2DVRA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvrA00
4GPJA 5F36A 4A9IA 4CUUA 5FE1A 2DKWA 5E7DA 4QZSA 4OGIA 4C67A 2RFJA 5EPBA 5L8TA 4UIVA 4QEVA 1JM4B 4NR4A 2RNWA 3MB3A 5FE5A 5I83A 4NRAA 5IG6A 4QSTA 2OSSA 4Q0NA 5D3RA 4A9HA 4N4IA 1ZS5A 2YYNA 5F2PA 5LVRA 3TLPA 2R0SA 5EGUA 5JI8A 4NUDA 5DFBA 5HQ6A 4N4FA 4QEWA 3HMHA 5DLZA 5ENIA 4QNSA 4O77A 4QSQA 4IR3A 5FE7A 4A9OA 2R0VA 4QY4A 5D3TA 4MEOA 4QSRA 4NQMA 5DX4A 4QSPA 2KTBB 5CQ5A 3G0LA 5ENEA 3UVXA 4YK0A 4MR5A 4NUCA 2LSPB 3LQIA 3QZTA 4HXKA 4ZQLA 4IORA 4YYMA 4J0SA 4LYIA 4MEQA 5ENBA 5FE6A 4CUQA 4A9JA 5LKXA 3UVDA 4KCXA 4NR9A 4X2IA 4NYWA 4WHUA 4A9NA 1X0JA 4HBWA 4BJXA 5HFQA 4NUEA 3P5OA 4LC2A 5EWDA 5CUGA 2D9EA 4UIWA 3LQJA 4TTEA 5F63A 5FDZA 4QSVA 5H1VA 5H1UA 5BT5A 3UV5A 5CRMA 4WHWA 5EISA 4ZC9A 3GG3A 5FE0A 4YYGA 5I7YA 4YYKA 2I8NA 5DKHA 4TS8A 5FH8A 4YYJA 4NR8A 5DKDA 5HELA 4LDFA 4O72A 3U5OA 4UYEA 4IOOA 3O35A 5F5ZA 4NS5A 4QSSA 5EI4A 4A9MA 5D3HA 4UIZA 5L8UA 4NR5A 4AKNA 5I40A 4OUFA 4NRBA 4TZ2A 2RO1A 5H85A 5C4QA 3Q2EA 2OO1A 4HXLA 4LZ2A 3JVKA 4YY4A 4O75A 4XUAA 2DVSA 3HMEA 4C66A 4J3IA 5A83A 2E3KA 4QR3A 4A9LA 4HBYA 4PTBA 5FFWA 5L98A 5BT4A 5II2A 5EPSA 5FB1A 4HBXA 4BHWA 5I88A 5FH6A 5HENA 3FKMX 4NYVA 3AQAA 5A7CA 4UYFB 3SVHA 5L96A 3LQHA 4YBTA 1WUMA 5CGPA 3LXJA 4BW2A 5A5SA 2L5EA 4HBVA 3UV2A 4CUSA 2RI7A 4LRGA 5EP7A 4IR5A 5FG4A 4NQNA 4XY8A 2R10A 4MENA 4E96A 5BT3A 5C85A 3S91A 4N3WA 5J0DA 3IU6A 4HXMA 4QC1A 1F68A 3DAIA 5CFWA 5HJCA 5KTXA 1JSPB 4PCEA 3HMFA 4QSWA 5DYUA 5HRXA 5ETBA 3O33A 5ETDA 3MUKA 2RS9B 5CQAA 4Z1QA 5HRWA 2GRCA 3MXFA 2DVVA 5DYCA 4QYLA 4N4GA 5II1A 4QUTA 5EV9A 2YEMA 4Z1SA 3UVWA 5CUCA 3UW9A 3P1DA 5E3GA 2YW5A 4MR3A 5EWCA 5G4SA 3P1FA 2DVRA 3AADA 5D3LA 5D25A 4PS5A 5E9YA 4Z6HA 5AMEA 4UIXA 4N4HA 5AMFA 4Q0OA 2H60A 2WP2A 5FE4A 5E9LA 5I80A 5F1LA 5LKTA 4CFLA 3MULA 5EQ1A 5KTUA 4ALHA 5A5OA 2RNYA 4A9KA 4F3IA 4BW3A 5CQ4A 4QYDA 5I86A 5LKUA 4PCIA 5LJ1A 5CQ8A 4LR6A 4YYNA 4UIUA 5EWVA 5F61A 4QC3A 5E74A 5KTWA 2D82A 4HXNA 3UVYA 5E73A 5ENCA 5IBNA 4FLPA 5LJ0A 3UV4A 5E9IA 3LJWA 5CS8A 3O34A 5DW2A 5D0CA 1N72A 5CTLA 2DATA 4PKLA 5A85A 4TU4A 5IGMA 4UITA 4BW1A 3NXBA 4XYAA 3JVJA 5ACYA 3U5MA 2F6JA 4DONA 3U5JA 4O7FA 5K29A 1WUGA 4O7AA 5D3SA 4LYSA 4CURA 3JVMA 4NYXA 3ZYUA 4YH4A 5A5NA 4YATA 4NR6A 3P1CA 4UYHA 4TT4A 4UYFA 5I7XA 5CUEA 4MR4A 3QZSA 3QZVA 4O7BA 5EVAA 4YAXA 3U5LA 5E3DA 4TU6A 5FE9A 4TT6A 2YEKA 5AD3A 5CU8A 5C89A 5TB6A 5A5QA 5FFVA 3O37A 5E9MA 4O7CA 4OGJA 5DFDA 5CP5A 5A5PA 5HLSA 4J1PA 2L85A 4YBSA 4Y03A 4ALGA 3RCWA 3IU5A 5CQ6A 5LJ2A 4YABA 5FBXA 4PY6A 5L97A 4Z93A 3U5NA 4QR5A 5D7XA 4O78A 5F60A 4QEUA 3I3JA 5EK9A 4KV4A 5EM3A 4KV1A 5EWHA 4LZRA 4WIVA 5EICA 5ENJA 4NR7A 5EWWA 3MB4A 5CQTA 5F62A 4J0RA 4TYLA 5DLXA 4UIYA 2G4AA 3DWYA 5HQ7A 3O36A 4QUUA 5HM0A 2WP1A 5DW1A 5A81A 3S92A 5D24A 4CLBA 5KO4A 2N9GA 5CQ7A 5F1HA 5E9VA 5CRZA 2YQDA 3SVFA 4LYWA 4HXRA 5ENHA 5FE2A 4A9FA 5FG6A 2L84A 5HRVA 5IIDA 5C7NA 4A9EA 5I1QA 5D26A 5L99A 5CUAA 2R0YA 5FE8A 5ENGA 5CY9A 5DYXA 4CUPA 2E7NA 4IR4A 2MJVB 5C87A 4YYDA 5COIA 4NXJA 5E9KA 5LVQA 5FG5A 5E0RA 3D7CA 4ZW1A 2RNXA 5CUBA 4IR6A 4BW4A 2DVQA 3U5PA 1E6IA 5DBMA 5JWMA 5IGKA 5IGLA 2OUOA 5DFCA 5DYAA 4TZ8A 1EQFA 4HXSA 2DWWA 4O70A 4QR4A 5I89A 3ONIA 5FB0A 5H1TA 4NRCA 4YBMA 4QSXA 2F6NA 5G4RA 4CUTA 5EU1A 4HXPA 5KU3A 4O71A 5A82A 4YADA 4YC9A 3SVGA 2YELA 4QB3A 2YDWA 2NXBA 3JVLA 5DY7A 4CFKA 4O74A 5CQ3A 4TT2A 5F3AA 2I7KA 3MQMA 4TQNA 3G0JA 4YY6A 3U5KA 4MEPA 3P1EA 4YH3A 5CZGA 5D3PA 2FSAA 5D3NA 5ENFA 3Q2FA 4IOQA 5I29A 5FH7A 5CUDA 4Z6IA 5EA1A 5HCLA 4QSUA 5HQ5A 4HXOA 4LZSA 5AD2A 5EPRA 4O7EA 5HEMA 5HFRA 5FE3A 5C8GA 5FFYA 5LUUA 5A5RA 4XUBA 4UYDA 4O76A 5F25A 4YYIA 5IGNA 4YYHA 4XY9A 5TCMA 3K2JA 4QBMA 5D3JA 4MR6A 4UYGA 5DKCA 2E7OA 4RVRA 5LKZA 4CL9A 5KHMA 5CPEA
