2DVRA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvrA00
4NUDA 4QZSA 5KTXA 4HXSA 4DONA 5DYAA 5E7DA 3K2JA 4ZC9A 4WIVA 4QR5A 3O35A 4NR8A 5L8UA 4QSRA 2RO1A 5LUUA 2YW5A 5FE2A 3IU6A 2R0YA 4TU6A 5E73A 5DW2A 3AADA 4CUTA 5FB0A 5ETBA 4NR7A 4HBVA 5I83A 5HFQA 4QB3A 4N4HA 5E9LA 5EISA 5EU1A 5A5RA 4LC2A 5E74A 5HM0A 3Q2FA 5A81A 4A9MA 5IGMA 2OO1A 3IU5A 5D3LA 4YYMA 2L5EA 4LZ2A 5DW1A 4CUSA 3U5LA 2NXBA 2YELA 4RVRA 4YK0A 2L84A 5E9YA 5FH8A 5EPBA 5LKUA 5F62A 2D82A 4UYGA 4TT2A 5A5QA 5ENHA 5J0DA 4YATA 4NRAA 4Q0OA 3P1FA 2OUOA 3UV2A 4A9HA 5E0RA 5CUEA 4QSQA 3O33A 4XYAA 4LZRA 5DFCA 4YYJA 5A5SA 4UYFB 5CP5A 1EQFA 4KV4A 4ALHA 4PCEA 4YH3A 5HEMA 5DY7A 4BW1A 3NXBA 4E96A 1E6IA 4NR6A 4HXPA 4YBSA 5A7CA 4YYHA 2N9GA 3SVFA 5CQTA 5CUDA 4UIVA 4HXKA 4NR9A 4TQNA 4A9NA 5L99A 4MENA 4HBWA 5I40A 4MEOA 5IG6A 4IORA 4CL9A 4UIYA 5I7YA 4UYEA 5HRVA 4CURA 5ENGA 5L97A 4PY6A 5FE3A 5I86A 5CQ4A 4CUPA 4AKNA 2DVRA 4YYKA 4N4IA 5CGPA 4Z6IA 5DFDA 4F3IA 4QUTA 4UIXA 2DVQA 5LJ1A 3UV4A 4NQNA 2D9EA 4OUFA 4TZ8A 2I8NA 4LR6A 3I3JA 5C7NA 5I88A 4WHWA 5A82A 5C4QA 3JVLA 5DLXA 3U5JA 5AD3A 3UW9A 4QSVA 4IR5A 5EWDA 2G4AA 5FG4A 4YADA 5CPEA 5HRXA 4YY6A 4YBMA 3G0LA 3MUKA 5FG6A 4N4GA 5I89A 4GPJA 4TU4A 3U5MA 5CZGA 3RCWA 5LKXA 3UVYA 4QYLA 5EGUA 4O7AA 2YYNA 5HQ6A 5CU8A 3D7CA 5LVRA 5ENCA 3MB3A 5CTLA 5KTWA 5CUGA 4YYDA 5D25A 4QEWA 4QSPA 4O76A 2E7NA 5HFRA 4PCIA 5CQ5A 5EK9A 5HLSA 4NR5A 4MR4A 5CRZA 4TZ2A 5JI8A 4BW4A 5AMFA 5K29A 4QC3A 4N3WA 5H1VA 5BT4A 2RS9B 4QSXA 5HRWA 4NUCA 4LYSA 5ENBA 4QUUA 2E7OA 4O78A 4O7CA 4QSUA 4PTBA 5CQ6A 4A9JA 3MB4A 3MULA 2MJVB 5CRMA 5A5PA 4J1PA 4UITA 5FE7A 5A5NA 3QZVA 5F63A 4A9OA 5LKTA 2LSPB 4UIUA 4LRGA 5H1TA 4QR3A 4YYNA 5IGKA 5KTUA 1N72A 4LYIA 4O7BA 5CQ8A 3P1DA 4YC9A 5E9IA 5A85A 4YAXA 5F1LA 3LQJA 5FE0A 3P1CA 4QY4A 4PS5A 5FE5A 4CLBA 3ZYUA 1WUGA 5G4SA 4IR4A 4YBTA 5E9MA 4TYLA 4C66A 5C87A 3O34A 4FLPA 4CFLA 4LDFA 4O70A 5A5OA 5DYUA 4IOOA 4J3IA 2R10A 1JM4B 5ENFA 4O71A 5D3PA 5HELA 5II1A 5FE6A 5C89A 5D3RA 4QSWA 4Q0NA 4CUUA 5DKCA 5CUAA 4IR6A 5DYCA 4XY8A 3Q2EA 5IBNA 5FBXA 5F61A 4YY4A 5IIDA 5F3AA 5H85A 2DVVA 5ENEA 4NS5A 4MR3A 4A9KA 3U5PA 4CUQA 4HBYA 5EWVA 5DFBA 5D26A 4MR5A 5EPRA 5I29A 5COIA 5E3GA 4QNSA 4O7FA 5TB6A 5CFWA 5BT5A 5DKHA 5F60A 5F5ZA 3FKMX 5D3JA 3LQIA 3TLPA 4ZW1A 5CUBA 4ZQLA 4A9FA 2RNWA 4X2IA 5KHMA 4KV1A 4LZSA 4PKLA 2WP1A 3ONIA 5EPSA 4J0RA 1X0JA 5HJCA 4NYVA 5G4RA 5ETDA 5JWMA 5L8TA 5FG5A 5CS8A 5BT3A 1WUMA 2OSSA 4N4FA 4O72A 4NRBA 3SVGA 4TS8A 3MXFA 4Z1SA 4HXNA 5DYXA 3U5OA 4QEUA 4BW2A 4HXMA 5HENA 5C85A 5AD2A 2H60A 4QSTA 4UIZA 3UVXA 5I80A 5D7XA 4O7EA 5IGLA 5EM3A 5E9VA 4C67A 4YABA 5CQAA 5FE4A 2RI7A 2DWWA 4OGIA 4A9LA 5EQ1A 2F6NA 3HMEA 2DVSA 5EWWA 3U5KA 5FFWA 5A83A 5LVQA 5EWCA 4MEQA 2I7KA 5CQ7A 4NR4A 5D3HA 3DWYA 3AQAA 4QBMA 2F6JA 2E3KA 4Z1QA 5LJ2A 5FFVA 3P5OA 5II2A 2WP2A 5ACYA 2FSAA 4HBXA 5I7XA 5TCMA 5FE9A 2YQDA 5FDZA 3QZSA 4IOQA 5D3NA 2R0VA 5LKZA 5FB1A 4NRCA 4NQMA 3QZTA 5KU3A 5EWHA 4O74A 3S92A 4QR4A 3JVJA 3UV5A 5E9KA 4QSSA 4BW3A 1JSPB 5IGNA 4NUEA 2YDWA 3P1EA 5FH6A 5DBMA 4TTEA 3GG3A 5L98A 4MEPA 5EV9A 4TT4A 3JVKA 4YYIA 5AMEA 5LJ0A 5EP7A 4OGJA 3UVDA 4XUBA 4O77A 3UVWA 3O36A 5DLZA 5I1QA 3JVMA 4HXLA 5HQ7A 5FE8A 5FFYA 5HQ5A 5D3TA 2DATA 2R0SA 4Y03A 3S91A 1F68A 4QC1A 5HCLA 3U5NA 2DKWA 4XY9A 4TT6A 5EVAA 4QYDA 3HMHA 3G0JA 5DKDA 5E3DA 4LYWA 4UIWA 4XUAA 4NXJA 4Z93A 5F25A 2GRCA 4KCXA 4A9EA 5CUCA 4BJXA 5FE1A 5DX4A 5EICA 4NYWA 2RFJA 4O75A 4HXRA 4HXOA 3SVHA 5F36A 5D3SA 5KO4A 5FH7A 5CY9A 3HMFA 3DAIA 2L85A 4CFKA 5F1HA 5H1UA 5D0CA 3LQHA 4MR6A 3MQMA 2KTBB 4IR3A 4QEVA 3LJWA 4UYFA 2YEKA 4UYDA 2RNXA 5CQ3A 5F2PA 3LXJA 4YYGA 5EI4A 4J0SA 4NYXA 4WHUA 5ENJA 5L96A 4YH4A 4A9IA 1ZS5A 2RNYA 4ALGA 2YEMA 3O37A 4BHWA 4Z6HA 5ENIA 5EA1A 5C8GA 4UYHA 5D24A
