4NR6A

Crystal structure of the bromodomain of human crebbp in complex with an oxazepin ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with an oxazepin ligand
rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 42
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nr6A00
5HRXA 5FE0A 4CUTA 4QNSA 4BW4A 4A9NA 2DVSA 5AD2A 4A9KA 5ENBA 4BW2A 4J0SA 2E7NA 4UIYA 5A5RA 5D3TA 5EPRA 4LYIA 2LSPB 4HXKA 4MEOA 5E9IA 5KU3A 5DYXA 2F6JA 4A9JA 4QBMA 4QYDA 4QSTA 2RFJA 4LRGA 4LR6A 5I40A 5E9MA 4HXMA 2WP2A 5IG6A 4LYSA 4QSPA 3U5MA 4O7CA 2RI7A 5CUEA 4QSUA 4QEVA 4NRAA 4XY9A 3P1CA 4O76A 5EA1A 4RVRA 5CQ3A 4Q0OA 5ETBA 5LVQA 5L96A 5CRMA 4IR6A 4UYDA 5FB1A 5D7XA 4MR6A 1WUMA 3MB3A 4NUDA 5DKCA 5I83A 4TTEA 4PS5A 5ETDA 3DWYA 5LVRA 4KV1A 4UIZA 5FBXA 5C85A 3JVLA 3MQMA 3MUKA 4TT6A 5D3HA 3UV5A 4YADA 4IORA 1JSPB 5CQ4A 4XUAA 5TCMA 4QSSA 4J1PA 5DFCA 5EGUA 5AMEA 5D3NA 4TS8A 5E7DA 5F62A 5J0DA 4QSXA 4UIVA 5C4QA 5ENIA 4TT4A 3ZYUA 3LQHA 5HCLA 4QB3A 5F3AA 4IR5A 4LZSA 4NR4A 5DW1A 5I7YA 5I88A 4LZRA 5FE1A 3I3JA 3SVGA 5JI8A 5EQ1A 4HXOA 4QSRA 2YQDA 4YK0A 5EWDA 5F5ZA 2G4AA 5FE4A 4HBVA 5LKXA 4UIXA 3QZTA 5E3DA 2N9GA 2OO1A 5DX4A 4YABA 5LUUA 2RO1A 4LYWA 4N4GA 4YYIA 5H1TA 4BHWA 2R0SA 4CURA 3LXJA 4NR9A 5HQ6A 3AQAA 5DFBA 5F1LA 4QSQA 5CY9A 5C87A 5AMFA 5HQ5A 5CQTA 4ZQLA 4MEQA 5C7NA 4QUUA 4FLPA 4TYLA 4Z1SA 5DYAA 5I86A 2RS9B 5CQ7A 5LKTA 4PCEA 5E0RA 4HXSA 4A9LA 5L99A 4QR5A 4XYAA 5CTLA 3TLPA 5LJ0A 5CQ6A 5DLZA 2L85A 3SVHA 5ENGA 5ENJA 5CQ8A 4F3IA 4GPJA 5IGKA 4N3WA 4PY6A 4UIWA 4QSWA 4O71A 4YYKA 4O78A 4TU6A 5II2A 5JWMA 2WP1A 4TU4A 5L8TA 3UV4A 2DWWA 4OGJA 5FE9A 5DYCA 1WUGA 3S91A 2R0VA 5FE5A 4NXJA 5FH6A 5D3RA 4IOQA 5FFVA 4TZ2A 5FB0A 3LJWA 2FSAA 5BT5A 5A5QA 3QZSA 4YYHA 4YC9A 5HELA 4C67A 5D0CA 5FDZA 5HEMA 2YDWA 3MULA 5EV9A 3UVWA 5HENA 2RNYA 4QEUA 4QR3A 2DVVA 5F2PA 2R0YA 3P1EA 5IBNA 5AD3A 3IU6A 4YYMA 5D3JA 5KTUA 5EK9A 5L98A 1E6IA 4A9EA 1X0JA 5ENHA 4NQMA 5LKUA 2F6NA 4NYWA 2DVQA 3DAIA 5DLXA 4ALHA 4HXNA 4QUTA 5FE2A 5FG5A 5CUBA 5HFRA 3MB4A 4LDFA 4HBXA 5FE8A 4UYFA 4HXRA 5IGNA 4N4FA 1N72A 5CQAA 5FH7A 4O7EA 5KHMA 4Z6HA 3JVKA 4CFLA 3U5KA 5C89A 4NYVA 5DKHA 2H60A 3UV2A 4J3IA 4HBWA 4PTBA 4QZSA 3P1FA 4NS5A 4QC3A 5F36A 4Y03A 5FE3A 3O35A 5G4SA 2YEKA 4IR3A 1JM4B 4MR5A 4MR4A 4CUQA 4NYXA 4YY4A 2YELA 3LQIA 1F68A 5E74A 5CUGA 5EVAA 3U5NA 2RNWA 5EM3A 4YH3A 4TT2A 2YYNA 4YYJA 5CPEA 3U5OA 5A83A 4Z1QA 5D24A 3O36A 4YYNA 3U5JA 5A5NA 5E9KA 4ALGA 3O37A 5DW2A 5TB6A 3QZVA 3SVFA 5E9YA 4CFKA 5FE7A 3JVMA 4MR3A 4NUEA 2L5EA 5A5SA 4A9IA 4QC1A 4CLBA 2L84A 4XUBA 3G0JA 4TZ8A 4A9HA 5L8UA 5FH8A 4UYGA 4UYFB 4YBTA 5KO4A 4C66A 1ZS5A 5FG4A 4YY6A 4UYHA 4KV4A 5EWCA 5II1A 4X2IA 5F61A 3LQJA 5EISA 4NR7A 3UW9A 2I8NA 4CL9A 4NRBA 5EPSA 4A9FA 5A85A 5HRVA 4O72A 5FG6A 5I29A 2OSSA 5DBMA 4QSVA 5F1HA 5F60A 5CUAA 4E96A 5K29A 