQ A;  4NQM A;  3MQM A;  4O78 A;  3AQA A;  5CRZ A;  5CUG A;  2D82 A;  3AAD A;  5LKX A;  4GPJ A;  3G0L A;  4NR9 A;  3P5O A;  4QUT A;  4YC9 A;  3TLP A;  4TT6 A;  3U5K A;  3ONI A;  5E0R A;  4IOQ A;  2YEM A;  3UV5 A;  4HBW A;  4XUA A;  5C87 A;  4N4H A;  3SVG A;  4C67 A;  5CUC A;  4A9I A; 
#chains in the Genus database with same CATH topology
 4QST A;  2E3K A;  4PCI A;  5D26 A;  5LVQ A;  5ENJ A;  3U5O A;  4NR8 A;  4LYS A;  5LJ1 A;  3JVL A;  4QR3 A;  4NR5 A;  5DY7 A;  4YYG A;  5KTW A;  3SVF A;  5H1T A;  3U5N A;  4Z6H A;  5CQ5 A;  3MB3 A;  2G4A A;  5AMF A;  5BT5 A;  4WHU A;  4AKN A;  3U5M A;  4ALG A;  4YYN A;  2OO1 A;  4HXO A;  5JI8 A;  4YY4 A;  4WIV A;  5H1U A;  4QNS A;  5A5R A;  5HEL A;  4TT2 A;  4FLP A;  4CFK A;  4NS5 A;  4QR4 A;  5CS8 A;  2L84 A;  5CP5 A;  5A83 A;  5A5N A;  1WUG A;  5I86 A;  5L8T A;  4Q0N A;  5COI A;  5CUB A;  5KU3 A;  3IU5 A;  5FH8 A;  3LJW A;  2RNW A;  4A9E A;  5CFW A;  5EK9 A;  4QEU A;  5C85 A;  4TTE A;  3P1C A;  5EP7 A;  5EU1 A;  5ENF A;  5EWC A;  3RCW A;  5HFR A;  4HBX A;  4YYD A;  2L85 A;  4KV1 A;  3UVX A;  4YAT A;  5ACY A;  4PKL A;  4IR5 A;  5FE7 A;  5CU8 A;  4O7B A;  5I29 A;  5F25 A;  3LQH A;  4A9L A;  5DLX A;  5F61 A;  2I8N A;  4MEP A;  4QC3 A;  5CQT A;  4YAD A;  3P1E A;  4YYJ A;  5L98 A;  3UVY A;  4BHW A;  4LC2 A;  5FG6 A;  3VKG A;  4O7E A;  4IOR A;  5CY9 A;  4NRB A;  5F62 A;  3UV4 A;  1ZS5 A;  2F6N A;  2YW5 A;  5AD2 A;  2DVR A;  2YEL A;  2H60 A;  4IR3 A;  5CTL A;  5CUD A;  5DKD A;  4UYH A;  3MUL A;  4CUR A;  3Q2F A;  4HXN A;  5D3L A;  3UVD A;  4YBM A;  1JSP B;  4QUU A;  4QYL A;  4QBM A;  5LUU A;  4RVR A;  4IR6 A;  4C66 A;  5D3S A;  4O70 A;  4TYL A;  4LRG A;  5CPE A;  3LQJ A;  4HXK A;  4YH3 A;  4N4I A;  2R0Y A;  5I40 A;  5LJ0 A;  4UYF A;  2D9E A;  5D3R A;  2L5E A;  4Z6I A;  2EJN A;  3NXB A;  5FE4 A;  2OSS A;  3HMF A;  4J0S A;  5D25 A;  5FDZ A;  5ENG A;  5DX4 A;  2YYN A;  5DYX A;  5EIS A;  4Q0O A;  3UV2 A;  4AKI A;  1WUM A;  4UIY A;  4O77 A;  2R0S A;  5FB0 A;  5IGN A;  4QYD A;  5D3P A;  5EGU A;  2RFJ A;  4UYG A;  5DKC A;  5EPB A;  3ZYU A;  5J0D A;  1JM4 B;  4QSQ A;  5EQ1 A;  5A85 A;  2R0V A;  5F2P A;  4MEO A;  5HCL A;  3HMH A;  5I1Q A;  1PUO A;  2YEK A;  5C89 A;  4TZ8 A;  4UIX A;  3DWY A;  2RNX A;  2YQD A;  5CZG A;  4LYW