chains in the Genus database with same CATH superfamily
4NUDA 4QZSA 5KTXA 4HXSA 4DONA 5DYAA 5E7DA 3K2JA 4ZC9A 4WIVA 4QR5A 3O35A 4NR8A 5L8UA 4QSRA 2RO1A 5LUUA 2YW5A 5FE2A 3IU6A 2R0YA 4TU6A 5E73A 5DW2A 3AADA 4CUTA 5FB0A 5ETBA 4NR7A 4HBVA 5I83A 5HFQA 4QB3A 4N4HA 5E9LA 5EISA 5EU1A 5A5RA 4LC2A 5E74A 5HM0A 3Q2FA 5A81A 4A9MA 5IGMA 2OO1A 3IU5A 5D3LA 4YYMA 2L5EA 4LZ2A 5DW1A 4CUSA 3U5LA 2NXBA 2YELA 4RVRA 4YK0A 2L84A 5E9YA 5FH8A 5EPBA 5LKUA 5F62A 2D82A 4UYGA 4TT2A 5A5QA 5ENHA 5J0DA 4YATA 4NRAA 4Q0OA 3P1FA 2OUOA 3UV2A 4A9HA 5E0RA 5CUEA 4QSQA 3O33A 4XYAA 4LZRA 5DFCA 4YYJA 5A5SA 4UYFB 5CP5A 1EQFA 4KV4A 4ALHA 4PCEA 4YH3A 3VKHA 5HEMA 5DY7A 4BW1A 3NXBA 4E96A 1E6IA 4NR6A 4HXPA 4YBSA 5A7CA 4YYHA 2N9GA 3SVFA 5CQTA 5CUDA 4UIVA 4HXKA 4NR9A 4TQNA 4A9NA 5L99A 4MENA 4HBWA 5I40A 4MEOA 5IG6A 4IORA 4CL9A 4UIYA 5I7YA 4UYEA 5HRVA 4CURA 5ENGA 5L97A 4PY6A 5FE3A 5I86A 5CQ4A 4CUPA 4AKNA 2DVRA 4YYKA 4N4IA 5CGPA 4Z6IA 5DFDA 4F3IA 4QUTA 4UIXA 2DVQA 5LJ1A 3UV4A 4NQNA 2D9EA 4TZ8A 4OUFA 2I8NA 4LR6A 3I3JA 5C7NA 5I88A 4WHWA 5A82A 5C4QA 3JVLA 5DLXA 3U5JA 5AD3A 3UW9A 4QSVA 4IR5A 5EWDA 3D1BA 2G4AA 5FG4A 4YADA 5CPEA 5HRXA 4YY6A 4YBMA 3G0LA 3MUKA 5FG6A 4N4GA 5I89A 4GPJA 4TU4A 3U5MA 5CZGA 3RCWA 5LKXA 3UVYA 4QYLA 5EGUA 4O7AA 2YYNA 5HQ6A 5CU8A 3D7CA 5LVRA 5ENCA 3MB3A 5CTLA 5KTWA 5CUGA 4YYDA 5D25A 4QEWA 4QSPA 4O76A 2E7NA 5HFRA 4PCIA 1PUOA 5CQ5A 5EK9A 5HLSA 4NR5A 4MR4A 5CRZA 4TZ2A 5JI8A 4BW4A 5AMFA 5K29A 4QC3A 4N3WA 5H1VA 5BT4A 2RS9B 4QSXA 5HRWA 4NUCA 4LYSA 5ENBA 4QUUA 2E7OA 4O78A 4O7CA 4QSUA 4PTBA 5CQ6A 4A9JA 3MB4A 3MULA 2MJVB 5CRMA 5A5PA 4J1PA 4UITA 5FE7A 5A5NA 3QZVA 5F63A 4A9OA 5LKTA 2LSPB 4UIUA 4LRGA 5H1TA 4QR3A 4YYNA 5IGKA 5KTUA 1N72A 4LYIA 4O7BA 5CQ8A 3P1DA 4YC9A 5E9IA 5A85A 4YAXA 5F1LA 3LQJA 5FE0A 3P1CA 4QY4A 4PS5A 5FE5A 4CLBA 3ZYUA 1WUGA 5G4SA 4IR4A 4YBTA 2EJNA 5E9MA 4TYLA 4C66A 5C87A 3O34A 4FLPA 4CFLA 4LDFA 4O70A 5A5OA 5DYUA 4IOOA 4J3IA 2R10A 1JM4B 5ENFA 4O71A 5D3PA 5HELA 5II1A 5FE6A 4AKGA 5C89A 5D3RA 4QSWA 4Q0NA 4CUUA 5DKCA 5CUAA 4IR6A 5DYCA 4XY8A 3Q2EA 5IBNA 5FBXA 3VKGA 5F61A 4YY4A 5IIDA 5F3AA 5H85A 2DVVA 5ENEA 4NS5A 4MR3A 4A9KA 3U5PA 4CUQA 4HBYA 5EWVA 5DFBA 5D26A 4MR5A 5EPRA 5I29A 5COIA 5E3GA 4QNSA 4O7FA 5TB6A 5CFWA 5BT5A 5DKHA 5F60A 5F5ZA 3FKMX 5D3JA 3LQIA 3TLPA 4ZW1A 5CUBA 4ZQLA 4A9FA 2RNWA 4X2IA 5KHMA 4KV1A 4LZSA 4PKLA 2WP1A 3ONIA 5EPSA 4J0RA 1X0JA 5HJCA 4NYVA 5G4RA 5ETDA 5JWMA 5L8TA 5FG5A 5CS8A 5BT3A 1WUMA 2OSSA 4N4FA 4O72A 4NRBA 3SVGA 4TS8A 3MXFA 4Z1SA 4HXNA 5DYXA 3U5OA 4QEUA 4BW2A 4HXMA 5HENA 5C85A 5AD2A 2H60A 4QSTA 4UIZA 3UVXA 5I80A 5D7XA 4O7EA 5IGLA 5EM3A 5E9VA 3ERRA 4C67A 4YABA 5CQAA 5FE4A 2RI7A 2DWWA 4OGIA 4A9LA 5EQ1A 2F6NA 3HMEA 2DVSA 4AI6A 5EWWA 3U5KA 5FFWA 5A83A 5LVQA 5EWCA 4MEQA 2I7KA 5CQ7A 4NR4A 5D3HA 3DWYA 3AQAA 4QBMA 2F6JA 2E3KA 4Z1QA 5LJ2A 5FFVA 3P5OA 5II2A 2WP2A 5ACYA 2FSAA 4HBXA 5I7XA 5TCMA 5FE9A 2YQDA 5FDZA 3QZSA 4IOQA 5D3NA 2R0VA 5LKZA 5FB1A 4NRCA 4NQMA 3QZTA 5KU3A 5EWHA 4O74A 3S92A 4QR4A 3JVJA 3UV5A 5E9KA 4QSSA 4BW3A 1JSPB 5IGNA 4NUEA 2YDWA 3P1EA 5FH6A 5DBMA 4TTEA 3GG3A 5L98A 4MEPA 1ZKRA 5EV9A 4TT4A 3JVKA 4YYIA 5AMEA 5LJ0A 5EP7A 4OGJA 3UVDA 4XUBA 4O77A 3UVWA 3O36A 5DLZA 5I1QA 4AKHA 3JVMA 4HXLA 5HQ7A 5FE8A 5FFYA 5HQ5A 5D3TA 2DATA 2R0SA 4AKIA 4Y03A 3S91A 1F68A 4QC1A 5HCLA 3U5NA 2DKWA 4XY9A 4TT6A 5EVAA 4QYDA 3HMHA 3G0JA 5DKDA 5E3DA 4LYWA 4UIWA 4XUAA 4NXJA 4Z93A 5F25A 2GRCA 4KCXA 4A9EA 5CUCA 4BJXA 5FE1A 5DX4A 5EICA 4NYWA 2RFJA 4O75A 4HXRA 4HXOA 3SVHA 5F36A 5D3SA 5KO4A 5FH7A 5CY9A 3HMFA 3DAIA 2L85A 4CFKA 5F1HA 5H1UA 5D0CA 3LQHA 4MR6A 3MQMA 2KTBB 4IR3A 4QEVA 3LJWA 4UYFA 2YEKA 4UYDA 2RNXA 5CQ3A 5F2PA 3LXJA 4YYGA 5EI4A 4J0SA 4NYXA 4WHUA 5ENJA 5L96A 4YH4A 4A9IA 1ZS5A 2RNYA 4ALGA 2YEMA 3O37A 4BHWA 4Z6HA 5ENIA 5EA1A 5C8GA 3D1DA 4UYHA 5D24A