4O7BA 5D26A 4O74A 4AKNA 4O7AA 5E9VA 5COIA 3HMHA 2RNXA 4IOOA 2NXBA 4QEWA 4CUUA 5CUDA 5E73A 4N4HA 5EPBA 4YBMA 4O70A 4LZ2A 4YYGA 4NR8A 5A7CA 5A5OA 2YW5A 2KTBB 5KTWA 5EI4A 2DVRA 5CFWA 4O75A 3GG3A 4OGIA 5A82A 5D3LA 5IIDA 3NXBA 4QY4A 5ENCA 4YATA 4YAXA 4MEPA 5HRWA 5BT3A 5IGLA 5HLSA 4CUSA 5H1UA 5F63A 4UIUA 4NQNA 4Z6IA 4UITA 5CP5A 3IU5A 5DY7A 5A5PA 5I80A 5IGMA 4KCXA 4MENA 5FFYA 5DYUA 5ENFA 4YBSA 4HXPA 2R10A 4OUFA 5E9LA 5HM0A 5EICA 5CS8A 2GRCA 4Z93A 3UVXA 2MJVB 4YH4A 4WHUA 4NR5A 4HBYA 5HQ7A 4LC2A 2OUOA 4XY8A 5CU8A 4WIVA 4ZW1A 4Q0NA 5FFWA 2DKWA 3K2JA 4WHWA 3S92A 4IR4A 5HJCA 3HMEA 4NUCA 5LJ1A 3MXFA 5I1QA 4DONA 5I89A 5ACYA 2I7KA 3Q2EA 5E3GA 5EP7A 5EWVA 3UVYA 4BJXA 4QYLA 5EU1A 5G4RA 4PKLA 5F25A 3AADA 5LKZA 4BW1A 5EWHA 3RCWA 4O7FA 5CQ5A 4CUPA 5LJ2A 4A9MA 4PCIA 5KTXA 3ONIA 3P5OA 4TQNA 5D3PA 4O77A 4YYDA 5HFQA 5CUCA 5D3SA 5EWWA 2YEMA 5DKDA 5ENEA 3U5LA 4QR4A 3U5PA 5FE6A 4NRCA 4A9OA 4NR6A 5I7XA 4N4IA 3JVJA 5D25A 3D7CA 5C8GA 3O33A 4UYEA 3FKMX 3Q2FA 3HMFA 5A81A 2D82A 3UVDA 5DFDA 2D9EA 5CZGA 5H85A 1EQFA 3G0LA 4BW3A 3P1DA 4HXLA 5CRZA 5CGPA 3O34A 5BT4A 2DATA 2E7OA 2E3KA 5H1VA 4ZC9A 4J0RA 5L97A
chains in the Genus database with same CATH superfamily
5HRXA 5FE0A 4CUTA 4QNSA 4BW4A 4A9NA 2DVSA 5AD2A 4A9KA 5ENBA 4BW2A 4J0SA 2E7NA 4UIYA 5A5RA 5D3TA 5EPRA 4LYIA 2LSPB 4HXKA 4MEOA 5E9IA 5KU3A 5DYXA 2F6JA 4A9JA 4QBMA 4QYDA 4QSTA 2RFJA 4LRGA 4LR6A 5I40A 5E9MA 4HXMA 2WP2A 5IG6A 4LYSA 4QSPA 3U5MA 4O7CA 2RI7A 5CUEA 4QSUA 4QEVA 4NRAA 4XY9A 3P1CA 4O76A 5EA1A 4RVRA 5CQ3A 4Q0OA 5ETBA 5LVQA 5L96A 5CRMA 4IR6A 4UYDA 5FB1A 5D7XA 4MR6A 1WUMA 3MB3A 4NUDA 5DKCA 5I83A 4TTEA 4PS5A 5ETDA 3DWYA 5LVRA 4KV1A 4UIZA 5FBXA 5C85A 3JVLA 3MQMA 3VKGA 3MUKA 4TT6A 5D3HA 3UV5A 4YADA 4IORA 1JSPB 5CQ4A 4XUAA 5TCMA 4QSSA 4J1PA 5DFCA 5EGUA 5AMEA 5D3NA 4TS8A 5E7DA 5F62A 5J0DA 4QSXA 4UIVA 5C4QA 5ENIA 4TT4A 3ZYUA 3LQHA 5HCLA 4QB3A 5F3AA 4IR5A 4LZSA 4NR4A 5DW1A 5I7YA 5I88A 4LZRA 5FE1A 3I3JA 3SVGA 5JI8A 5EQ1A 4HXOA 4QSRA 2YQDA 4YK0A 5EWDA 5F5ZA 2G4AA 5FE4A 4HBVA 5LKXA 4UIXA 3QZTA 5E3DA 2N9GA 2OO1A 5DX4A 4YABA 5LUUA 2RO1A 4LYWA 4N4GA 4YYIA 5H1TA 4BHWA 2R0SA 4CURA 3LXJA 4NR9A 5HQ6A 3AQAA 5DFBA 3VKHA 5F1LA 4QSQA 5CY9A 5C87A 5AMFA 5HQ5A 5CQTA 4ZQLA 4MEQA 5C7NA 4QUUA 4FLPA 4TYLA 4Z1SA 5DYAA 5I86A 2RS9B 5CQ7A 4AKHA 5LKTA 4PCEA 5E0RA 4HXSA 4A9LA 5L99A 4QR5A 4XYAA 3D1DA 5CTLA 3TLPA 5LJ0A 5CQ6A 5DLZA 2L85A 3SVHA 5ENGA 5ENJA 5CQ8A 4F3IA 4GPJA 5IGKA 4N3WA 4PY6A 4UIWA 4QSWA 4O71A 4YYKA 4O78A 4TU6A 5II2A 5JWMA 2WP1A 4TU4A 5L8TA 3UV4A 2DWWA 4OGJA 5FE9A 5DYCA 1WUGA 3S91A 2R0VA 5FE5A 4NXJA 5FH6A 5D3RA 4IOQA 5FFVA 4TZ2A 5FB0A 3LJWA 2FSAA 5BT5A 5A5QA 3QZSA 4YYHA 4YC9A 5HELA 4C67A 5D0CA 5FDZA 5HEMA 2YDWA 3MULA 5EV9A 3UVWA 5HENA 2RNYA 4QEUA 4QR3A 2DVVA 5F2PA 2R0YA 3P1EA 5IBNA 5AD3A 3IU6A 4YYMA 