chains in the Genus database with same CATH superfamily
4GPJA 5F36A 4A9IA 4CUUA 5FE1A 2DKWA 5E7DA 4QZSA 4OGIA 4C67A 2RFJA 5EPBA 5L8TA 4UIVA 4QEVA 1JM4B 4NR4A 2RNWA 3MB3A 5FE5A 5I83A 4NRAA 5IG6A 4QSTA 3VKHA 2OSSA 4Q0NA 5D3RA 4A9HA 4N4IA 1ZS5A 2YYNA 5F2PA 5LVRA 3TLPA 2R0SA 5EGUA 5JI8A 4NUDA 5DFBA 5HQ6A 4N4FA 4QEWA 3HMHA 5DLZA 5ENIA 4QNSA 4O77A 4QSQA 4IR3A 5FE7A 4A9OA 2R0VA 4QY4A 5D3TA 4MEOA 4QSRA 4NQMA 5DX4A 4QSPA 2KTBB 5CQ5A 3G0LA 5ENEA 3UVXA 4YK0A 4MR5A 4NUCA 2LSPB 3LQIA 3QZTA 4HXKA 4ZQLA 4IORA 4YYMA 4J0SA 4LYIA 4MEQA 5ENBA 5FE6A 4CUQA 4A9JA 5LKXA 3UVDA 4KCXA 4NR9A 4X2IA 4NYWA 4WHUA 4A9NA 1X0JA 4HBWA 4BJXA 4AKHA 5HFQA 4NUEA 3P5OA 4LC2A 5EWDA 5CUGA 2D9EA 4UIWA 3LQJA 4TTEA 5F63A 5FDZA 4QSVA 5H1VA 5H1UA 5BT5A 3UV5A 5CRMA 4WHWA 5EISA 4ZC9A 3GG3A 5FE0A 4YYGA 5I7YA 4YYKA 2I8NA 5DKHA 4TS8A 5FH8A 4YYJA 4NR8A 5DKDA 5HELA 4LDFA 4O72A 3U5OA 4UYEA 4IOOA 3O35A 5F5ZA 4NS5A 4QSSA 5EI4A 4A9MA 5D3HA 4UIZA 5L8UA 4NR5A 4AKNA 5I40A 4OUFA 4NRBA 4TZ2A 2RO1A 5H85A 5C4QA 3Q2EA 2OO1A 4HXLA 4LZ2A 3JVKA 4YY4A 4O75A 4XUAA 2DVSA 3HMEA 4C66A 4J3IA 5A83A 2E3KA 4QR3A 4A9LA 4HBYA 4PTBA 4AKIA 5FFWA 5L98A 5BT4A 5II2A 5EPSA 5FB1A 4HBXA 4BHWA 5I88A 5FH6A 5HENA 3FKMX 4NYVA 3AQAA 5A7CA 4UYFB 3SVHA 5L96A 3LQHA 4YBTA 1WUMA 5CGPA 3LXJA 4BW2A 5A5SA 2L5EA 4HBVA 3UV2A 4CUSA 2RI7A 4LRGA 5EP7A 4IR5A 5FG4A 4NQNA 4XY8A 2R10A 4MENA 4E96A 5BT3A 5C85A 3D1BA 3S91A 4N3WA 5J0DA 3IU6A 4HXMA 4QC1A 1F68A 3DAIA 5CFWA 5HJCA 5KTXA 1JSPB 4PCEA 3HMFA 4QSWA 5DYUA 5HRXA 5ETBA 3O33A 5ETDA 3MUKA 2RS9B 5CQAA 4Z1QA 5HRWA 2GRCA 3MXFA 2DVVA 5DYCA 4QYLA 4N4GA 5II1A 4QUTA 5EV9A 2YEMA 4Z1SA 3UVWA 5CUCA 3UW9A 3P1DA 5E3GA 2YW5A 4MR3A 5EWCA 5G4SA 3P1FA 2DVRA 3AADA 5D3LA 5D25A 4PS5A 5E9YA 4Z6HA 5AMEA 4UIXA 4N4HA 5AMFA 3VKGA 4Q0OA 3ERRA 2H60A 2WP2A 5FE4A 5E9LA 1ZKRA 5I80A 5F1LA 5LKTA 4CFLA 3MULA 5EQ1A 5KTUA 4ALHA 5A5OA 2RNYA 4A9KA 4F3IA 4BW3A 5CQ4A 4QYDA 5I86A 5LKUA 4PCIA 5LJ1A 5CQ8A 4LR6A 4YYNA 4UIUA 5EWVA 5F61A 4QC3A 5E74A 5KTWA 2D82A 4HXNA 3UVYA 5E73A 5ENCA 5IBNA 4FLPA 5LJ0A 3UV4A 5E9IA 3LJWA 5CS8A 3O34A 5DW2A 5D0CA 1N72A 5CTLA 2DATA 4PKLA 5A85A 4TU4A 5IGMA 4UITA 4BW1A 4AKGA 3NXBA 4XYAA 3JVJA 5ACYA 3U5MA 2F6JA 4DONA 3U5JA 4O7FA 5K29A 1WUGA 4O7AA 5D3SA 4LYSA 4CURA 3JVMA 4NYXA 3ZYUA 4YH4A 5A5NA 4AI6A 4YATA 4NR6A 3P1CA 4UYHA 4TT4A 4UYFA 5I7XA 5CUEA 4MR4A 3QZSA 3QZVA 4O7BA 5EVAA 4YAXA 3U5LA 5E3DA 4TU6A 5FE9A 4TT6A 2YEKA 5AD3A 5CU8A 5C89A 5TB6A 5A5QA 5FFVA 3O37A 5E9MA 4O7CA 4OGJA 5CP5A 5DFDA 5A5PA 5HLSA 4J1PA 2L85A 4YBSA 4Y03A 4ALGA 3RCWA 3IU5A 5CQ6A 5LJ2A 4YABA 5FBXA 4PY6A 5L97A 4Z93A 3U5NA 4QR5A 5D7XA 4O78A 5F60A 4QEUA 3I3JA 5EK9A 4KV4A 5EM3A 4KV1A 5EWHA 4LZRA 4WIVA 5EICA 5ENJA 4NR7A 5EWWA 3MB4A 5CQTA 5F62A 4J0RA 4TYLA 5DLXA 4UIYA 2G4AA 2EJNA 3DWYA 5HQ7A 3O36A 4QUUA 5HM0A 2WP1A 5DW1A 5A81A 3S92A 5D24A 4CLBA 5KO4A 2N9GA 5CQ7A 5F1HA 5E9VA 5CRZA 2YQDA 3SVFA 4LYWA 4HXRA 5ENHA 5FE2A 4A9FA 5FG6A 2L84A 5HRVA 3D1DA 5IIDA 5C7NA 4A9EA 5I1QA 5D26A 5L99A 5CUAA 2R0YA 5FE8A 5ENGA 5CY9A 5DYXA 4CUPA 2E7NA 4IR4A 2MJVB 5C87A 4YYDA 5COIA 4NXJA 5E9KA 5LVQA 5FG5A 5E0RA 3D7CA 4ZW1A 2RNXA 5CUBA 4IR6A 4BW4A 2DVQA 3U5PA 1E6IA 5DBMA 5JWMA 5IGKA 5IGLA 2OUOA 5DFCA 5DYAA 4TZ8A 1EQFA 4HXSA 2DWWA 4O70A 4QR4A 5I89A 3ONIA 5FB0A 5H1TA 4NRCA 4YBMA 4QSXA 2F6NA 5G4RA 4CUTA 5EU1A 4HXPA 5KU3A 4O71A 5A82A 4YADA 4YC9A 3SVGA 2YELA 4QB3A 2YDWA 2NXBA 1PUOA 3JVLA 5DY7A 4CFKA 4O74A 5CQ3A 4TT2A 5F3AA 2I7KA 3MQMA 4TQNA 3G0JA 4YY6A 3U5KA 4MEPA 3P1EA 4YH3A 5CZGA 5D3PA 2FSAA 5D3NA 5ENFA 3Q2FA 4IOQA 5I29A 5FH7A 5CUDA 4Z6IA 5EA1A 5HCLA 4QSUA 5HQ5A 4HXOA 4LZSA 5AD2A 5EPRA 4O7EA 5HEMA 5HFRA 5FE3A 5C8GA 5FFYA 5LUUA 5A5RA 4XUBA 4UYDA 4O76A 5F25A 4YYIA 5IGNA 4YYHA 4XY9A 5TCMA 3K2JA 4QBMA 5D3JA 4MR6A 4UYGA 5DKCA 2E7OA 4RVRA 5LKZA 4CL9A 5KHMA 5CPEA