chains in the Genus database with same CATH topology
4NUDA 4QZSA 5KTXA 4HXSA 4DONA 5DYAA 5E7DA 3K2JA 4ZC9A 4WIVA 4QR5A 3O35A 4NR8A 5L8UA 4QSRA 2RO1A 5LUUA 2YW5A 5FE2A 3IU6A 2R0YA 4TU6A 5E73A 5DW2A 3AADA 4CUTA 5FB0A 5ETBA 4NR7A 4HBVA 5I83A 5HFQA 4QB3A 4N4HA 5E9LA 5EISA 5EU1A 5A5RA 4LC2A 5E74A 5HM0A 3Q2FA 5A81A 4A9MA 5IGMA 2OO1A 3IU5A 5D3LA 4YYMA 2L5EA 4LZ2A 5DW1A 4CUSA 3U5LA 2NXBA 2YELA 4RVRA 4YK0A 2L84A 5E9YA 5FH8A 5EPBA 5LKUA 5F62A 2D82A 4UYGA 4TT2A 5A5QA 5ENHA 5J0DA 4YATA 4NRAA 4Q0OA 3P1FA 2OUOA 3UV2A 4A9HA 5E0RA 5CUEA 4QSQA 3O33A 4XYAA 4LZRA 5DFCA 4YYJA 5A5SA 4UYFB 5CP5A 1EQFA 4KV4A 4ALHA 4PCEA 4YH3A 5HEMA 5DY7A 4BW1A 3NXBA 4E96A 1E6IA 4NR6A 4HXPA 4YBSA 5A7CA 4YYHA 2N9GA 3SVFA 5CQTA 5CUDA 4UIVA 4HXKA 4NR9A 4TQNA 4A9NA 5L99A 4MENA 4HBWA 5I40A 4MEOA 5IG6A 4IORA 4CL9A 4UIYA 5I7YA 4UYEA 5HRVA 4CURA 5ENGA 5L97A 4PY6A 5FE3A 5I86A 5CQ4A 4CUPA 4AKNA 2DVRA 4YYKA 4N4IA 5CGPA 4Z6IA 5DFDA 4F3IA 4QUTA 4UIXA 2DVQA 5LJ1A 3UV4A 4NQNA 2D9EA 4OUFA 4TZ8A 2I8NA 4LR6A 3I3JA 5C7NA 5I88A 4WHWA 5A82A 5C4QA 3JVLA 5DLXA 3U5JA 5AD3A 3UW9A 4QSVA 4IR5A 5EWDA 2G4AA 5FG4A 4YADA 5CPEA 5HRXA 4YY6A 4YBMA 3G0LA 3MUKA 5FG6A 4N4GA 5I89A 4GPJA 4TU4A 3U5MA 5CZGA 3RCWA 5LKXA 3UVYA 4QYLA 5EGUA 4O7AA 2YYNA 5HQ6A 5CU8A 3D7CA 5LVRA 5ENCA 3MB3A 5CTLA 5KTWA 5CUGA 4YYDA 5D25A 4QEWA 4QSPA 4O76A 2E7NA 5HFRA 4PCIA 5CQ5A 5EK9A 5HLSA 4NR5A 4MR4A 5CRZA 4TZ2A 5JI8A 4BW4A 5AMFA 5K29A 4QC3A 4N3WA 5H1VA 5BT4A 2RS9B 4QSXA 5HRWA 4NUCA 4LYSA 5ENBA 4QUUA 2E7OA 4O78A 4O7CA 4QSUA 4PTBA 5CQ6A 4A9JA 3MB4A 3MULA 2MJVB 5CRMA 5A5PA 4J1PA 4UITA 5FE7A 5A5NA 3QZVA 5F63A 4A9OA 5LKTA 2LSPB 4UIUA 4LRGA 5H1TA 4QR3A 4YYNA 5IGKA 5KTUA 1N72A 4LYIA 4O7BA 5CQ8A 3P1DA 4YC9A 5E9IA 5A85A 4YAXA 5F1LA 3LQJA 5FE0A 3P1CA 4QY4A 4PS5A 5FE5A 4CLBA 3ZYUA 1WUGA 5G4SA 4IR4A 4YBTA 5E9MA 4TYLA 4C66A 5C87A 3O34A 4FLPA 4CFLA 4LDFA 4O70A 5A5OA 5DYUA 4IOOA 4J3IA 2R10A 1JM4B 5ENFA 4O71A 5D3PA 5HELA 5II1A 5FE6A 5C89A 5D3RA 4QSWA 4Q0NA 4CUUA 5DKCA 5CUAA 4IR6A 5DYCA 4XY8A 3Q2EA 5IBNA 5FBXA 5F61A 4YY4A 5IIDA 5F3AA 5H85A 2DVVA 5ENEA 4NS5A 4MR3A 4A9KA 3U5PA 4CUQA 4HBYA 5EWVA 5DFBA 5D26A 4MR5A 5EPRA 5I29A 5COIA 5E3GA 4QNSA 4O7FA 5TB6A 5CFWA 5BT5A 5DKHA 5F60A 5F5ZA 3FKMX 5D3JA 3LQIA 3TLPA 4ZW1A 5CUBA 4ZQLA 4A9FA 2RNWA 4X2IA 5KHMA 4KV1A 4LZSA 4PKLA 2WP1A 3ONIA 5EPSA 4J0RA 1X0JA 5HJCA 4NYVA 5G4RA 5ETDA 5JWMA 5L8TA 5FG5A 5CS8A 5BT3A 1WUMA 2OSSA 4N4FA 4O72A 4NRBA 3SVGA 4TS8A 3MXFA 4Z1SA 4HXNA 5DYXA 3U5OA 4QEUA 4BW2A 4HXMA 5HENA 5C85A 5AD2A 2H60A 4QSTA 4UIZA 3UVXA 5I80A 5D7XA 4O7EA 5IGLA 5EM3A 5E9VA 4C67A 4YABA 5CQAA 5FE4A 2RI7A 2DWWA 4OGIA 4A9LA 5EQ1A 2F6NA 3HMEA 2DVSA 5EWWA 3U5KA 5FFWA 5A83A 5LVQA 5EWCA 4MEQA 2I7KA 5CQ7A 4NR4A 5D3HA 3DWYA 3AQAA 4QBMA 2F6JA 2E3KA 4Z1QA 5LJ2A 5FFVA 3P5OA 5II2A 2WP2A 5ACYA 2FSAA 4HBXA 5I7XA 5TCMA 5FE9A 2YQDA 5FDZA 3QZSA 4IOQA 5D3NA 2R0VA 5LKZA 5FB1A 4NRCA 4NQMA 3QZTA 5KU3A 5EWHA 4O74A 3S92A 4QR4A 3JVJA 3UV5A 5E9KA 4QSSA 4BW3A 1JSPB 5IGNA 4NUEA 2YDWA 