5D3JA 5KTUA 5EK9A 5L98A 1E6IA 4A9EA 1X0JA 5ENHA 4AI6A 4NQMA 5LKUA 2F6NA 4NYWA 2DVQA 3DAIA 5DLXA 4ALHA 4HXNA 4QUTA 5FE2A 5FG5A 5CUBA 5HFRA 3MB4A 4LDFA 4HBXA 5FE8A 4UYFA 4HXRA 5IGNA 4N4FA 1N72A 5CQAA 5FH7A 2EJNA 4O7EA 5KHMA 4Z6HA 3JVKA 4CFLA 3U5KA 5C89A 4NYVA 5DKHA 2H60A 3UV2A 4AKGA 4J3IA 4HBWA 4PTBA 4QZSA 3P1FA 4NS5A 4QC3A 5F36A 4Y03A 5FE3A 3O35A 5G4SA 2YEKA 4IR3A 1JM4B 4MR5A 4MR4A 4CUQA 4NYXA 3ERRA 4YY4A 2YELA 3LQIA 1F68A 5E74A 5CUGA 5EVAA 3U5NA 2RNWA 5EM3A 4YH3A 4TT2A 2YYNA 4YYJA 5CPEA 3U5OA 5A83A 4Z1QA 5D24A 3O36A 4YYNA 3U5JA 5A5NA 5E9KA 4ALGA 3O37A 5DW2A 5TB6A 3QZVA 3SVFA 5E9YA 4CFKA 5FE7A 3JVMA 4MR3A 4NUEA 2L5EA 5A5SA 4A9IA 4QC1A 4CLBA 2L84A 4XUBA 3G0JA 4TZ8A 4A9HA 5L8UA 1PUOA 5FH8A 4UYGA 4UYFB 4YBTA 5KO4A 4C66A 1ZS5A 5FG4A 4YY6A 4UYHA 4KV4A 5EWCA 5II1A 4X2IA 5F61A 3LQJA 5EISA 4NR7A 3UW9A 2I8NA 4CL9A 4NRBA 5EPSA 4A9FA 5A85A 5HRVA 4O72A 5FG6A 5I29A 2OSSA 5DBMA 4QSVA 5F1HA 5F60A 5CUAA 4E96A 5K29A 4O7BA 5D26A 4O74A 4AKNA 4AKIA 4O7AA 5E9VA 5COIA 3HMHA 2RNXA 4IOOA 2NXBA 4QEWA 4CUUA 5CUDA 5E73A 4N4HA 5EPBA 4YBMA 4O70A 4LZ2A 4YYGA 4NR8A 5A7CA 5A5OA 2YW5A 2KTBB 5KTWA 5EI4A 2DVRA 5CFWA 4O75A 3GG3A 4OGIA 5A82A 5D3LA 5IIDA 3NXBA 4QY4A 5ENCA 4YATA 4YAXA 4MEPA 5HRWA 5BT3A 5IGLA 5HLSA 4CUSA 5H1UA 5F63A 4UIUA 4NQNA 4Z6IA 4UITA 5CP5A 3IU5A 5DY7A 5A5PA 5I80A 3D1BA 5IGMA 4KCXA 4MENA 5FFYA 5DYUA 5ENFA 4YBSA 4HXPA 2R10A 4OUFA 5E9LA 5HM0A 5EICA 5CS8A 2GRCA 4Z93A 3UVXA 2MJVB 4YH4A 4WHUA 4NR5A 4HBYA 5HQ7A 4LC2A 2OUOA 4XY8A 5CU8A 4WIVA 4ZW1A 4Q0NA 5FFWA 2DKWA 3K2JA 4WHWA 3S92A 4IR4A 5HJCA 3HMEA 4NUCA 5LJ1A 3MXFA 5I1QA 4DONA 5I89A 5ACYA 2I7KA 1ZKRA 3Q2EA 5E3GA 5EP7A 5EWVA 3UVYA 4BJXA 4QYLA 5EU1A 5G4RA 4PKLA 5F25A 3AADA 5LKZA 4BW1A 5EWHA 3RCWA 4O7FA 5CQ5A 4CUPA 5LJ2A 4A9MA 4PCIA 5KTXA 3ONIA 3P5OA 4TQNA 5D3PA 4O77A 4YYDA 5HFQA 5CUCA 5D3SA 5EWWA 2YEMA 5DKDA 5ENEA 3U5LA 4QR4A 3U5PA 5FE6A 4NRCA 4A9OA 4NR6A 5I7XA 4N4IA 3JVJA 5D25A 3D7CA 5C8GA 3O33A 4UYEA 3FKMX 3Q2FA 3HMFA 5A81A 2D82A 3UVDA 5DFDA 2D9EA 5CZGA 5H85A 1EQFA 3G0LA 4BW3A 3P1DA 4HXLA 5CRZA 5CGPA 3O34A 5BT4A 2DATA 2E7OA 2E3KA 5H1VA 4ZC9A 4J0RA 5L97A
chains in the Genus database with same CATH topology
5HRXA 5FE0A 4CUTA 4QNSA 4BW4A 4A9NA 2DVSA 5AD2A 4A9KA 5ENBA 4BW2A 4J0SA 2E7NA 4UIYA 5A5RA 5D3TA 5EPRA 4LYIA 2LSPB 4HXKA 4MEOA 5E9IA 5KU3A 5DYXA 2F6JA 4A9JA 4QBMA 4QYDA 4QSTA 2RFJA 4LRGA 4LR6A 5I40A 5E9MA 4HXMA 2WP2A 5IG6A 4LYSA 4QSPA 3U5MA 4O7CA 2RI7A 5CUEA 4QSUA 4QEVA 4NRAA 4XY9A 3P1CA 4O76A 5EA1A 4RVRA 5CQ3A 4Q0OA 5ETBA 5LVQA 5L96A 5CRMA 4IR6A 4UYDA 5FB1A 5D7XA 4MR6A 1WUMA 3MB3A 4NUDA 5DKCA 5I83A 4TTEA 4PS5A 5ETDA 3DWYA 5LVRA 4KV1A 4UIZA 5FBXA 5C85A 3JVLA 3MQMA 3MUKA 4TT6A 5D3HA 3UV5A 4YADA 4IORA 1JSPB 5CQ4A 4XUAA 5TCMA 4QSSA 4J1PA 5DFCA 5EGUA 5AMEA 5D3NA 4TS8A 5E7DA 5F62A 