chains in the Genus database with same CATH topology
4GPJA 5F36A 4A9IA 4CUUA 5FE1A 2DKWA 5E7DA 4QZSA 4OGIA 4C67A 2RFJA 5EPBA 5L8TA 4UIVA 4QEVA 1JM4B 4NR4A 2RNWA 3MB3A 5FE5A 5I83A 4NRAA 5IG6A 4QSTA 2OSSA 4Q0NA 5D3RA 4A9HA 4N4IA 1ZS5A 2YYNA 5F2PA 5LVRA 3TLPA 2R0SA 5EGUA 5JI8A 4NUDA 5DFBA 5HQ6A 4N4FA 4QEWA 3HMHA 5DLZA 5ENIA 4QNSA 4O77A 4QSQA 4IR3A 5FE7A 4A9OA 2R0VA 4QY4A 5D3TA 4MEOA 4QSRA 4NQMA 5DX4A 4QSPA 2KTBB 5CQ5A 3G0LA 5ENEA 3UVXA 4YK0A 4MR5A 4NUCA 2LSPB 3LQIA 3QZTA 4HXKA 4ZQLA 4IORA 4YYMA 4J0SA 4LYIA 4MEQA 5ENBA 5FE6A 4CUQA 4A9JA 5LKXA 3UVDA 4KCXA 4NR9A 4X2IA 4NYWA 4WHUA 4A9NA 1X0JA 4HBWA 4BJXA 5HFQA 4NUEA 3P5OA 4LC2A 5EWDA 5CUGA 2D9EA 4UIWA 3LQJA 4TTEA 5F63A 5FDZA 4QSVA 5H1VA 5H1UA 5BT5A 3UV5A 5CRMA 4WHWA 5EISA 4ZC9A 3GG3A 5FE0A 4YYGA 5I7YA 4YYKA 2I8NA 5DKHA 4TS8A 5FH8A 4YYJA 4NR8A 5DKDA 5HELA 4LDFA 4O72A 3U5OA 4UYEA 4IOOA 3O35A 5F5ZA 4NS5A 4QSSA 5EI4A 4A9MA 5D3HA 4UIZA 5L8UA 4NR5A 4AKNA 5I40A 4OUFA 4NRBA 4TZ2A 2RO1A 5H85A 5C4QA 3Q2EA 2OO1A 4HXLA 4LZ2A 3JVKA 4YY4A 4O75A 4XUAA 2DVSA 3HMEA 4C66A 4J3IA 5A83A 2E3KA 4QR3A 4A9LA 4HBYA 4PTBA 5FFWA 5L98A 5BT4A 5II2A 5EPSA 5FB1A 4HBXA 4BHWA 5I88A 5FH6A 5HENA 3FKMX 4NYVA 3AQAA 5A7CA 4UYFB 3SVHA 5L96A 3LQHA 4YBTA 1WUMA 5CGPA 3LXJA 4BW2A 5A5SA 2L5EA 4HBVA 3UV2A 4CUSA 2RI7A 4LRGA 5EP7A 4IR5A 5FG4A 4NQNA 4XY8A 2R10A 4MENA 4E96A 5BT3A 5C85A 3S91A 4N3WA 5J0DA 3IU6A 4HXMA 4QC1A 1F68A 3DAIA 5CFWA 5HJCA 5KTXA 1JSPB 4PCEA 3HMFA 4QSWA 5DYUA 5HRXA 5ETBA 3O33A 5ETDA 3MUKA 2RS9B 5CQAA 4Z1QA 5HRWA 2GRCA 3MXFA 2DVVA 5DYCA 4QYLA 4N4GA 5II1A 4QUTA 5EV9A 2YEMA 4Z1SA 3UVWA 5CUCA 3UW9A 3P1DA 5E3GA 2YW5A 4MR3A 5EWCA 5G4SA 3P1FA 2DVRA 3AADA 5D3LA 5D25A 4PS5A 5E9YA 4Z6HA 5AMEA 4UIXA 4N4HA 5AMFA 4Q0OA 2H60A 2WP2A 5FE4A 5E9LA 5I80A 5F1LA 5LKTA 4CFLA 3MULA 5EQ1A 5KTUA 4ALHA 5A5OA 2RNYA 4A9KA 4F3IA 4BW3A 5CQ4A 4QYDA 5I86A 5LKUA 4PCIA 5LJ1A 5CQ8A 4LR6A 4YYNA 4UIUA 5EWVA 5F61A 4QC3A 5E74A 5KTWA 2D82A 4HXNA 3UVYA 5E73A 5ENCA 5IBNA 4FLPA 5LJ0A 3UV4A 5E9IA 3LJWA 5CS8A 3O34A 5DW2A 5D0CA 1N72A 5CTLA 2DATA 4PKLA 5A85A 4TU4A 5IGMA 4UITA 4BW1A 3NXBA 4XYAA 3JVJA 5ACYA 3U5MA 2F6JA 4DONA 3U5JA 4O7FA 5K29A 1WUGA 4O7AA 5D3SA 4LYSA 4CURA 3JVMA 4NYXA 3ZYUA 4YH4A 5A5NA 4YATA 4NR6A 3P1CA 4UYHA 4TT4A 4UYFA 5I7XA 5CUEA 4MR4A 3QZSA 3QZVA 4O7BA 5EVAA 4YAXA 3U5LA 5E3DA 4TU6A 5FE9A 4TT6A 2YEKA 5AD3A 5CU8A 5C89A 5TB6A 5A5QA 5FFVA 3O37A 5E9MA 4O7CA 4OGJA 5DFDA 5CP5A 5A5PA 5HLSA 4J1PA 2L85A 4YBSA 4Y03A 4ALGA 3RCWA 3IU5A 5CQ6A 5LJ2A 4YABA 5FBXA 4PY6A 5L97A 4Z93A 3U5NA 4QR5A 5D7XA 4O78A 5F60A 4QEUA 3I3JA 5EK9A 4KV4A 5EM3A 4KV1A 5EWHA 4LZRA 4WIVA 5EICA 5ENJA 4NR7A 5EWWA 3MB4A 5CQTA 5F62A 4J0RA 4TYLA 5DLXA 4UIYA 2G4AA 3DWYA 5HQ7A 3O36A 4QUUA 5HM0A 2WP1A 5DW1A 5A81A 3S92A 5D24A 4CLBA 5KO4A 2N9GA 5CQ7A 5F1HA 5E9VA 5CRZA 2YQDA 3SVFA 4LYWA 4HXRA 5ENHA 5FE2A 4A9FA 5FG6A 2L84A 5HRVA 5IIDA 5C7NA 4A9EA 5I1QA 5D26A 5L99A 5CUAA 2R0YA 5FE8A 5ENGA 5CY9A 5DYXA 4CUPA 2E7NA 4IR4A 2MJVB 5C87A 4YYDA 