A;  3D1D A;  3GG3 A;  4NXJ A;  5DW1 A;  5EVA A;  5KHM A;  5FE8 A;  5L99 A;  2RO1 A;  4O7C A;  5IG6 A;  2DWW A;  4HXP A;  5ENI A;  4NR6 A;  4QSV A;  4MR6 A;  5I88 A;  5DKH A;  4CL9 A;  4ZC9 A;  5E3G A;  5A82 A;  5A5Q A;  4QSU A;  5II1 A;  1F68 A;  4TZ2 A;  5FB1 A;  4CUS A;  4UIV A;  4HBV A;  3MXF A;  4O7F A;  4QSX A;  5FH7 A;  5FH6 A;  3HME A;  4J1P A;  5TB6 A;  4O75 A;  5AME A;  2E7O A;  2RS9 B;  5KO4 A;  5LKU A;  4N4F A;  2KTB B;  5I80 A;  4Z93 A;  5EWV A;  5HEN A;  5A5S A;  5E9I A;  4QEV A;  5F1L A;  5DFC A;  2GRC A;  5DYC A;  4Z1Q A;  2WP2 A;  5A81 A;  1N72 A;  4WHW A;  5CQ3 A;  5IID A;  5EWD A;  5EPS A;  4CUP A;  4MR3 A;  4E96 A;  3QZT A;  5DYA A;  5II2 A;  5IGM A;  4F3I A;  4O71 A;  5CQ4 A;  3U5L A;  5C8G A;  5HQ6 A;  4XY8 A;  2OUO A;  4PCE A;  2MJV B;  4A9K A;  5EWW A;  4BW4 A;  3D1B A;  5DBM A;  4TU4 A;  4NQN A;  5LKT A;  5EA1 A;  5F5Z A;  3MB4 A;  4OUF A;  5HRW A;  5F60 A;  4HXR A;  4XUB A;  4TS8 A;  5C7N A;  5CQ7 A;  3O37 A;  4LR6 A;  2WP1 A;  3Q2E A;  4NYX A;  4UIT A;  5FE5 A;  4QSP A;  5ENC A;  4UIW A;  4UYF B;  5HM0 A;  2YDW A;  2DAT A;  5FFV A;  4NUD A;  2NXB A;  4LZR A;  3O36 A;  4BW3 A;  5I7Y A;  4UYE A;  3JVM A;  5FFW A;  4A9O A;  4QZS A;  5ENB A;  4YBS A;  4HXS A;  4YAX A;  3VKH A;  4UIZ A;  4XY9 A;  4ALH A;  4CLB A;  4O72 A;  4A9J A;  3O33 A;  4TQN A;  4QSW A;  4NRC A;  4LYI A;  5H1V A;  4MR4 A;  3SVH A;  5CUA A;  3U5P A;  4AKH A;  4MR5 A;  5EM3 A;  5A5P A;  5FFY A;  5D24 A;  5DW2 A;  4CUT A;  3O34 A;  4AI6 A;  5DYU A;  4IOO A;  5EIC A;  5BT3 A;  5JWM A;  5E7D A;  2I7K A;  5DFB A;  4J3I A;  5HJC A;  4NRA A;  5L96 A;  3MUK A;  4MEN A;  5F1H A;  5F63 A;  4A9H A;  5EPR A;  4ZW1 A;  2RI7 A;  5I83 A;  5E9L A;  5FE0 A;  4YK0 A;  2DVQ A;  2F6J A;  4QR5 A;  2RNY A;  4HXL A;  5CRM A;  5H85 A;  4PTB A;  5AD3 A;  4QEW A;  1E6I A;  5E9V A;  3DAI A;  5F36 A;  4BJX A;  1ZKR A;  4YYI A;  4N3W A;  3G0J A;  5LVR A;  4YAB A;  5IGL A;  4LZS A;  5D3J A;  3JVK A;  3I3J A;  4ZQL A;  5G4R A;  4CUU A;  3QZS A;  4KCX A;  4J0R A;  4PY6 A;  4QY4 A;  4AKG A;  5K29 A;  5FG4 A;  5E3D A;  3S91 A;  5BT4 A;  5C4Q A;  5E9Y A;  4HXM A;  2E7N A;  5G4S A;  5CGP A;  4YY6 A;  4XYA A;  3LXJ A;  5EV9 A;  5D0C A;  5D3N A;  3P1F A;  5ETB A;  4LDF A;  4BW2 A;  4LZ2 A;  