3P1EA 5FH6A 5DBMA 4TTEA 3GG3A 5L98A 4MEPA 5EV9A 4TT4A 3JVKA 4YYIA 5AMEA 5LJ0A 5EP7A 4OGJA 3UVDA 4XUBA 4O77A 3UVWA 3O36A 5DLZA 5I1QA 3JVMA 4HXLA 5HQ7A 5FE8A 5FFYA 5HQ5A 5D3TA 2DATA 2R0SA 4Y03A 3S91A 1F68A 4QC1A 5HCLA 3U5NA 2DKWA 4XY9A 4TT6A 5EVAA 4QYDA 3HMHA 3G0JA 5DKDA 5E3DA 4LYWA 4UIWA 4XUAA 4NXJA 4Z93A 5F25A 2GRCA 4KCXA 4A9EA 5CUCA 4BJXA 5FE1A 5DX4A 5EICA 4NYWA 2RFJA 4O75A 4HXRA 4HXOA 3SVHA 5F36A 5D3SA 5KO4A 5FH7A 5CY9A 3HMFA 3DAIA 2L85A 4CFKA 5F1HA 5H1UA 5D0CA 3LQHA 4MR6A 3MQMA 2KTBB 4IR3A 4QEVA 3LJWA 4UYFA 2YEKA 4UYDA 2RNXA 5CQ3A 5F2PA 3LXJA 4YYGA 5EI4A 4J0SA 4NYXA 4WHUA 5ENJA 5L96A 4YH4A 4A9IA 1ZS5A 2RNYA 4ALGA 2YEMA 3O37A 4BHWA 4Z6HA 5ENIA 5EA1A 5C8GA 4UYHA 5D24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUD A;  4QZS A;  5KTX A;  4HXS A;  4DON A;  5DYA A;  5E7D A;  3K2J A;  4ZC9 A;  4WIV A;  4QR5 A;  3O35 A;  4NR8 A;  5L8U A;  4QSR A;  2RO1 A;  5LUU A;  2YW5 A;  5FE2 A;  3IU6 A;  2R0Y A;  4TU6 A;  5E73 A;  5DW2 A;  3AAD A;  4CUT A;  5FB0 A;  5ETB A;  4NR7 A;  4HBV A;  5I83 A;  5HFQ A;  4QB3 A;  4N4H A;  5E9L A;  5EIS A;  5EU1 A;  5A5R A;  4LC2 A;  5E74 A;  5HM0 A;  3Q2F A;  5A81 A;  4A9M A;  5IGM A;  2OO1 A;  3IU5 A;  5D3L A;  4YYM A;  2L5E A;  4LZ2 A;  5DW1 A;  4CUS A;  3U5L A;  2NXB A;  2YEL A;  4RVR A;  4YK0 A;  2L84 A;  5E9Y A;  5FH8 A;  5EPB A;  5LKU A;  5F62 A;  2D82 A;  4UYG A;  4TT2 A;  5A5Q A;  5ENH A;  5J0D A;  4YAT A;  4NRA A;  4Q0O A;  3P1F A;  2OUO A;  3UV2 A;  4A9H A;  5E0R A;  5CUE A;  4QSQ A;  3O33 A;  4XYA A;  4LZR A;  5DFC A;  4YYJ A;  5A5S A;  4UYF B;  5CP5 A;  1EQF A;  4KV4 A;  4ALH A;  4PCE A;  4YH3 A;  5HEM A;  5DY7 A;  4BW1 A;  3NXB A;  4E96 A;  1E6I A;  4NR6 A;  4HXP A;  4YBS A;  5A7C A;  4YYH A;  2N9G A;  3SVF A;  5CQT A;  5CUD A;  4UIV A;  4HXK A;  4NR9 A;  4TQN A;  4A9N A;  5L99 A;  4MEN A;  4HBW A;  5I40 A;  4MEO A;  5IG6 A;  4IOR A;  4CL9 A;  4UIY A;  5I7Y A;  4UYE A;  5HRV A;  4CUR A;  5ENG A;  5L97 A;  4PY6 A;  5FE3 A;  5I86 A;  5CQ4 A;  4CUP A;  4AKN A;  2DVR A;  4YYK A;  4N4I A;  5CGP A;  4Z6I A;  5DFD A;  4F3I A;  4QUT A;  4UIX A;  2DVQ A;  5LJ1 A;  3UV4 A;  4NQN A;  2D9E A;  4OUF A;  4TZ8 A;  2I8N A;  4LR6 A;  3I3J A;  5C7N A;  5I88 A;  4WHW A;  5A82 A;  5C4Q A;  3JVL A;  5DLX A;  3U5J A;  5AD3 A;  3UW9 A;  4QSV A;  4IR5 A;  5EWD A;  2G4A A;  5FG4 A;  4YAD A;  5CPE A;  5HRX A;  4YY6 A;  4YBM A;  3G0L A;  3MUK A;  5FG6 A;  4N4G A;  5I89 A;  4GPJ A;  4TU4 A;  3U5M A;  5CZG A;  3RCW A;  5LKX A;  3UVY A;  4QYL A;  5EGU A;  4O7A A;  2YYN A;  5HQ6 A;  5CU8 A;  3D7C A;  5LVR A;  5ENC A;  3MB3 A;  5CTL A;  5KTW A;  5CUG A;  4YYD A;  5D25 A;  4QEW A;  4QSP A;  4O76 A;  2E7N A;  5HFR A;  4PCI A;  5CQ5 A;  5EK9 A;  5HLS A;  4NR5 A;  4MR4 A;  5CRZ A;  4TZ2 A;  5JI8 A;  4BW4 A;  5AMF A;  5K29 A;  4QC3 A;  4N3W A;  5H1V A;  5BT4 A;  2RS9 B;  4QSX A;  5HRW A;  4NUC A;  4LYS A;  5ENB A;  4QUU A;  2E7O A;  4O78 A;  4O7C A;  4QSU A;  4PTB A;  5CQ6 A;  4A9J A;  3MB4 A;  3MUL A;  2MJV B;  5CRM A;  5A5P A;  4J1P A;  4UIT A;  5FE7 A;  5A5N A;  3QZV A;  5F63 A;  4A9O A;  5LKT A;  2LSP B;  4UIU A;  4LRG A;  5H1T A;  4QR3 A;  4YYN A;  5IGK A;  5KTU A;  1N72 A;  4LYI A;  4O7B A;  5CQ8 A;  3P1D A;  4YC9 A;  5E9I A;  5A85 A;  4YAX A;  5F1L A;  3LQJ A;  5FE0 A;  3P1C A;  4QY4 A;  4PS5 A;  5FE5 A;  4CLB A;  3ZYU A;  1WUG A;  5G4S A;  4IR4 A;  4YBT A;  5E9M A;  4TYL A;  4C66 A;  5C87 A;  3O34 A;  4FLP A;  4CFL A;  4LDF A;  