5COIA 4NXJA 5E9KA 5LVQA 5FG5A 5E0RA 3D7CA 4ZW1A 2RNXA 5CUBA 4IR6A 4BW4A 2DVQA 3U5PA 1E6IA 5DBMA 5JWMA 5IGKA 5IGLA 2OUOA 5DFCA 5DYAA 4TZ8A 1EQFA 4HXSA 2DWWA 4O70A 4QR4A 5I89A 3ONIA 5FB0A 5H1TA 4NRCA 4YBMA 4QSXA 2F6NA 5G4RA 4CUTA 5EU1A 4HXPA 5KU3A 4O71A 5A82A 4YADA 4YC9A 3SVGA 2YELA 4QB3A 2YDWA 2NXBA 3JVLA 5DY7A 4CFKA 4O74A 5CQ3A 4TT2A 5F3AA 2I7KA 3MQMA 4TQNA 3G0JA 4YY6A 3U5KA 4MEPA 3P1EA 4YH3A 5CZGA 5D3PA 2FSAA 5D3NA 5ENFA 3Q2FA 4IOQA 5I29A 5FH7A 5CUDA 4Z6IA 5EA1A 5HCLA 4QSUA 5HQ5A 4HXOA 4LZSA 5AD2A 5EPRA 4O7EA 5HEMA 5HFRA 5FE3A 5C8GA 5FFYA 5LUUA 5A5RA 4XUBA 4UYDA 4O76A 5F25A 4YYIA 5IGNA 4YYHA 4XY9A 5TCMA 3K2JA 4QBMA 5D3JA 4MR6A 4UYGA 5DKCA 2E7OA 4RVRA 5LKZA 4CL9A 5KHMA 5CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPJ A;  5F36 A;  4A9I A;  4CUU A;  5FE1 A;  2DKW A;  5E7D A;  4QZS A;  4OGI A;  4C67 A;  2RFJ A;  5EPB A;  5L8T A;  4UIV A;  4QEV A;  1JM4 B;  4NR4 A;  2RNW A;  3MB3 A;  5FE5 A;  5I83 A;  4NRA A;  5IG6 A;  4QST A;  2OSS A;  4Q0N A;  5D3R A;  4A9H A;  4N4I A;  1ZS5 A;  2YYN A;  5F2P A;  5LVR A;  3TLP A;  2R0S A;  5EGU A;  5JI8 A;  4NUD A;  5DFB A;  5HQ6 A;  4N4F A;  4QEW A;  3HMH A;  5DLZ A;  5ENI A;  4QNS A;  4O77 A;  4QSQ A;  4IR3 A;  5FE7 A;  4A9O A;  2R0V A;  4QY4 A;  5D3T A;  4MEO A;  4QSR A;  4NQM A;  5DX4 A;  4QSP A;  2KTB B;  5CQ5 A;  3G0L A;  5ENE A;  3UVX A;  4YK0 A;  4MR5 A;  4NUC A;  2LSP B;  3LQI A;  3QZT A;  4HXK A;  4ZQL A;  4IOR A;  4YYM A;  4J0S A;  4LYI A;  4MEQ A;  5ENB A;  5FE6 A;  4CUQ A;  4A9J A;  5LKX A;  3UVD A;  4KCX A;  4NR9 A;  4X2I A;  4NYW A;  4WHU A;  4A9N A;  1X0J A;  4HBW A;  4BJX A;  5HFQ A;  4NUE A;  3P5O A;  4LC2 A;  5EWD A;  5CUG A;  2D9E A;  4UIW A;  3LQJ A;  4TTE A;  5F63 A;  5FDZ A;  4QSV A;  5H1V A;  5H1U A;  5BT5 A;  3UV5 A;  5CRM A;  4WHW A;  5EIS A;  4ZC9 A;  3GG3 A;  5FE0 A;  4YYG A;  5I7Y A;  4YYK A;  2I8N A;  5DKH A;  4TS8 A;  5FH8 A;  4YYJ A;  4NR8 A;  5DKD A;  5HEL A;  4LDF A;  4O72 A;  3U5O A;  4UYE A;  4IOO A;  3O35 A;  5F5Z A;  4NS5 A;  4QSS A;  5EI4 A;  4A9M A;  5D3H A;  4UIZ A;  5L8U A;  4NR5 A;  4AKN A;  5I40 A;  4OUF A;  4NRB A;  4TZ2 A;  2RO1 A;  5H85 A;  5C4Q A;  3Q2E A;  2OO1 A;  4HXL A;  4LZ2 A;  3JVK A;  4YY4 A;  4O75 A;  4XUA A;  2DVS A;  3HME A;  4C66 A;  4J3I A;  5A83 A;  2E3K A;  4QR3 A;  4A9L A;  4HBY A;  4PTB A;  5FFW A;  5L98 A;  5BT4 A;  5II2 A;  5EPS A;  5FB1 A;  4HBX A;  4BHW A;  5I88 A;  5FH6 A;  5HEN A;  3FKM X;  4NYV A;  3AQA A;  5A7C A;  4UYF B;  3SVH A;  5L96 A;  3LQH A;  4YBT A;  1WUM A;  5CGP A;  3LXJ A;  4BW2 A;  5A5S A;  2L5E A;  4HBV A;  3UV2 A;  4CUS A;  2RI7 A;  4LRG A;  5EP7 A;  4IR5 A;  5FG4 A;  4NQN A;  4XY8 A;  2R10 A;  4MEN A;  4E96 A;  5BT3 A;  5C85 A;  3S91 A;  4N3W A;  5J0D A;  3IU6 A;  4HXM A;  4QC1 A;  1F68 A;  3DAI A;  5CFW A;  5HJC A;  5KTX A;  1JSP B;  4PCE A;  3HMF A;  4QSW A;  5DYU A;  5HRX A;  5ETB A;  3O33 A;  5ETD A;  3MUK A;  2RS9 B;  5CQA A;  4Z1Q A;  5HRW A;  2GRC A;  3MXF A;  2DVV A;  5DYC A;  4QYL A;  4N4G A;  5II1 A;  4QUT A;  5EV9 A;  2YEM A;  4Z1S A;  3UVW A;  5CUC A;  3UW9 A;  3P1D A;  5E3G A;  2YW5 A;  4MR3 A;  5EWC A;  5G4S A;  3P1F A;  2DVR A;  3AAD A;  5D3L A;  5D25 A;  4PS5 A;  5E9Y A;  4Z6H A;  5AME A;  4UIX A;  4N4H A;  5AMF A;  4Q0O A;  2H60 A;  2WP2 A;  5FE4 A;  5E9L A;  5I80 A;  5F1L A;  5LKT A;  4CFL A;  3MUL A;  5EQ1 A;  5KTU A;  4ALH A;  5A5O A;  2RNY A;  4A9K A;  4F3I A;  4BW3 A;  5CQ4 A;  4QYD A;  5I86 A;  