4QSR A;  3QZV A;  4QC1 A;  5CQA A;  5LKZ A;  2FSA A;  4UIU A;  4A9N A;  3UW9 A;  5F3A A;  4DON A;  2DVV A;  5HRX A;  4NYV A;  4YH4 A;  2R10 A;  3K2J A;  4PS5 A;  5EWH A;  3U5J A;  4TU6 A;  5D3T A;  5FBX A;  5HQ7 A;  5D7X A;  5LJ2 A;  5ENE A;  5E9K A;  4OGI A;  5E73 A;  5HRV A;  4CUQ A;  4NR7 A;  4TT4 A;  5E74 A;  3JVJ A;  5CQ8 A;  3IU6 A;  2N9G A;  5ETD A;  5HEM A;  4O76 A;  4NYW A;  4QSS A;  4KV4 A;  4A9F A;  4X2I A;  5DFD A;  5IGK A;  5FE9 A;  3UVW A;  4O7A A;  5D3H A;  2DKW A;  4UYD A;  5L97 A;  3O35 A;  5FE3 A;  4N4G A;  5HQ5 A;  5FG5 A;  2DVS A;  4NUE A;  4Y03 A;  5CQ6 A;  5FE1 A;  5L8U A;  5KTX A;  5KTU A;  4IR4 A;  4A9M A;  3S92 A;  4YYK A;  4YBT A;  4NR4 A;  4YYM A;  5HFQ A;  4Z1S A;  1X0J A;  4HBY A;  5CUE A;  5DLZ A;  3P1D A;  5IBN A;  5FE2 A;  5A5O A;  5EI4 A;  5I89 A;  4O74 A;  5E9M A;  3FKM X;  5I7X A;  1EQF A;  5TCM A;  2LSP B;  4BW1 A;  4CFL A;  4QB3 A;  4OGJ A;  5A7C A;  5FE6 A;  4NUC A;  5HLS A;  3D7C A;  5ENH A;  4YYH A;  3LQI A;  4MEQ A;  4NQM A;  3MQM A;  4O78 A;  3AQA A;  5CRZ A;  3ERR A;  5CUG A;  2D82 A;  3AAD A;  5LKX A;  4GPJ A;  3G0L A;  4NR9 A;  3P5O A;  4QUT A;  4YC9 A;  3TLP A;  4TT6 A;  3U5K A;  3ONI A;  5E0R A;  4IOQ A;  2YEM A;  3UV5 A;  4HBW A;  4XUA A;  5C87 A;  4N4H A;  3SVG A;  4C67 A;  5CUC A;  4A9I A; 
#chains in the Genus database with same CATH homology
 4QST A;  2E3K A;  4PCI A;  5D26 A;  5LVQ A;  5ENJ A;  3U5O A;  4NR8 A;  4LYS A;  5LJ1 A;  3JVL A;  4QR3 A;  4NR5 A;  5DY7 A;  4YYG A;  5KTW A;  3SVF A;  5H1T A;  3U5N A;  4Z6H A;  5CQ5 A;  3MB3 A;  2G4A A;  5AMF A;  5BT5 A;  4WHU A;  4AKN A;  3U5M A;  4ALG A;  4YYN A;  2OO1 A;  4HXO A;  5JI8 A;  4YY4 A;  4WIV A;  5H1U A;  4QNS A;  5A5R A;  5HEL A;  4TT2 A;  4FLP A;  4CFK A;  4NS5 A;  4QR4 A;  5CS8 A;  2L84 A;  5CP5 A;  5A83 A;  5A5N A;  1WUG A;  5I86 A;  5L8T A;  4Q0N A;  5COI A;  5CUB A;  5KU3 A;  3IU5 A;  5FH8 A;  3LJW A;  2RNW A;  4A9E A;  5CFW A;  5EK9 A;  4QEU A;  5C85 A;  4TTE A;  3P1C A;  5EP7 A;  5EU1 A;  5ENF A;  5EWC A;  3RCW A;  5HFR A;  4HBX A;  4YYD A;  2L85 A;  4KV1 A;  3UVX A;  4YAT A;  5ACY A;  4PKL A;  4IR5 A;  5FE7 A;  5CU8 A;  4O7B A;  5I29 A;  5F25 A;  3LQH A;  4A9L A;  5DLX A;  5F61 A;  2I8N A;  4MEP A;  4QC3 A;  5CQT A;  4YAD A;  