4O70 A;  5A5O A;  5DYU A;  4IOO A;  4J3I A;  2R10 A;  1JM4 B;  5ENF A;  4O71 A;  5D3P A;  5HEL A;  5II1 A;  5FE6 A;  5C89 A;  5D3R A;  4QSW A;  4Q0N A;  4CUU A;  5DKC A;  5CUA A;  4IR6 A;  5DYC A;  4XY8 A;  3Q2E A;  5IBN A;  5FBX A;  5F61 A;  4YY4 A;  5IID A;  5F3A A;  5H85 A;  2DVV A;  5ENE A;  4NS5 A;  4MR3 A;  4A9K A;  3U5P A;  4CUQ A;  4HBY A;  5EWV A;  5DFB A;  5D26 A;  4MR5 A;  5EPR A;  5I29 A;  5COI A;  5E3G A;  4QNS A;  4O7F A;  5TB6 A;  5CFW A;  5BT5 A;  5DKH A;  5F60 A;  5F5Z A;  3FKM X;  5D3J A;  3LQI A;  3TLP A;  4ZW1 A;  5CUB A;  4ZQL A;  4A9F A;  2RNW A;  4X2I A;  5KHM A;  4KV1 A;  4LZS A;  4PKL A;  2WP1 A;  3ONI A;  5EPS A;  4J0R A;  1X0J A;  5HJC A;  4NYV A;  5G4R A;  5ETD A;  5JWM A;  5L8T A;  5FG5 A;  5CS8 A;  5BT3 A;  1WUM A;  2OSS A;  4N4F A;  4O72 A;  4NRB A;  3SVG A;  4TS8 A;  3MXF A;  4Z1S A;  4HXN A;  5DYX A;  3U5O A;  4QEU A;  4BW2 A;  4HXM A;  5HEN A;  5C85 A;  5AD2 A;  2H60 A;  4QST A;  4UIZ A;  3UVX A;  5I80 A;  5D7X A;  4O7E A;  5IGL A;  5EM3 A;  5E9V A;  4C67 A;  4YAB A;  5CQA A;  5FE4 A;  2RI7 A;  2DWW A;  4OGI A;  4A9L A;  5EQ1 A;  2F6N A;  3HME A;  2DVS A;  5EWW A;  3U5K A;  5FFW A;  5A83 A;  5LVQ A;  5EWC A;  4MEQ A;  2I7K A;  5CQ7 A;  4NR4 A;  5D3H A;  3DWY A;  3AQA A;  4QBM A;  2F6J A;  2E3K A;  4Z1Q A;  5LJ2 A;  5FFV A;  3P5O A;  5II2 A;  2WP2 A;  5ACY A;  2FSA A;  4HBX A;  5I7X A;  5TCM A;  5FE9 A;  2YQD A;  5FDZ A;  3QZS A;  4IOQ A;  5D3N A;  2R0V A;  5LKZ A;  5FB1 A;  4NRC A;  4NQM A;  3QZT A;  5KU3 A;  5EWH A;  4O74 A;  3S92 A;  4QR4 A;  3JVJ A;  3UV5 A;  5E9K A;  4QSS A;  4BW3 A;  1JSP B;  5IGN A;  4NUE A;  2YDW A;  3P1E A;  5FH6 A;  5DBM A;  4TTE A;  3GG3 A;  5L98 A;  4MEP A;  5EV9 A;  4TT4 A;  3JVK A;  4YYI A;  5AME A;  5LJ0 A;  5EP7 A;  4OGJ A;  3UVD A;  4XUB A;  4O77 A;  3UVW A;  3O36 A;  5DLZ A;  5I1Q A;  3JVM A;  4HXL A;  5HQ7 A;  5FE8 A;  5FFY A;  5HQ5 A;  5D3T A;  2DAT A;  2R0S A;  4Y03 A;  3S91 A;  1F68 A;  4QC1 A;  5HCL A;  3U5N A;  2DKW A;  4XY9 A;  4TT6 A;  5EVA A;  4QYD A;  3HMH A;  3G0J A;  5DKD A;  5E3D A;  4LYW A;  4UIW A;  4XUA A;  4NXJ A;  4Z93 A;  5F25 A;  2GRC A;  4KCX A;  4A9E A;  5CUC A;  4BJX A;  5FE1 A;  5DX4 A;  5EIC A;  4NYW A;  2RFJ A;  4O75 A;  4HXR A;  4HXO A;  3SVH A;  5F36 A;  5D3S A;  5KO4 A;  5FH7 A;  5CY9 A;  3HMF A;  3DAI A;  2L85 A;  4CFK A;  5F1H A;  5H1U A;  5D0C A;  3LQH A;  4MR6 A;  3MQM A;  2KTB B;  4IR3 A;  4QEV A;  3LJW A;  4UYF A;  2YEK A;  4UYD A;  2RNX A;  5CQ3 A;  5F2P A;  3LXJ A;  4YYG A;  5EI4 A;  4J0S A;  4NYX A;  4WHU A;  5ENJ A;  5L96 A;  4YH4 A;  4A9I A;  1ZS5 A;  2RNY A;  4ALG A;  2YEM A;  3O37 A;  4BHW A;  4Z6H A;  5ENI A;  5EA1 A;  5C8G A;  4UYH A;  5D24 A; 
#chains in the Genus database with same CATH topology
 4NUD A;  4QZS A;  5KTX A;  4HXS A;  4DON A;  5DYA A;  5E7D A;  3K2J A;  4ZC9 A;  4WIV A;  4QR5 A;  3O35 A;  4NR8 A;  5L8U A;  4QSR A;  2RO1 A;  5LUU A;  2YW5 A;  5FE2 A;  3IU6 A;  2R0Y A;  4TU6 A;  5E73 A;  5DW2 A;  3AAD A;  4CUT A;  5FB0 A;  5ETB A;  4NR7 A;  4HBV A;  5I83 A;  5HFQ A;  4QB3 A;  4N4H A;  5E9L A;  5EIS A;  5EU1 A;  5A5R A;  4LC2 A;  5E74 A;  5HM0 A;  3Q2F A;  5A81 A;  4A9M A;  5IGM A;  2OO1 A;  3IU5 A;  5D3L A;  4YYM A;  2L5E A;  4LZ2 A;  5DW1 A;  4CUS A;  3U5L A;  2NXB A;  2YEL A;  4RVR A;  4YK0 A;  2L84 A;  5E9Y A;  5FH8 A;  5EPB A;  5LKU A;  5F62 A;  2D82 A;  4UYG A;  4TT2 A;  5A5Q A;  5ENH A;  5J0D A;  4YAT A;  4NRA A;  