5J0DA 4QSXA 4UIVA 5C4QA 5ENIA 4TT4A 3ZYUA 3LQHA 5HCLA 4QB3A 5F3AA 4IR5A 4LZSA 4NR4A 5DW1A 5I7YA 5I88A 4LZRA 5FE1A 3I3JA 3SVGA 5JI8A 5EQ1A 4HXOA 4QSRA 2YQDA 4YK0A 5EWDA 5F5ZA 2G4AA 5FE4A 4HBVA 5LKXA 4UIXA 3QZTA 5E3DA 2N9GA 2OO1A 5DX4A 4YABA 5LUUA 2RO1A 4LYWA 4N4GA 4YYIA 5H1TA 4BHWA 2R0SA 4CURA 3LXJA 4NR9A 5HQ6A 3AQAA 5DFBA 5F1LA 4QSQA 5CY9A 5C87A 5AMFA 5HQ5A 5CQTA 4ZQLA 4MEQA 5C7NA 4QUUA 4FLPA 4TYLA 4Z1SA 5DYAA 5I86A 2RS9B 5CQ7A 5LKTA 4PCEA 5E0RA 4HXSA 4A9LA 5L99A 4QR5A 4XYAA 5CTLA 3TLPA 5LJ0A 5CQ6A 5DLZA 2L85A 3SVHA 5ENGA 5ENJA 5CQ8A 4F3IA 4GPJA 5IGKA 4N3WA 4PY6A 4UIWA 4QSWA 4O71A 4YYKA 4O78A 4TU6A 5II2A 5JWMA 2WP1A 4TU4A 5L8TA 3UV4A 2DWWA 4OGJA 5FE9A 5DYCA 1WUGA 3S91A 2R0VA 5FE5A 4NXJA 5FH6A 5D3RA 4IOQA 5FFVA 4TZ2A 5FB0A 3LJWA 2FSAA 5BT5A 5A5QA 3QZSA 4YYHA 4YC9A 5HELA 4C67A 5D0CA 5FDZA 5HEMA 2YDWA 3MULA 5EV9A 3UVWA 5HENA 2RNYA 4QEUA 4QR3A 2DVVA 5F2PA 2R0YA 3P1EA 5IBNA 5AD3A 3IU6A 4YYMA 5D3JA 5KTUA 5EK9A 5L98A 1E6IA 4A9EA 1X0JA 5ENHA 4NQMA 5LKUA 2F6NA 4NYWA 2DVQA 3DAIA 5DLXA 4ALHA 4HXNA 4QUTA 5FE2A 5FG5A 5CUBA 5HFRA 3MB4A 4LDFA 4HBXA 5FE8A 4UYFA 4HXRA 5IGNA 4N4FA 1N72A 5CQAA 5FH7A 4O7EA 5KHMA 4Z6HA 3JVKA 4CFLA 3U5KA 5C89A 4NYVA 5DKHA 2H60A 3UV2A 4J3IA 4HBWA 4PTBA 4QZSA 3P1FA 4NS5A 4QC3A 5F36A 4Y03A 5FE3A 3O35A 5G4SA 2YEKA 4IR3A 1JM4B 4MR5A 4MR4A 4CUQA 4NYXA 4YY4A 2YELA 3LQIA 1F68A 5E74A 5CUGA 5EVAA 3U5NA 2RNWA 5EM3A 4YH3A 4TT2A 2YYNA 4YYJA 5CPEA 3U5OA 5A83A 4Z1QA 5D24A 3O36A 4YYNA 3U5JA 5A5NA 5E9KA 4ALGA 3O37A 5DW2A 5TB6A 3QZVA 3SVFA 5E9YA 4CFKA 5FE7A 3JVMA 4MR3A 4NUEA 2L5EA 5A5SA 4A9IA 4QC1A 4CLBA 2L84A 4XUBA 3G0JA 4TZ8A 4A9HA 5L8UA 5FH8A 4UYGA 4UYFB 4YBTA 5KO4A 4C66A 1ZS5A 5FG4A 4YY6A 4UYHA 4KV4A 5EWCA 5II1A 4X2IA 5F61A 3LQJA 5EISA 4NR7A 3UW9A 2I8NA 4CL9A 4NRBA 5EPSA 4A9FA 5A85A 5HRVA 4O72A 5FG6A 5I29A 2OSSA 5DBMA 4QSVA 5F1HA 5F60A 5CUAA 4E96A 5K29A 4O7BA 5D26A 4O74A 4AKNA 4O7AA 5E9VA 5COIA 3HMHA 2RNXA 4IOOA 2NXBA 4QEWA 4CUUA 5CUDA 5E73A 4N4HA 5EPBA 4YBMA 4O70A 4LZ2A 4YYGA 4NR8A 5A7CA 5A5OA 2YW5A 2KTBB 5KTWA 5EI4A 2DVRA 5CFWA 4O75A 3GG3A 4OGIA 5A82A 5D3LA 5IIDA 3NXBA 4QY4A 5ENCA 4YATA 4YAXA 4MEPA 5HRWA 5BT3A 5IGLA 5HLSA 4CUSA 5H1UA 5F63A 4UIUA 4NQNA 4Z6IA 4UITA 5CP5A 3IU5A 5DY7A 5A5PA 5I80A 5IGMA 4KCXA 4MENA 5FFYA 5DYUA 5ENFA 4YBSA 4HXPA 2R10A 4OUFA 5E9LA 5HM0A 5EICA 5CS8A 2GRCA 4Z93A 3UVXA 2MJVB 4YH4A 4WHUA 4NR5A 4HBYA 5HQ7A 4LC2A 2OUOA 4XY8A 5CU8A 4WIVA 4ZW1A 4Q0NA 5FFWA 2DKWA 3K2JA 4WHWA 3S92A 4IR4A 5HJCA 3HMEA 4NUCA 5LJ1A 3MXFA 5I1QA 4DONA 5I89A 5ACYA 2I7KA 3Q2EA 5E3GA 5EP7A 5EWVA 3UVYA 4BJXA 4QYLA 5EU1A 5G4RA 4PKLA 5F25A 3AADA 5LKZA 4BW1A 5EWHA 3RCWA 4O7FA 5CQ5A 4CUPA 5LJ2A 4A9MA 4PCIA 5KTXA 3ONIA 3P5OA 4TQNA 5D3PA 4O77A 4YYDA 5HFQA 5CUCA 5D3SA 5EWWA 2YEMA 5DKDA 5ENEA 3U5LA 4QR4A 3U5PA 5FE6A 4NRCA 