3P1E A;  4YYJ A;  5L98 A;  3UVY A;  4BHW A;  4LC2 A;  5FG6 A;  4O7E A;  4IOR A;  5CY9 A;  4NRB A;  5F62 A;  3UV4 A;  1ZS5 A;  2F6N A;  2YW5 A;  5AD2 A;  2DVR A;  2YEL A;  2H60 A;  4IR3 A;  5CTL A;  5CUD A;  5DKD A;  4UYH A;  3MUL A;  4CUR A;  3Q2F A;  4HXN A;  5D3L A;  3UVD A;  4YBM A;  1JSP B;  4QUU A;  4QYL A;  4QBM A;  5LUU A;  4RVR A;  4IR6 A;  4C66 A;  5D3S A;  4O70 A;  4TYL A;  4LRG A;  5CPE A;  3LQJ A;  4HXK A;  4YH3 A;  4N4I A;  2R0Y A;  5I40 A;  5LJ0 A;  4UYF A;  2D9E A;  5D3R A;  2L5E A;  4Z6I A;  3NXB A;  5FE4 A;  2OSS A;  3HMF A;  4J0S A;  5D25 A;  5FDZ A;  5ENG A;  5DX4 A;  2YYN A;  5DYX A;  5EIS A;  4Q0O A;  3UV2 A;  1WUM A;  4UIY A;  4O77 A;  2R0S A;  5FB0 A;  5IGN A;  4QYD A;  5D3P A;  5EGU A;  2RFJ A;  4UYG A;  5DKC A;  5EPB A;  3ZYU A;  5J0D A;  1JM4 B;  4QSQ A;  5EQ1 A;  5A85 A;  2R0V A;  5F2P A;  4MEO A;  5HCL A;  3HMH A;  5I1Q A;  2YEK A;  5C89 A;  4TZ8 A;  4UIX A;  3DWY A;  2RNX A;  2YQD A;  5CZG A;  4LYW A;  5EVA A;  3GG3 A;  4NXJ A;  5DW1 A;  5KHM A;  5FE8 A;  5L99 A;  2RO1 A;  4O7C A;  5IG6 A;  2DWW A;  4HXP A;  5ENI A;  4NR6 A;  4QSV A;  4MR6 A;  5I88 A;  5DKH A;  4CL9 A;  4ZC9 A;  5E3G A;  5A82 A;  5A5Q A;  4QSU A;  5II1 A;  1F68 A;  4TZ2 A;  5FB1 A;  4CUS A;  4UIV A;  4HBV A;  3MXF A;  4O7F A;  4QSX A;  5FH7 A;  5FH6 A;  3HME A;  4J1P A;  5TB6 A;  4O75 A;  5AME A;  2E7O A;  2RS9 B;  5KO4 A;  5LKU A;  4N4F A;  2KTB B;  5I80 A;  4Z93 A;  5EWV A;  5HEN A;  5A5S A;  5E9I A;  4QEV A;  5F1L A;  5DFC A;  2GRC A;  5DYC A;  4Z1Q A;  2WP2 A;  5A81 A;  1N72 A;  4WHW A;  5CQ3 A;  5IID A;  5EWD A;  5EPS A;  4CUP A;  4MR3 A;  4E96 A;  3QZT A;  5DYA A;  5II2 A;  5IGM A;  4F3I A;  4O71 A;  5CQ4 A;  3U5L A;  5C8G A;  5HQ6 A;  4XY8 A;  2OUO A;  4PCE A;  2MJV B;  4A9K A;  5EWW A;  4BW4 A;  5DBM A;  4TU4 A;  4NQN A;  5LKT A;  5EA1 A;  5F5Z A;  3MB4 A;  4OUF A;  5HRW A;  5F60 A;  4HXR A;  4XUB A;  4TS8 A;  5C7N A;  5CQ7 A;  3O37 A;  4LR6 A;  2WP1 A;  3Q2E A;  4NYX A;  4UIT A;  5FE5 A;  4QSP A;  5ENC A;  4UIW A;  4UYF B;  5HM0 A;  2YDW A;  2DAT A;  5FFV A;  4NUD A;  2NXB A;  4LZR A;  3O36 A;  4BW3 A;  5I7Y A;  4UYE A;  3JVM A;  5FFW A;  4A9O A;  4QZS A;  5ENB A;  4YBS A;  4HXS A;  4YAX A;  4UIZ A;  4XY9 A;  4ALH A;  4CLB A;  4O72 A;  