5LKU A;  4PCI A;  5LJ1 A;  5CQ8 A;  4LR6 A;  4YYN A;  4UIU A;  5EWV A;  5F61 A;  4QC3 A;  5E74 A;  5KTW A;  2D82 A;  4HXN A;  3UVY A;  5E73 A;  5ENC A;  5IBN A;  4FLP A;  5LJ0 A;  3UV4 A;  5E9I A;  3LJW A;  5CS8 A;  3O34 A;  5DW2 A;  5D0C A;  1N72 A;  5CTL A;  2DAT A;  4PKL A;  5A85 A;  4TU4 A;  5IGM A;  4UIT A;  4BW1 A;  3NXB A;  4XYA A;  3JVJ A;  5ACY A;  3U5M A;  2F6J A;  4DON A;  3U5J A;  4O7F A;  5K29 A;  1WUG A;  4O7A A;  5D3S A;  4LYS A;  4CUR A;  3JVM A;  4NYX A;  3ZYU A;  4YH4 A;  5A5N A;  4YAT A;  4NR6 A;  3P1C A;  4UYH A;  4TT4 A;  4UYF A;  5I7X A;  5CUE A;  4MR4 A;  3QZS A;  3QZV A;  4O7B A;  5EVA A;  4YAX A;  3U5L A;  5E3D A;  4TU6 A;  5FE9 A;  4TT6 A;  2YEK A;  5AD3 A;  5CU8 A;  5C89 A;  5TB6 A;  5A5Q A;  5FFV A;  3O37 A;  5E9M A;  4O7C A;  4OGJ A;  5DFD A;  5CP5 A;  5A5P A;  5HLS A;  4J1P A;  2L85 A;  4YBS A;  4Y03 A;  4ALG A;  3RCW A;  3IU5 A;  5CQ6 A;  5LJ2 A;  4YAB A;  5FBX A;  4PY6 A;  5L97 A;  4Z93 A;  3U5N A;  4QR5 A;  5D7X A;  4O78 A;  5F60 A;  4QEU A;  3I3J A;  5EK9 A;  4KV4 A;  5EM3 A;  4KV1 A;  5EWH A;  4LZR A;  4WIV A;  5EIC A;  5ENJ A;  4NR7 A;  5EWW A;  3MB4 A;  5CQT A;  5F62 A;  4J0R A;  4TYL A;  5DLX A;  4UIY A;  2G4A A;  3DWY A;  5HQ7 A;  3O36 A;  4QUU A;  5HM0 A;  2WP1 A;  5DW1 A;  5A81 A;  3S92 A;  5D24 A;  4CLB A;  5KO4 A;  2N9G A;  5CQ7 A;  5F1H A;  5E9V A;  5CRZ A;  2YQD A;  3SVF A;  4LYW A;  4HXR A;  5ENH A;  5FE2 A;  4A9F A;  5FG6 A;  2L84 A;  5HRV A;  5IID A;  5C7N A;  4A9E A;  5I1Q A;  5D26 A;  5L99 A;  5CUA A;  2R0Y A;  5FE8 A;  5ENG A;  5CY9 A;  5DYX A;  4CUP A;  2E7N A;  4IR4 A;  2MJV B;  5C87 A;  4YYD A;  5COI A;  4NXJ A;  5E9K A;  5LVQ A;  5FG5 A;  5E0R A;  3D7C A;  4ZW1 A;  2RNX A;  5CUB A;  4IR6 A;  4BW4 A;  2DVQ A;  3U5P A;  1E6I A;  5DBM A;  5JWM A;  5IGK A;  5IGL A;  2OUO A;  5DFC A;  5DYA A;  4TZ8 A;  1EQF A;  4HXS A;  2DWW A;  4O70 A;  4QR4 A;  5I89 A;  3ONI A;  5FB0 A;  5H1T A;  4NRC A;  4YBM A;  4QSX A;  2F6N A;  5G4R A;  4CUT A;  5EU1 A;  4HXP A;  5KU3 A;  4O71 A;  5A82 A;  4YAD A;  4YC9 A;  3SVG A;  2YEL A;  4QB3 A;  2YDW A;  2NXB A;  3JVL A;  5DY7 A;  4CFK A;  4O74 A;  5CQ3 A;  4TT2 A;  5F3A A;  2I7K A;  3MQM A;  4TQN A;  3G0J A;  4YY6 A;  3U5K A;  4MEP A;  3P1E A;  4YH3 A;  5CZG A;  5D3P A;  2FSA A;  5D3N A;  5ENF A;  3Q2F A;  4IOQ A;  5I29 A;  5FH7 A;  5CUD A;  4Z6I A;  5EA1 A;  5HCL A;  4QSU A;  5HQ5 A;  4HXO A;  4LZS A;  5AD2 A;  5EPR A;  4O7E A;  5HEM A;  5HFR A;  5FE3 A;  5C8G A;  5FFY A;  5LUU A;  5A5R A;  4XUB A;  4UYD A;  4O76 A;  5F25 A;  4YYI A;  5IGN A;  4YYH A;  4XY9 A;  5TCM A;  3K2J A;  4QBM A;  5D3J A;  4MR6 A;  4UYG A;  5DKC A;  2E7O A;  4RVR A;  5LKZ A;  4CL9 A;  5KHM A;  5CPE A; 
#chains in the Genus database with same CATH topology
 4GPJ A;  5F36 A;  4A9I A;  4CUU A;  5FE1 A;  2DKW A;  5E7D A;  4QZS A;  4OGI A;  4C67 A;  2RFJ A;  5EPB A;  5L8T A;  4UIV A;  4QEV A;  1JM4 B;  4NR4 A;  2RNW A;  3MB3 A;  5FE5 A;  5I83 A;  4NRA A;  5IG6 A;  4QST A;  3VKH A;  2OSS A;  4Q0N A;  5D3R A;  4A9H A;  4N4I A;  1ZS5 A;  2YYN A;  5F2P A;  5LVR A;  3TLP A;  2R0S A;  5EGU A;  5JI8 A;  4NUD A;  5DFB A;  5HQ6 A;  4N4F A;  4QEW A;  3HMH A;  5DLZ A;  5ENI A;  4QNS A;  4O77 A;  4QSQ A;  4IR3 A;  5FE7 A;  4A9O A;  2R0V A;  4QY4 A;  5D3T A;  4MEO A;  4QSR A;  4NQM A;  5DX4 A;  4QSP A;  2KTB B;  5CQ5 A;  3G0L A;  5ENE A;  3UVX A;  4YK0 A;  4MR5 A;  4NUC A;  2LSP B;  3LQI A;  3QZT A;  4HXK A;  