4A9OA 4NR6A 5I7XA 4N4IA 3JVJA 5D25A 3D7CA 5C8GA 3O33A 4UYEA 3FKMX 3Q2FA 3HMFA 5A81A 2D82A 3UVDA 5DFDA 2D9EA 5CZGA 5H85A 1EQFA 3G0LA 4BW3A 3P1DA 4HXLA 5CRZA 5CGPA 3O34A 5BT4A 2DATA 2E7OA 2E3KA 5H1VA 4ZC9A 4J0RA 5L97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRX A;  5FE0 A;  4CUT A;  4QNS A;  4BW4 A;  4A9N A;  2DVS A;  5AD2 A;  4A9K A;  5ENB A;  4BW2 A;  4J0S A;  2E7N A;  4UIY A;  5A5R A;  5D3T A;  5EPR A;  4LYI A;  2LSP B;  4HXK A;  4MEO A;  5E9I A;  5KU3 A;  5DYX A;  2F6J A;  4A9J A;  4QBM A;  4QYD A;  4QST A;  2RFJ A;  4LRG A;  4LR6 A;  5I40 A;  5E9M A;  4HXM A;  2WP2 A;  5IG6 A;  4LYS A;  4QSP A;  3U5M A;  4O7C A;  2RI7 A;  5CUE A;  4QSU A;  4QEV A;  4NRA A;  4XY9 A;  3P1C A;  4O76 A;  5EA1 A;  4RVR A;  5CQ3 A;  4Q0O A;  5ETB A;  5LVQ A;  5L96 A;  5CRM A;  4IR6 A;  4UYD A;  5FB1 A;  5D7X A;  4MR6 A;  1WUM A;  3MB3 A;  4NUD A;  5DKC A;  5I83 A;  4TTE A;  4PS5 A;  5ETD A;  3DWY A;  5LVR A;  4KV1 A;  4UIZ A;  5FBX A;  5C85 A;  3JVL A;  3MQM A;  3MUK A;  4TT6 A;  5D3H A;  3UV5 A;  4YAD A;  4IOR A;  1JSP B;  5CQ4 A;  4XUA A;  5TCM A;  4QSS A;  4J1P A;  5DFC A;  5EGU A;  5AME A;  5D3N A;  4TS8 A;  5E7D A;  5F62 A;  5J0D A;  4QSX A;  4UIV A;  5C4Q A;  5ENI A;  4TT4 A;  3ZYU A;  3LQH A;  5HCL A;  4QB3 A;  5F3A A;  4IR5 A;  4LZS A;  4NR4 A;  5DW1 A;  5I7Y A;  5I88 A;  4LZR A;  5FE1 A;  3I3J A;  3SVG A;  5JI8 A;  5EQ1 A;  4HXO A;  4QSR A;  2YQD A;  4YK0 A;  5EWD A;  5F5Z A;  2G4A A;  5FE4 A;  4HBV A;  5LKX A;  4UIX A;  3QZT A;  5E3D A;  2N9G A;  2OO1 A;  5DX4 A;  4YAB A;  5LUU A;  2RO1 A;  4LYW A;  4N4G A;  4YYI A;  5H1T A;  4BHW A;  2R0S A;  4CUR A;  3LXJ A;  4NR9 A;  5HQ6 A;  3AQA A;  5DFB A;  5F1L A;  4QSQ A;  5CY9 A;  5C87 A;  5AMF A;  5HQ5 A;  5CQT A;  4ZQL A;  4MEQ A;  5C7N A;  4QUU A;  4FLP A;  4TYL A;  4Z1S A;  5DYA A;  5I86 A;  2RS9 B;  5CQ7 A;  5LKT A;  4PCE A;  5E0R A;  4HXS A;  4A9L A;  5L99 A;  4QR5 A;  4XYA A;  5CTL A;  3TLP A;  5LJ0 A;  5CQ6 A;  5DLZ A;  2L85 A;  3SVH A;  5ENG A;  5ENJ A;  5CQ8 A;  4F3I A;  4GPJ A;  5IGK A;  4N3W A;  4PY6 A;  4UIW A;  4QSW A;  4O71 A;  4YYK A;  4O78 A;  4TU6 A;  5II2 A;  5JWM A;  2WP1 A;  4TU4 A;  5L8T A;  3UV4 A;  2DWW A;  4OGJ A;  5FE9 A;  5DYC A;  1WUG A;  3S91 A;  2R0V A;  5FE5 A;  4NXJ A;  5FH6 A;  5D3R A;  4IOQ A;  5FFV A;  4TZ2 A;  5FB0 A;  3LJW A;  2FSA A;  5BT5 A;  5A5Q A;  3QZS A;  4YYH A;  4YC9 A;  5HEL A;  4C67 A;  5D0C A;  5FDZ A;  5HEM A;  2YDW A;  3MUL A;  5EV9 A;  3UVW A;  5HEN A;  2RNY A;  4QEU A;  4QR3 A;  2DVV A;  5F2P A;  2R0Y A;  3P1E A;  5IBN A;  5AD3 A;  3IU6 A;  4YYM A;  5D3J A;  5KTU A;  5EK9 A;  5L98 A;  1E6I A;  4A9E A;  1X0J A;  5ENH A;  4NQM A;  5LKU A;  2F6N A;  4NYW A;  2DVQ A;  3DAI A;  5DLX A;  4ALH A;  4HXN A;  4QUT