4A9J A;  3O33 A;  4TQN A;  4QSW A;  4NRC A;  4LYI A;  5H1V A;  4MR4 A;  3SVH A;  5CUA A;  3U5P A;  4MR5 A;  5EM3 A;  5A5P A;  5FFY A;  5D24 A;  5DW2 A;  4CUT A;  3O34 A;  5DYU A;  4IOO A;  5EIC A;  5BT3 A;  5JWM A;  5E7D A;  2I7K A;  5DFB A;  4J3I A;  5HJC A;  4NRA A;  5L96 A;  3MUK A;  4MEN A;  5F1H A;  5F63 A;  4A9H A;  5EPR A;  4ZW1 A;  2RI7 A;  5I83 A;  5E9L A;  5FE0 A;  4YK0 A;  2DVQ A;  2F6J A;  4QR5 A;  2RNY A;  4HXL A;  5CRM A;  5H85 A;  4PTB A;  5AD3 A;  4QEW A;  1E6I A;  5E9V A;  3DAI A;  5F36 A;  4BJX A;  4YYI A;  4N3W A;  3G0J A;  5LVR A;  4YAB A;  5IGL A;  4LZS A;  5D3J A;  3JVK A;  3I3J A;  4ZQL A;  5G4R A;  4CUU A;  3QZS A;  4KCX A;  4J0R A;  4PY6 A;  4QY4 A;  5K29 A;  5FG4 A;  5E3D A;  3S91 A;  5BT4 A;  5C4Q A;  5E9Y A;  4HXM A;  2E7N A;  5G4S A;  5CGP A;  4YY6 A;  4XYA A;  3LXJ A;  5EV9 A;  5D0C A;  5D3N A;  3P1F A;  5ETB A;  4LDF A;  4BW2 A;  4LZ2 A;  4QSR A;  3QZV A;  4QC1 A;  5CQA A;  5LKZ A;  2FSA A;  4UIU A;  4A9N A;  3UW9 A;  5F3A A;  4DON A;  2DVV A;  5HRX A;  4NYV A;  4YH4 A;  2R10 A;  3K2J A;  4PS5 A;  5EWH A;  3U5J A;  4TU6 A;  5D3T A;  5FBX A;  5HQ7 A;  5D7X A;  5LJ2 A;  5ENE A;  5E9K A;  4OGI A;  5E73 A;  5HRV A;  4CUQ A;  4NR7 A;  4TT4 A;  5E74 A;  3JVJ A;  5CQ8 A;  3IU6 A;  2N9G A;  5ETD A;  5HEM A;  4O76 A;  4NYW A;  4QSS A;  4KV4 A;  4A9F A;  4X2I A;  5DFD A;  5IGK A;  5FE9 A;  3UVW A;  4O7A A;  5D3H A;  2DKW A;  4UYD A;  5L97 A;  3O35 A;  5FE3 A;  4N4G A;  5HQ5 A;  5FG5 A;  2DVS A;  4NUE A;  4Y03 A;  5CQ6 A;  5FE1 A;  5L8U A;  5KTX A;  5KTU A;  4IR4 A;  4A9M A;  3S92 A;  4YYK A;  4YBT A;  4NR4 A;  4YYM A;  5HFQ A;  4Z1S A;  1X0J A;  4HBY A;  5CUE A;  5DLZ A;  3P1D A;  5IBN A;  5FE2 A;  5A5O A;  5EI4 A;  5I89 A;  4O74 A;  5E9M A;  3FKM X;  5I7X A;  1EQF A;  5TCM A;  2LSP B;  4BW1 A;  4CFL A;  4QB3 A;  4OGJ A;  5A7C A;  5FE6 A;  4NUC A;  5HLS A;  3D7C A;  5ENH A;  4YYH A;  3LQI A;  4MEQ A;  4NQM A;  3MQM A;  4O78 A;  3AQA A;  5CRZ A;  5CUG A;  2D82 A;  3AAD A;  5LKX A;  4GPJ A;  3G0L A;  4NR9 A;  3P5O A;  4QUT A;  4YC9 A;  3TLP A;  4TT6 A;  3U5K A;  3ONI A;  5E0R A;  4IOQ A;  2YEM A;  3UV5 A;  4HBW A;  4XUA A;  5C87 A;  4N4H A;  3SVG A;  4C67 A;  5CUC A;  4A9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...