4ZQL A;  4IOR A;  4YYM A;  4J0S A;  4LYI A;  4MEQ A;  5ENB A;  5FE6 A;  4CUQ A;  4A9J A;  5LKX A;  3UVD A;  4KCX A;  4NR9 A;  4X2I A;  4NYW A;  4WHU A;  4A9N A;  1X0J A;  4HBW A;  4BJX A;  4AKH A;  5HFQ A;  4NUE A;  3P5O A;  4LC2 A;  5EWD A;  5CUG A;  2D9E A;  4UIW A;  3LQJ A;  4TTE A;  5F63 A;  5FDZ A;  4QSV A;  5H1V A;  5H1U A;  5BT5 A;  3UV5 A;  5CRM A;  4WHW A;  5EIS A;  4ZC9 A;  3GG3 A;  5FE0 A;  4YYG A;  5I7Y A;  4YYK A;  2I8N A;  5DKH A;  4TS8 A;  5FH8 A;  4YYJ A;  4NR8 A;  5DKD A;  5HEL A;  4LDF A;  4O72 A;  3U5O A;  4UYE A;  4IOO A;  3O35 A;  5F5Z A;  4NS5 A;  4QSS A;  5EI4 A;  4A9M A;  5D3H A;  4UIZ A;  5L8U A;  4NR5 A;  4AKN A;  5I40 A;  4OUF A;  4NRB A;  4TZ2 A;  2RO1 A;  5H85 A;  5C4Q A;  3Q2E A;  2OO1 A;  4HXL A;  4LZ2 A;  3JVK A;  4YY4 A;  4O75 A;  4XUA A;  2DVS A;  3HME A;  4C66 A;  4J3I A;  5A83 A;  2E3K A;  4QR3 A;  4A9L A;  4HBY A;  4PTB A;  4AKI A;  5FFW A;  5L98 A;  5BT4 A;  5II2 A;  5EPS A;  5FB1 A;  4HBX A;  4BHW A;  5I88 A;  5FH6 A;  5HEN A;  3FKM X;  4NYV A;  3AQA A;  5A7C A;  4UYF B;  3SVH A;  5L96 A;  3LQH A;  4YBT A;  1WUM A;  5CGP A;  3LXJ A;  4BW2 A;  5A5S A;  2L5E A;  4HBV A;  3UV2 A;  4CUS A;  2RI7 A;  4LRG A;  5EP7 A;  4IR5 A;  5FG4 A;  4NQN A;  4XY8 A;  2R10 A;  4MEN A;  4E96 A;  5BT3 A;  5C85 A;  3D1B A;  3S91 A;  4N3W A;  5J0D A;  3IU6 A;  4HXM A;  4QC1 A;  1F68 A;  3DAI A;  5CFW A;  5HJC A;  5KTX A;  1JSP B;  4PCE A;  3HMF A;  4QSW A;  5DYU A;  5HRX A;  5ETB A;  3O33 A;  5ETD A;  3MUK A;  2RS9 B;  5CQA A;  4Z1Q A;  5HRW A;  2GRC A;  3MXF A;  2DVV A;  5DYC A;  4QYL A;  4N4G A;  5II1 A;  4QUT A;  5EV9 A;  2YEM A;  4Z1S A;  3UVW A;  5CUC A;  3UW9 A;  3P1D A;  5E3G A;  2YW5 A;  4MR3 A;  5EWC A;  5G4S A;  3P1F A;  2DVR A;  3AAD A;  5D3L A;  5D25 A;  4PS5 A;  5E9Y A;  4Z6H A;  5AME A;  4UIX A;  4N4H A;  5AMF A;  3VKG A;  4Q0O A;  3ERR A;  2H60 A;  2WP2 A;  5FE4 A;  5E9L A;  1ZKR A;  5I80 A;  5F1L A;  5LKT A;  4CFL A;  3MUL A;  5EQ1 A;  5KTU A;  4ALH A;  5A5O A;  2RNY A;  4A9K A;  4F3I A;  4BW3 A;  5CQ4 A;  4QYD A;  5I86 A;  5LKU A;  4PCI A;  5LJ1 A;  5CQ8 A;  4LR6 A;  4YYN A;  4UIU A;  5EWV A;  5F61 A;  4QC3 A;  5E74 A;  5KTW A;  2D82 A;  4HXN A;  3UVY A;  5E73 A;  5ENC A;  5IBN A;  4FLP A;  5LJ0 A;  3UV4 A;  5E9I A;  3LJW A;  5CS8 A;  3O34 A;  5DW2 A;  5D0C A;  1N72 A;  5CTL A;  2DAT A;  4PKL A;  5A85 A;  4TU4 A;  5IGM A;  4UIT A;  4BW1 A;  4AKG A;  3NXB A;  4XYA A;  3JVJ A;  5ACY A;  3U5M A;  2F6J A;  4DON A;  3U5J A;  4O7F A;  5K29 A;  1WUG A;  4O7A A;  5D3S A;  4LYS A;  4CUR A;  3JVM A;  4NYX A;  3ZYU A;  4YH4 A;  5A5N A;  4AI6 A;  4YAT A;  4NR6 A;  3P1C A;  4UYH A;  4TT4 A;  4UYF A;  5I7X A;  5CUE A;  4MR4 A;  3QZS A;  3QZV A;  4O7B A;  5EVA A;  4YAX A;  3U5L A;  5E3D A;  4TU6 A;  5FE9 A;  4TT6 A;  2YEK A;  5AD3 A;  5CU8 A;  5C89 A;  5TB6 A;  5A5Q A;  5FFV A;  3O37 A;  5E9M A;  4O7C A;  4OGJ A;  5CP5 A;  5DFD A;  5A5P A;  5HLS A;  4J1P A;  2L85 A;  4YBS A;  4Y03 A;  4ALG A;  3RCW A;  3IU5 A;  5CQ6 A;  5LJ2 A;  4YAB A;  5FBX A;  4PY6 A;  5L97 A;  4Z93 A;  3U5N A;  4QR5 A;  5D7X A;  4O78 A;  5F60 A;  4QEU A;  3I3J A;  5EK9 A;  4KV4 A;  5EM3 A;  4KV1 A;  5EWH A;  4LZR A;  4WIV A;  5EIC A;  5ENJ A;  4NR7 A;  5EWW A;  3MB4 A;  5CQT A;  5F62 A;  4J0R A;  4TYL A;  5DLX A;  4UIY A;  2G4A A;  2EJN A;  3DWY A;  5HQ7 A;  3O36 A;  4QUU A;  5HM0 A;  2WP1 A;  5DW1 A;  5A81 A;  3S92 A;  5D24 A;  4CLB A;  5KO4 A;  2N9G A;  