A;  5FE2 A;  5FG5 A;  5CUB A;  5HFR A;  3MB4 A;  4LDF A;  4HBX A;  5FE8 A;  4UYF A;  4HXR A;  5IGN A;  4N4F A;  1N72 A;  5CQA A;  5FH7 A;  4O7E A;  5KHM A;  4Z6H A;  3JVK A;  4CFL A;  3U5K A;  5C89 A;  4NYV A;  5DKH A;  2H60 A;  3UV2 A;  4J3I A;  4HBW A;  4PTB A;  4QZS A;  3P1F A;  4NS5 A;  4QC3 A;  5F36 A;  4Y03 A;  5FE3 A;  3O35 A;  5G4S A;  2YEK A;  4IR3 A;  1JM4 B;  4MR5 A;  4MR4 A;  4CUQ A;  4NYX A;  4YY4 A;  2YEL A;  3LQI A;  1F68 A;  5E74 A;  5CUG A;  5EVA A;  3U5N A;  2RNW A;  5EM3 A;  4YH3 A;  4TT2 A;  2YYN A;  4YYJ A;  5CPE A;  3U5O A;  5A83 A;  4Z1Q A;  5D24 A;  3O36 A;  4YYN A;  3U5J A;  5A5N A;  5E9K A;  4ALG A;  3O37 A;  5DW2 A;  5TB6 A;  3QZV A;  3SVF A;  5E9Y A;  4CFK A;  5FE7 A;  3JVM A;  4MR3 A;  4NUE A;  2L5E A;  5A5S A;  4A9I A;  4QC1 A;  4CLB A;  2L84 A;  4XUB A;  3G0J A;  4TZ8 A;  4A9H A;  5L8U A;  5FH8 A;  4UYG A;  4UYF B;  4YBT A;  5KO4 A;  4C66 A;  1ZS5 A;  5FG4 A;  4YY6 A;  4UYH A;  4KV4 A;  5EWC A;  5II1 A;  4X2I A;  5F61 A;  3LQJ A;  5EIS A;  4NR7 A;  3UW9 A;  2I8N A;  4CL9 A;  4NRB A;  5EPS A;  4A9F A;  5A85 A;  5HRV A;  4O72 A;  5FG6 A;  5I29 A;  2OSS A;  5DBM A;  4QSV A;  5F1H A;  5F60 A;  5CUA A;  4E96 A;  5K29 A;  4O7B A;  5D26 A;  4O74 A;  4AKN A;  4O7A A;  5E9V A;  5COI A;  3HMH A;  2RNX A;  4IOO A;  2NXB A;  4QEW A;  4CUU A;  5CUD A;  5E73 A;  4N4H A;  5EPB A;  4YBM A;  4O70 A;  4LZ2 A;  4YYG A;  4NR8 A;  5A7C A;  5A5O A;  2YW5 A;  2KTB B;  5KTW A;  5EI4 A;  2DVR A;  5CFW A;  4O75 A;  3GG3 A;  4OGI A;  5A82 A;  5D3L A;  5IID A;  3NXB A;  4QY4 A;  5ENC A;  4YAT A;  4YAX A;  4MEP A;  5HRW A;  5BT3 A;  5IGL A;  5HLS A;  4CUS A;  5H1U A;  5F63 A;  4UIU A;  4NQN A;  4Z6I A;  4UIT A;  5CP5 A;  3IU5 A;  5DY7 A;  5A5P A;  5I80 A;  5IGM A;  4KCX A;  4MEN A;  5FFY A;  5DYU A;  5ENF A;  4YBS A;  4HXP A;  2R10 A;  4OUF A;  5E9L A;  5HM0 A;  5EIC A;  5CS8 A;  2GRC A;  4Z93 A;  3UVX A;  2MJV B;  4YH4 A;  4WHU A;  4NR5 A;  4HBY A;  5HQ7 A;  4LC2 A;  2OUO A;  4XY8 A;  5CU8 A;  4WIV A;  4ZW1 A;  4Q0N A;  5FFW A;  2DKW A;  3K2J A;  4WHW A;  3S92 A;  4IR4 A;  5HJC A;  3HME A;  4NUC A;  5LJ1 A;  3MXF A;  5I1Q A;  4DON A;  5I89 A;  5ACY A;  2I7K A;  3Q2E A;  5E3G A;  5EP7 A;  5EWV A;  3UVY A;  4BJX A;  4QYL A;  5EU1 A;  5G4R A;  4PKL A;  5F25 A;  3AAD A;  5LKZ A;  4BW1 A;  5EWH A;  3RCW A;  4O7F A;  5CQ5 A;  4CUP A;  5LJ2 A;  4A9M A;  4PCI A;  5KTX A;  3ONI A;  3P5O A;  4TQN A;  5D3P A;  4O77 A;  4YYD A;  5HFQ A;  5CUC A;  5D3S A;  5EWW A;  2YEM A;  5DKD A;  5ENE A;  3U5L A;  4QR4 A;  3U5P A;  5FE6 A;  4NRC A;  4A9O A;  4NR6 A;  5I7X A;  4N4I A;  3JVJ A;  5D25 A;  3D7C A;  5C8G A;  3O33 A;  4UYE A;  3FKM X;  3Q2F A;  3HMF A;  5A81 A;  2D82 A;  3UVD A;  5DFD A;  2D9E A;  5CZG A;  5H85 A;  1EQF A;  3G0L A;  4BW3 A;  3P1D A;  4HXL A;  5CRZ A;  5CGP A;  3O34 A;  5BT4 A;  2DAT A;  2E7O A;  2E3K A;  5H1V A;  4ZC9 A;  4J0R A;  5L97 A; 