4Q0O A;  3P1F A;  2OUO A;  3UV2 A;  4A9H A;  5E0R A;  5CUE A;  4QSQ A;  3O33 A;  4XYA A;  4LZR A;  5DFC A;  4YYJ A;  5A5S A;  4UYF B;  5CP5 A;  1EQF A;  4KV4 A;  4ALH A;  4PCE A;  4YH3 A;  3VKH A;  5HEM A;  5DY7 A;  4BW1 A;  3NXB A;  4E96 A;  1E6I A;  4NR6 A;  4HXP A;  4YBS A;  5A7C A;  4YYH A;  2N9G A;  3SVF A;  5CQT A;  5CUD A;  4UIV A;  4HXK A;  4NR9 A;  4TQN A;  4A9N A;  5L99 A;  4MEN A;  4HBW A;  5I40 A;  4MEO A;  5IG6 A;  4IOR A;  4CL9 A;  4UIY A;  5I7Y A;  4UYE A;  5HRV A;  4CUR A;  5ENG A;  5L97 A;  4PY6 A;  5FE3 A;  5I86 A;  5CQ4 A;  4CUP A;  4AKN A;  2DVR A;  4YYK A;  4N4I A;  5CGP A;  4Z6I A;  5DFD A;  4F3I A;  4QUT A;  4UIX A;  2DVQ A;  5LJ1 A;  3UV4 A;  4NQN A;  2D9E A;  4TZ8 A;  4OUF A;  2I8N A;  4LR6 A;  3I3J A;  5C7N A;  5I88 A;  4WHW A;  5A82 A;  5C4Q A;  3JVL A;  5DLX A;  3U5J A;  5AD3 A;  3UW9 A;  4QSV A;  4IR5 A;  5EWD A;  3D1B A;  2G4A A;  5FG4 A;  4YAD A;  5CPE A;  5HRX A;  4YY6 A;  4YBM A;  3G0L A;  3MUK A;  5FG6 A;  4N4G A;  5I89 A;  4GPJ A;  4TU4 A;  3U5M A;  5CZG A;  3RCW A;  5LKX A;  3UVY A;  4QYL A;  5EGU A;  4O7A A;  2YYN A;  5HQ6 A;  5CU8 A;  3D7C A;  5LVR A;  5ENC A;  3MB3 A;  5CTL A;  5KTW A;  5CUG A;  4YYD A;  5D25 A;  4QEW A;  4QSP A;  4O76 A;  2E7N A;  5HFR A;  4PCI A;  1PUO A;  5CQ5 A;  5EK9 A;  5HLS A;  4NR5 A;  4MR4 A;  5CRZ A;  4TZ2 A;  5JI8 A;  4BW4 A;  5AMF A;  5K29 A;  4QC3 A;  4N3W A;  5H1V A;  5BT4 A;  2RS9 B;  4QSX A;  5HRW A;  4NUC A;  4LYS A;  5ENB A;  4QUU A;  2E7O A;  4O78 A;  4O7C A;  4QSU A;  4PTB A;  5CQ6 A;  4A9J A;  3MB4 A;  3MUL A;  2MJV B;  5CRM A;  5A5P A;  4J1P A;  4UIT A;  5FE7 A;  5A5N A;  3QZV A;  5F63 A;  4A9O A;  5LKT A;  2LSP B;  4UIU A;  4LRG A;  5H1T A;  4QR3 A;  4YYN A;  5IGK A;  5KTU A;  1N72 A;  4LYI A;  4O7B A;  5CQ8 A;  3P1D A;  4YC9 A;  5E9I A;  5A85 A;  4YAX A;  5F1L A;  3LQJ A;  5FE0 A;  3P1C A;  4QY4 A;  4PS5 A;  5FE5 A;  4CLB A;  3ZYU A;  1WUG A;  5G4S A;  4IR4 A;  4YBT A;  2EJN A;  5E9M A;  4TYL A;  4C66 A;  5C87 A;  3O34 A;  4FLP A;  4CFL A;  4LDF A;  4O70 A;  5A5O A;  5DYU A;  4IOO A;  4J3I A;  2R10 A;  1JM4 B;  5ENF A;  4O71 A;  5D3P A;  5HEL A;  5II1 A;  5FE6 A;  4AKG A;  5C89 A;  5D3R A;  4QSW A;  4Q0N A;  4CUU A;  5DKC A;  5CUA A;  4IR6 A;  5DYC A;  4XY8 A;  3Q2E A;  5IBN A;  5FBX A;  3VKG A;  5F61 A;  4YY4 A;  5IID A;  5F3A A;  5H85 A;  2DVV A;  5ENE A;  4NS5 A;  4MR3 A;  4A9K A;  3U5P A;  4CUQ A;  4HBY A;  5EWV A;  5DFB A;  5D26 A;  4MR5 A;  5EPR A;  5I29 A;  5COI A;  5E3G A;  4QNS A;  4O7F A;  5TB6 A;  5CFW A;  5BT5 A;  5DKH A;  5F60 A;  5F5Z A;  3FKM X;  5D3J A;  3LQI A;  3TLP A;  4ZW1 A;  5CUB A;  4ZQL A;  4A9F A;  2RNW A;  4X2I A;  5KHM A;  4KV1 A;  4LZS A;  4PKL A;  2WP1 A;  3ONI A;  5EPS A;  4J0R A;  1X0J A;  5HJC A;  4NYV A;  5G4R A;  5ETD A;  5JWM A;  5L8T A;  5FG5 A;  5CS8 A;  5BT3 A;  1WUM A;  2OSS A;  4N4F A;  4O72 A;  4NRB A;  3SVG A;  4TS8 A;  3MXF A;  4Z1S A;  4HXN A;  5DYX A;  3U5O A;  4QEU A;  4BW2 A;  4HXM A;  5HEN A;  5C85 A;  5AD2 A;  2H60 A;  4QST A;  4UIZ A;  3UVX A;  5I80 A;  5D7X A;  4O7E A;  5IGL A;  5EM3 A;  5E9V A;  3ERR A;  4C67 A;  4YAB A;  5CQA A;  5FE4 A;  2RI7 A;  2DWW A;  4OGI A;  4A9L A;  5EQ1 A;  2F6N A;  3HME A;  2DVS A;  4AI6 A;  5EWW A;  3U5K A;  5FFW A;  5A83 A;  5LVQ A;  5EWC A;  4MEQ A;  2I7K A;  5CQ7 A;  4NR4 A;  5D3H A;  3DWY A;  3AQA A;  4QBM A;  2F6J A;  2E3K A;  4Z1Q A;  5LJ2 A;  5FFV A;  3P5O A;  5II2 A;  2WP2 A;  5ACY