5CQ7 A;  5F1H A;  5E9V A;  5CRZ A;  2YQD A;  3SVF A;  4LYW A;  4HXR A;  5ENH A;  5FE2 A;  4A9F A;  5FG6 A;  2L84 A;  5HRV A;  3D1D A;  5IID A;  5C7N A;  4A9E A;  5I1Q A;  5D26 A;  5L99 A;  5CUA A;  2R0Y A;  5FE8 A;  5ENG A;  5CY9 A;  5DYX A;  4CUP A;  2E7N A;  4IR4 A;  2MJV B;  5C87 A;  4YYD A;  5COI A;  4NXJ A;  5E9K A;  5LVQ A;  5FG5 A;  5E0R A;  3D7C A;  4ZW1 A;  2RNX A;  5CUB A;  4IR6 A;  4BW4 A;  2DVQ A;  3U5P A;  1E6I A;  5DBM A;  5JWM A;  5IGK A;  5IGL A;  2OUO A;  5DFC A;  5DYA A;  4TZ8 A;  1EQF A;  4HXS A;  2DWW A;  4O70 A;  4QR4 A;  5I89 A;  3ONI A;  5FB0 A;  5H1T A;  4NRC A;  4YBM A;  4QSX A;  2F6N A;  5G4R A;  4CUT A;  5EU1 A;  4HXP A;  5KU3 A;  4O71 A;  5A82 A;  4YAD A;  4YC9 A;  3SVG A;  2YEL A;  4QB3 A;  2YDW A;  2NXB A;  1PUO A;  3JVL A;  5DY7 A;  4CFK A;  4O74 A;  5CQ3 A;  4TT2 A;  5F3A A;  2I7K A;  3MQM A;  4TQN A;  3G0J A;  4YY6 A;  3U5K A;  4MEP A;  3P1E A;  4YH3 A;  5CZG A;  5D3P A;  2FSA A;  5D3N A;  5ENF A;  3Q2F A;  4IOQ A;  5I29 A;  5FH7 A;  5CUD A;  4Z6I A;  5EA1 A;  5HCL A;  4QSU A;  5HQ5 A;  4HXO A;  4LZS A;  5AD2 A;  5EPR A;  4O7E A;  5HEM A;  5HFR A;  5FE3 A;  5C8G A;  5FFY A;  5LUU A;  5A5R A;  4XUB A;  4UYD A;  4O76 A;  5F25 A;  4YYI A;  5IGN A;  4YYH A;  4XY9 A;  5TCM A;  3K2J A;  4QBM A;  5D3J A;  4MR6 A;  4UYG A;  5DKC A;  2E7O A;  4RVR A;  5LKZ A;  4CL9 A;  5KHM A;  5CPE A; 
#chains in the Genus database with same CATH homology
 4GPJ A;  5F36 A;  4A9I A;  4CUU A;  5FE1 A;  2DKW A;  5E7D A;  4QZS A;  4OGI A;  4C67 A;  2RFJ A;  5EPB A;  5L8T A;  4UIV A;  4QEV A;  1JM4 B;  4NR4 A;  2RNW A;  3MB3 A;  5FE5 A;  5I83 A;  4NRA A;  5IG6 A;  4QST A;  2OSS A;  4Q0N A;  5D3R A;  4A9H A;  4N4I A;  1ZS5 A;  2YYN A;  5F2P A;  5LVR A;  3TLP A;  2R0S A;  5EGU A;  5JI8 A;  4NUD A;  5DFB A;  5HQ6 A;  4N4F A;  4QEW A;  3HMH A;  5DLZ A;  5ENI A;  4QNS A;  4O77 A;  4QSQ A;  4IR3 A;  5FE7 A;  4A9O A;  2R0V A;  4QY4 A;  5D3T A;  4MEO A;  4QSR A;  4NQM A;  5DX4 A;  4QSP A;  2KTB B;  5CQ5 A;  3G0L A;  5ENE A;  3UVX A;  4YK0 A;  4MR5 A;  4NUC A;  2LSP B;  3LQI A;  3QZT A;  4HXK A;  4ZQL A;  4IOR A;  4YYM A;  4J0S A;  4LYI A;  4MEQ A;  5ENB A;  5FE6 A;  4CUQ A;  4A9J A;  5LKX A;  3UVD A;  4KCX A;  4NR9 A;  4X2I A;  4NYW A;  4WHU A;  4A9N A;  1X0J A;  4HBW A;  4BJX A;  5HFQ A;  4NUE A;  3P5O A;  4LC2 A;  5EWD A;  5CUG A;  2D9E A;  4UIW A;  3LQJ A;  4TTE A;  5F63 A;  5FDZ A;  4QSV A;  5H1V A;  5H1U A;  5BT5 A;  3UV5 A;  5CRM A;  4WHW A;  5EIS A;  4ZC9 A;  3GG3 A;  5FE0 A;  4YYG A;  5I7Y A;  4YYK A;  2I8N A;  5DKH A;  4TS8 A;  5FH8 A;  4YYJ A;  4NR8 A;  5DKD A;  5HEL A;  4LDF A;  4O72 A;  3U5O A;  4UYE A;  4IOO A;  3O35 A;  5F5Z A;  4NS5 A;  4QSS A;  5EI4 A;  4A9M A;  5D3H A;  4UIZ A;  5L8U A;  4NR5 A;  4AKN A;  5I40 A;  4OUF A;  4NRB A;  4TZ2 A;  2RO1 A;  5H85 A;  5C4Q A;  3Q2E A;  2OO1 A;  4HXL A;  4LZ2 A;  3JVK A;  4YY4 A;  4O75 A;  4XUA A;  2DVS A;  3HME A;  4C66 A;  4J3I A;  5A83 A;  2E3K A;  4QR3 A;  4A9L A;  4HBY A;  4PTB A;  5FFW A;  5L98 A;  5BT4 A;  5II2 A;  5EPS A;  5FB1 A;  4HBX A;  4BHW A;  5I88 A;  5FH6 A;  5HEN A;  3FKM X;  4NYV A;  3AQA A;  5A7C A;  4UYF B;  3SVH A;  5L96 A;  3LQH A;  4YBT A;  1WUM A;  5CGP A;  3LXJ A;  4BW2 A;  5A5S A;  2L5E A;  4HBV A;  3UV2 A;  4CUS A;  2RI7 A;  4LRG A;  5EP7 A;  4IR5 A;  5FG4 A;  4NQN A;  4XY8 A;  2R10 A;  4MEN A;  4E96 A;  5BT3 A;  5C85 A;  3S91 A;  4N3W A;  5J0D A;  3IU6 A;  4HXM A;  4QC1 