#chains in the Genus database with same CATH topology
 5HRX A;  5FE0 A;  4CUT A;  4QNS A;  4BW4 A;  4A9N A;  2DVS A;  5AD2 A;  4A9K A;  5ENB A;  4BW2 A;  4J0S A;  2E7N A;  4UIY A;  5A5R A;  5D3T A;  5EPR A;  4LYI A;  2LSP B;  4HXK A;  4MEO A;  5E9I A;  5KU3 A;  5DYX A;  2F6J A;  4A9J A;  4QBM A;  4QYD A;  4QST A;  2RFJ A;  4LRG A;  4LR6 A;  5I40 A;  5E9M A;  4HXM A;  2WP2 A;  5IG6 A;  4LYS A;  4QSP A;  3U5M A;  4O7C A;  2RI7 A;  5CUE A;  4QSU A;  4QEV A;  4NRA A;  4XY9 A;  3P1C A;  4O76 A;  5EA1 A;  4RVR A;  5CQ3 A;  4Q0O A;  5ETB A;  5LVQ A;  5L96 A;  5CRM A;  4IR6 A;  4UYD A;  5FB1 A;  5D7X A;  4MR6 A;  1WUM A;  3MB3 A;  4NUD A;  5DKC A;  5I83 A;  4TTE A;  4PS5 A;  5ETD A;  3DWY A;  5LVR A;  4KV1 A;  4UIZ A;  5FBX A;  5C85 A;  3JVL A;  3MQM A;  3VKG A;  3MUK A;  4TT6 A;  5D3H A;  3UV5 A;  4YAD A;  4IOR A;  1JSP B;  5CQ4 A;  4XUA A;  5TCM A;  4QSS A;  4J1P A;  5DFC A;  5EGU A;  5AME A;  5D3N A;  4TS8 A;  5E7D A;  5F62 A;  5J0D A;  4QSX A;  4UIV A;  5C4Q A;  5ENI A;  4TT4 A;  3ZYU A;  3LQH A;  5HCL A;  4QB3 A;  5F3A A;  4IR5 A;  4LZS A;  4NR4 A;  5DW1 A;  5I7Y A;  5I88 A;  4LZR A;  5FE1 A;  3I3J A;  3SVG A;  5JI8 A;  5EQ1 A;  4HXO A;  4QSR A;  2YQD A;  4YK0 A;  5EWD A;  5F5Z A;  2G4A A;  5FE4 A;  4HBV A;  5LKX A;  4UIX A;  3QZT A;  5E3D A;  2N9G A;  2OO1 A;  5DX4 A;  4YAB A;  5LUU A;  2RO1 A;  4LYW A;  4N4G A;  4YYI A;  5H1T A;  4BHW A;  2R0S A;  4CUR A;  3LXJ A;  4NR9 A;  5HQ6 A;  3AQA A;  5DFB A;  3VKH A;  5F1L A;  4QSQ A;  5CY9 A;  5C87 A;  5AMF A;  5HQ5 A;  5CQT A;  4ZQL A;  4MEQ A;  5C7N A;  4QUU A;  4FLP A;  4TYL A;  4Z1S A;  5DYA A;  5I86 A;  2RS9 B;  5CQ7 A;  4AKH A;  5LKT A;  4PCE A;  5E0R A;  4HXS A;  4A9L A;  5L99 A;  4QR5 A;  4XYA A;  3D1D A;  5CTL A;  3TLP A;  5LJ0 A;  5CQ6 A;  5DLZ A;  2L85 A;  3SVH A;  5ENG A;  5ENJ A;  5CQ8 A;  4F3I A;  4GPJ A;  5IGK A;  4N3W A;  4PY6 A;  4UIW A;  4QSW A;  4O71 A;  4YYK A;  4O78 A;  4TU6 A;  5II2 A;  5JWM A;  2WP1 A;  4TU4 A;  5L8T A;  3UV4 A;  2DWW A;  4OGJ A;  5FE9 A;  5DYC A;  1WUG A;  3S91 A;  2R0V A;  5FE5 A;  4NXJ A;  5FH6 A;  5D3R A;  4IOQ A;  5FFV A;  4TZ2 A;  5FB0 A;  3LJW A;  2FSA A;  5BT5 A;  5A5Q A;  3QZS A;  4YYH A;  4YC9 A;  5HEL A;  4C67 A;  5D0C A;  5FDZ A;  5HEM A;  2YDW A;  3MUL A;  5EV9 A;  3UVW A;  5HEN A;  2RNY A;  4QEU A;  4QR3 A;  2DVV A;  5F2P A;  2R0Y A;  3P1E A;  5IBN A;  5AD3 A;  3IU6 A;  4YYM A;  5D3J A;  5KTU A;  5EK9 A;  5L98 A;  1E6I A;  4A9E A;  1X0J A;  5ENH A;  4AI6 A;  4NQM A;  5LKU A;  2F6N A;  4NYW A;  2DVQ A;  3DAI A;  5DLX A;  4ALH A;  4HXN A;  4QUT A;  5FE2 A;  5FG5 A;  