A;  2FSA A;  4HBX A;  5I7X A;  5TCM A;  5FE9 A;  2YQD A;  5FDZ A;  3QZS A;  4IOQ A;  5D3N A;  2R0V A;  5LKZ A;  5FB1 A;  4NRC A;  4NQM A;  3QZT A;  5KU3 A;  5EWH A;  4O74 A;  3S92 A;  4QR4 A;  3JVJ A;  3UV5 A;  5E9K A;  4QSS A;  4BW3 A;  1JSP B;  5IGN A;  4NUE A;  2YDW A;  3P1E A;  5FH6 A;  5DBM A;  4TTE A;  3GG3 A;  5L98 A;  4MEP A;  1ZKR A;  5EV9 A;  4TT4 A;  3JVK A;  4YYI A;  5AME A;  5LJ0 A;  5EP7 A;  4OGJ A;  3UVD A;  4XUB A;  4O77 A;  3UVW A;  3O36 A;  5DLZ A;  5I1Q A;  4AKH A;  3JVM A;  4HXL A;  5HQ7 A;  5FE8 A;  5FFY A;  5HQ5 A;  5D3T A;  2DAT A;  2R0S A;  4AKI A;  4Y03 A;  3S91 A;  1F68 A;  4QC1 A;  5HCL A;  3U5N A;  2DKW A;  4XY9 A;  4TT6 A;  5EVA A;  4QYD A;  3HMH A;  3G0J A;  5DKD A;  5E3D A;  4LYW A;  4UIW A;  4XUA A;  4NXJ A;  4Z93 A;  5F25 A;  2GRC A;  4KCX A;  4A9E A;  5CUC A;  4BJX A;  5FE1 A;  5DX4 A;  5EIC A;  4NYW A;  2RFJ A;  4O75 A;  4HXR A;  4HXO A;  3SVH A;  5F36 A;  5D3S A;  5KO4 A;  5FH7 A;  5CY9 A;  3HMF A;  3DAI A;  2L85 A;  4CFK A;  5F1H A;  5H1U A;  5D0C A;  3LQH A;  4MR6 A;  3MQM A;  2KTB B;  4IR3 A;  4QEV A;  3LJW A;  4UYF A;  2YEK A;  4UYD A;  2RNX A;  5CQ3 A;  5F2P A;  3LXJ A;  4YYG A;  5EI4 A;  4J0S A;  4NYX A;  4WHU A;  5ENJ A;  5L96 A;  4YH4 A;  4A9I A;  1ZS5 A;  2RNY A;  4ALG A;  2YEM A;  3O37 A;  4BHW A;  4Z6H A;  5ENI A;  5EA1 A;  5C8G A;  3D1D A;  4UYH A;  5D24 A; 
#chains in the Genus database with same CATH homology
 4NUD A;  4QZS A;  5KTX A;  4HXS A;  4DON A;  5DYA A;  5E7D A;  3K2J A;  4ZC9 A;  4WIV A;  4QR5 A;  3O35 A;  4NR8 A;  5L8U A;  4QSR A;  2RO1 A;  5LUU A;  2YW5 A;  5FE2 A;  3IU6 A;  2R0Y A;  4TU6 A;  5E73 A;  5DW2 A;  3AAD A;  4CUT A;  5FB0 A;  5ETB A;  4NR7 A;  4HBV A;  5I83 A;  5HFQ A;  4QB3 A;  4N4H A;  5E9L A;  5EIS A;  5EU1 A;  5A5R A;  4LC2 A;  5E74 A;  5HM0 A;  3Q2F A;  5A81 A;  4A9M A;  5IGM A;  2OO1 A;  3IU5 A;  5D3L A;  4YYM A;  2L5E A;  4LZ2 A;  5DW1 A;  4CUS A;  3U5L A;  2NXB A;  2YEL A;  4RVR A;  4YK0 A;  2L84 A;  5E9Y A;  5FH8 A;  5EPB A;  5LKU A;  5F62 A;  2D82 A;  4UYG A;  4TT2 A;  5A5Q A;  5ENH A;  5J0D A;  4YAT A;  4NRA A;  4Q0O A;  3P1F A;  2OUO A;  3UV2 A;  4A9H A;  5E0R A;  5CUE A;  4QSQ A;  3O33 A;  4XYA A;  4LZR A;  5DFC A;  4YYJ A;  5A5S A;  4UYF B;  5CP5 A;  1EQF A;  4KV4 A;  4ALH A;  4PCE A;  4YH3 A;  5HEM A;  5DY7 A;  4BW1 A;  3NXB A;  4E96 A;  1E6I A;  4NR6 A;  4HXP A;  4YBS A;  5A7C A;  4YYH A;  2N9G A;  3SVF A;  5CQT A;  5CUD A;  4UIV A;  4HXK A;  4NR9 A;  4TQN A;  4A9N A;  5L99 A;  4MEN A;  4HBW A;  5I40 A;  4MEO A;  5IG6 A;  4IOR A;  4CL9 A;  4UIY A;  5I7Y A;  4UYE A;  5HRV A;  4CUR A;  5ENG A;  5L97 A;  4PY6 A;  5FE3 A;  5I86 A;  5CQ4 A;  4CUP A;  4AKN A;  2DVR A;  4YYK A;  4N4I A;  5CGP A;  4Z6I A;  5DFD A;  4F3I A;  4QUT A;  4UIX A;  2DVQ A;  5LJ1 A;  3UV4 A;  4NQN A;  2D9E A;  4OUF A;  4TZ8 A;  2I8N A;  4LR6 A;  3I3J A;  5C7N A;  5I88 A;  4WHW A;  5A82 A;  5C4Q A;  3JVL A;  5DLX A;  3U5J A;  5AD3 A;  3UW9 A;  4QSV A;  4IR5 A;  5EWD A;  2G4A A;  5FG4 A;  4YAD A;  5CPE A;  5HRX A;  4YY6 A;  4YBM A;  3G0L A;  3MUK A;  5FG6 A;  4N4G A;  5I89 A;  4GPJ A;  4TU4 A;  3U5M A;  5CZG A;  3RCW A;  5LKX A;  3UVY A;  4QYL A;  5EGU A;  4O7A A;  2YYN A;  5HQ6 A;  5CU8 A;  3D7C A;  5LVR A;  5ENC A;  3MB3 A;  5CTL A;  5KTW A;  5CUG A;  4YYD A;  5D25 A;  4QEW A;  4QSP A;  4O76 A;  2E7N A;  5HFR A;  4PCI A;  5CQ5 A;  5EK9 A;  5HLS A;  4NR5 A;  4MR4 A;  5CRZ A;  4TZ2 A;  5JI8 