A;  1F68 A;  3DAI A;  5CFW A;  5HJC A;  5KTX A;  1JSP B;  4PCE A;  3HMF A;  4QSW A;  5DYU A;  5HRX A;  5ETB A;  3O33 A;  5ETD A;  3MUK A;  2RS9 B;  5CQA A;  4Z1Q A;  5HRW A;  2GRC A;  3MXF A;  2DVV A;  5DYC A;  4QYL A;  4N4G A;  5II1 A;  4QUT A;  5EV9 A;  2YEM A;  4Z1S A;  3UVW A;  5CUC A;  3UW9 A;  3P1D A;  5E3G A;  2YW5 A;  4MR3 A;  5EWC A;  5G4S A;  3P1F A;  2DVR A;  3AAD A;  5D3L A;  5D25 A;  4PS5 A;  5E9Y A;  4Z6H A;  5AME A;  4UIX A;  4N4H A;  5AMF A;  4Q0O A;  2H60 A;  2WP2 A;  5FE4 A;  5E9L A;  5I80 A;  5F1L A;  5LKT A;  4CFL A;  3MUL A;  5EQ1 A;  5KTU A;  4ALH A;  5A5O A;  2RNY A;  4A9K A;  4F3I A;  4BW3 A;  5CQ4 A;  4QYD A;  5I86 A;  5LKU A;  4PCI A;  5LJ1 A;  5CQ8 A;  4LR6 A;  4YYN A;  4UIU A;  5EWV A;  5F61 A;  4QC3 A;  5E74 A;  5KTW A;  2D82 A;  4HXN A;  3UVY A;  5E73 A;  5ENC A;  5IBN A;  4FLP A;  5LJ0 A;  3UV4 A;  5E9I A;  3LJW A;  5CS8 A;  3O34 A;  5DW2 A;  5D0C A;  1N72 A;  5CTL A;  2DAT A;  4PKL A;  5A85 A;  4TU4 A;  5IGM A;  4UIT A;  4BW1 A;  3NXB A;  4XYA A;  3JVJ A;  5ACY A;  3U5M A;  2F6J A;  4DON A;  3U5J A;  4O7F A;  5K29 A;  1WUG A;  4O7A A;  5D3S A;  4LYS A;  4CUR A;  3JVM A;  4NYX A;  3ZYU A;  4YH4 A;  5A5N A;  4YAT A;  4NR6 A;  3P1C A;  4UYH A;  4TT4 A;  4UYF A;  5I7X A;  5CUE A;  4MR4 A;  3QZS A;  3QZV A;  4O7B A;  5EVA A;  4YAX A;  3U5L A;  5E3D A;  4TU6 A;  5FE9 A;  4TT6 A;  2YEK A;  5AD3 A;  5CU8 A;  5C89 A;  5TB6 A;  5A5Q A;  5FFV A;  3O37 A;  5E9M A;  4O7C A;  4OGJ A;  5DFD A;  5CP5 A;  5A5P A;  5HLS A;  4J1P A;  2L85 A;  4YBS A;  4Y03 A;  4ALG A;  3RCW A;  3IU5 A;  5CQ6 A;  5LJ2 A;  4YAB A;  5FBX A;  4PY6 A;  5L97 A;  4Z93 A;  3U5N A;  4QR5 A;  5D7X A;  4O78 A;  5F60 A;  4QEU A;  3I3J A;  5EK9 A;  4KV4 A;  5EM3 A;  4KV1 A;  5EWH A;  4LZR A;  4WIV A;  5EIC A;  5ENJ A;  4NR7 A;  5EWW A;  3MB4 A;  5CQT A;  5F62 A;  4J0R A;  4TYL A;  5DLX A;  4UIY A;  2G4A A;  3DWY A;  5HQ7 A;  3O36 A;  4QUU A;  5HM0 A;  2WP1 A;  5DW1 A;  5A81 A;  3S92 A;  5D24 A;  4CLB A;  5KO4 A;  2N9G A;  5CQ7 A;  5F1H A;  5E9V A;  5CRZ A;  2YQD A;  3SVF A;  4LYW A;  4HXR A;  5ENH A;  5FE2 A;  4A9F A;  5FG6 A;  2L84 A;  5HRV A;  5IID A;  5C7N A;  4A9E A;  5I1Q A;  5D26 A;  5L99 A;  5CUA A;  2R0Y A;  5FE8 A;  5ENG A;  5CY9 A;  5DYX A;  4CUP A;  2E7N A;  4IR4 A;  2MJV B;  5C87 A;  4YYD A;  5COI A;  4NXJ A;  5E9K A;  5LVQ A;  5FG5 A;  5E0R A;  3D7C A;  4ZW1 A;  2RNX A;  5CUB A;  4IR6 A;  4BW4 A;  2DVQ A;  3U5P A;  1E6I A;  5DBM A;  5JWM A;  5IGK A;  5IGL A;  2OUO A;  5DFC A;  5DYA A;  4TZ8 A;  1EQF A;  4HXS A;  2DWW A;  4O70 A;  4QR4 A;  5I89 A;  3ONI A;  5FB0 A;  5H1T A;  4NRC A;  4YBM A;  4QSX A;  2F6N A;  5G4R A;  4CUT A;  5EU1 A;  4HXP A;  5KU3 A;  4O71 A;  5A82 A;  4YAD A;  4YC9 A;  3SVG A;  2YEL A;  4QB3 A;  2YDW A;  2NXB A;  3JVL A;  5DY7 A;  4CFK A;  4O74 A;  5CQ3 A;  4TT2 A;  5F3A A;  2I7K A;  3MQM A;  4TQN A;  3G0J A;  4YY6 A;  3U5K A;  4MEP A;  3P1E A;  4YH3 A;  5CZG A;  5D3P A;  2FSA A;  5D3N A;  5ENF A;  3Q2F A;  4IOQ A;  5I29 A;  5FH7 A;  5CUD A;  4Z6I A;  5EA1 A;  5HCL A;  4QSU A;  5HQ5 A;  4HXO A;  4LZS A;  5AD2 A;  5EPR A;  4O7E A;  5HEM A;  5HFR A;  5FE3 A;  5C8G A;  5FFY A;  5LUU A;  5A5R A;  4XUB A;  4UYD A;  4O76 A;  5F25 A;  4YYI A;  5IGN A;  4YYH A;  4XY9 A;  5TCM A;  3K2J A;  4QBM A;  5D3J A;  4MR6 A;  4UYG A;  5DKC A;  2E7O A;  4RVR A;  5LKZ A;  4CL9 A;  5KHM A;  5CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...