A;  4BW4 A;  5AMF A;  5K29 A;  4QC3 A;  4N3W A;  5H1V A;  5BT4 A;  2RS9 B;  4QSX A;  5HRW A;  4NUC A;  4LYS A;  5ENB A;  4QUU A;  2E7O A;  4O78 A;  4O7C A;  4QSU A;  4PTB A;  5CQ6 A;  4A9J A;  3MB4 A;  3MUL A;  2MJV B;  5CRM A;  5A5P A;  4J1P A;  4UIT A;  5FE7 A;  5A5N A;  3QZV A;  5F63 A;  4A9O A;  5LKT A;  2LSP B;  4UIU A;  4LRG A;  5H1T A;  4QR3 A;  4YYN A;  5IGK A;  5KTU A;  1N72 A;  4LYI A;  4O7B A;  5CQ8 A;  3P1D A;  4YC9 A;  5E9I A;  5A85 A;  4YAX A;  5F1L A;  3LQJ A;  5FE0 A;  3P1C A;  4QY4 A;  4PS5 A;  5FE5 A;  4CLB A;  3ZYU A;  1WUG A;  5G4S A;  4IR4 A;  4YBT A;  5E9M A;  4TYL A;  4C66 A;  5C87 A;  3O34 A;  4FLP A;  4CFL A;  4LDF A;  4O70 A;  5A5O A;  5DYU A;  4IOO A;  4J3I A;  2R10 A;  1JM4 B;  5ENF A;  4O71 A;  5D3P A;  5HEL A;  5II1 A;  5FE6 A;  5C89 A;  5D3R A;  4QSW A;  4Q0N A;  4CUU A;  5DKC A;  5CUA A;  4IR6 A;  5DYC A;  4XY8 A;  3Q2E A;  5IBN A;  5FBX A;  5F61 A;  4YY4 A;  5IID A;  5F3A A;  5H85 A;  2DVV A;  5ENE A;  4NS5 A;  4MR3 A;  4A9K A;  3U5P A;  4CUQ A;  4HBY A;  5EWV A;  5DFB A;  5D26 A;  4MR5 A;  5EPR A;  5I29 A;  5COI A;  5E3G A;  4QNS A;  4O7F A;  5TB6 A;  5CFW A;  5BT5 A;  5DKH A;  5F60 A;  5F5Z A;  3FKM X;  5D3J A;  3LQI A;  3TLP A;  4ZW1 A;  5CUB A;  4ZQL A;  4A9F A;  2RNW A;  4X2I A;  5KHM A;  4KV1 A;  4LZS A;  4PKL A;  2WP1 A;  3ONI A;  5EPS A;  4J0R A;  1X0J A;  5HJC A;  4NYV A;  5G4R A;  5ETD A;  5JWM A;  5L8T A;  5FG5 A;  5CS8 A;  5BT3 A;  1WUM A;  2OSS A;  4N4F A;  4O72 A;  4NRB A;  3SVG A;  4TS8 A;  3MXF A;  4Z1S A;  4HXN A;  5DYX A;  3U5O A;  4QEU A;  4BW2 A;  4HXM A;  5HEN A;  5C85 A;  5AD2 A;  2H60 A;  4QST A;  4UIZ A;  3UVX A;  5I80 A;  5D7X A;  4O7E A;  5IGL A;  5EM3 A;  5E9V A;  4C67 A;  4YAB A;  5CQA A;  5FE4 A;  2RI7 A;  2DWW A;  4OGI A;  4A9L A;  5EQ1 A;  2F6N A;  3HME A;  2DVS A;  5EWW A;  3U5K A;  5FFW A;  5A83 A;  5LVQ A;  5EWC A;  4MEQ A;  2I7K A;  5CQ7 A;  4NR4 A;  5D3H A;  3DWY A;  3AQA A;  4QBM A;  2F6J A;  2E3K A;  4Z1Q A;  5LJ2 A;  5FFV A;  3P5O A;  5II2 A;  2WP2 A;  5ACY A;  2FSA A;  4HBX A;  5I7X A;  5TCM A;  5FE9 A;  2YQD A;  5FDZ A;  3QZS A;  4IOQ A;  5D3N A;  2R0V A;  5LKZ A;  5FB1 A;  4NRC A;  4NQM A;  3QZT A;  5KU3 A;  5EWH A;  4O74 A;  3S92 A;  4QR4 A;  3JVJ A;  3UV5 A;  5E9K A;  4QSS A;  4BW3 A;  1JSP B;  5IGN A;  4NUE A;  2YDW A;  3P1E A;  5FH6 A;  5DBM A;  4TTE A;  3GG3 A;  5L98 A;  4MEP A;  5EV9 A;  4TT4 A;  3JVK A;  4YYI A;  5AME A;  5LJ0 A;  5EP7 A;  4OGJ A;  3UVD A;  4XUB A;  4O77 A;  3UVW A;  3O36 A;  5DLZ A;  5I1Q A;  3JVM A;  4HXL A;  5HQ7 A;  5FE8 A;  5FFY A;  5HQ5 A;  5D3T A;  2DAT A;  2R0S A;  4Y03 A;  3S91 A;  1F68 A;  4QC1 A;  5HCL A;  3U5N A;  2DKW A;  4XY9 A;  4TT6 A;  5EVA A;  4QYD A;  3HMH A;  3G0J A;  5DKD A;  5E3D A;  4LYW A;  4UIW A;  4XUA A;  4NXJ A;  4Z93 A;  5F25 A;  2GRC A;  4KCX A;  4A9E A;  5CUC A;  4BJX A;  5FE1 A;  5DX4 A;  5EIC A;  4NYW A;  2RFJ A;  4O75 A;  4HXR A;  4HXO A;  3SVH A;  5F36 A;  5D3S A;  5KO4 A;  5FH7 A;  5CY9 A;  3HMF A;  3DAI A;  2L85 A;  4CFK A;  5F1H A;  5H1U A;  5D0C A;  3LQH A;  4MR6 A;  3MQM A;  2KTB B;  4IR3 A;  4QEV A;  3LJW A;  4UYF A;  2YEK A;  4UYD A;  2RNX A;  5CQ3 A;  5F2P A;  3LXJ A;  4YYG A;  5EI4 A;  4J0S A;  4NYX A;  4WHU A;  5ENJ A;  5L96 A;  4YH4 A;  4A9I A;  1ZS5 A;  2RNY A;  4ALG A;  2YEM A;  3O37 A;  4BHW A;  4Z6H A;  5ENI A;  5EA1 A;  5C8G A;  4UYH A;  5D24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...