5CUB A;  5HFR A;  3MB4 A;  4LDF A;  4HBX A;  5FE8 A;  4UYF A;  4HXR A;  5IGN A;  4N4F A;  1N72 A;  5CQA A;  5FH7 A;  2EJN A;  4O7E A;  5KHM A;  4Z6H A;  3JVK A;  4CFL A;  3U5K A;  5C89 A;  4NYV A;  5DKH A;  2H60 A;  3UV2 A;  4AKG A;  4J3I A;  4HBW A;  4PTB A;  4QZS A;  3P1F A;  4NS5 A;  4QC3 A;  5F36 A;  4Y03 A;  5FE3 A;  3O35 A;  5G4S A;  2YEK A;  4IR3 A;  1JM4 B;  4MR5 A;  4MR4 A;  4CUQ A;  4NYX A;  3ERR A;  4YY4 A;  2YEL A;  3LQI A;  1F68 A;  5E74 A;  5CUG A;  5EVA A;  3U5N A;  2RNW A;  5EM3 A;  4YH3 A;  4TT2 A;  2YYN A;  4YYJ A;  5CPE A;  3U5O A;  5A83 A;  4Z1Q A;  5D24 A;  3O36 A;  4YYN A;  3U5J A;  5A5N A;  5E9K A;  4ALG A;  3O37 A;  5DW2 A;  5TB6 A;  3QZV A;  3SVF A;  5E9Y A;  4CFK A;  5FE7 A;  3JVM A;  4MR3 A;  4NUE A;  2L5E A;  5A5S A;  4A9I A;  4QC1 A;  4CLB A;  2L84 A;  4XUB A;  3G0J A;  4TZ8 A;  4A9H A;  5L8U A;  1PUO A;  5FH8 A;  4UYG A;  4UYF B;  4YBT A;  5KO4 A;  4C66 A;  1ZS5 A;  5FG4 A;  4YY6 A;  4UYH A;  4KV4 A;  5EWC A;  5II1 A;  4X2I A;  5F61 A;  3LQJ A;  5EIS A;  4NR7 A;  3UW9 A;  2I8N A;  4CL9 A;  4NRB A;  5EPS A;  4A9F A;  5A85 A;  5HRV A;  4O72 A;  5FG6 A;  5I29 A;  2OSS A;  5DBM A;  4QSV A;  5F1H A;  5F60 A;  5CUA A;  4E96 A;  5K29 A;  4O7B A;  5D26 A;  4O74 A;  4AKN A;  4AKI A;  4O7A A;  5E9V A;  5COI A;  3HMH A;  2RNX A;  4IOO A;  2NXB A;  4QEW A;  4CUU A;  5CUD A;  5E73 A;  4N4H A;  5EPB A;  4YBM A;  4O70 A;  4LZ2 A;  4YYG A;  4NR8 A;  5A7C A;  5A5O A;  2YW5 A;  2KTB B;  5KTW A;  5EI4 A;  2DVR A;  5CFW A;  4O75 A;  3GG3 A;  4OGI A;  5A82 A;  5D3L A;  5IID A;  3NXB A;  4QY4 A;  5ENC A;  4YAT A;  4YAX A;  4MEP A;  5HRW A;  5BT3 A;  5IGL A;  5HLS A;  4CUS A;  5H1U A;  5F63 A;  4UIU A;  4NQN A;  4Z6I A;  4UIT A;  5CP5 A;  3IU5 A;  5DY7 A;  5A5P A;  5I80 A;  3D1B A;  5IGM A;  4KCX A;  4MEN A;  5FFY A;  5DYU A;  5ENF A;  4YBS A;  4HXP A;  2R10 A;  4OUF A;  5E9L A;  5HM0 A;  5EIC A;  5CS8 A;  2GRC A;  4Z93 A;  3UVX A;  2MJV B;  4YH4 A;  4WHU A;  4NR5 A;  4HBY A;  5HQ7 A;  4LC2 A;  2OUO A;  4XY8 A;  5CU8 A;  4WIV A;  4ZW1 A;  4Q0N A;  5FFW A;  2DKW A;  3K2J A;  4WHW A;  3S92 A;  4IR4 A;  5HJC A;  3HME A;  4NUC A;  5LJ1 A;  3MXF A;  5I1Q A;  4DON A;  5I89 A;  5ACY A;  2I7K A;  1ZKR A;  3Q2E A;  5E3G A;  5EP7 A;  5EWV A;  3UVY A;  4BJX A;  4QYL A;  5EU1 A;  5G4R A;  4PKL A;  5F25 A;  3AAD A;  5LKZ A;  4BW1 A;  5EWH A;  3RCW A;  4O7F A;  5CQ5 A;  4CUP A;  5LJ2 A;  4A9M A;  4PCI A;  5KTX A;  3ONI A;  3P5O A;  4TQN A;  5D3P A;  4O77 A;  4YYD A;  5HFQ A;  5CUC A;  5D3S A;  5EWW A;  2YEM A;  5DKD A;  5ENE A;  3U5L A;  4QR4 A;  3U5P A;  5FE6 A;  4NRC A;  4A9O A;  4NR6 A;  5I7X A;  4N4I A;  3JVJ A;  5D25 A;  3D7C A;  5C8G A;  3O33 A;  4UYE A;  3FKM X;  3Q2F A;  3HMF A;  5A81 A;  2D82 A;  3UVD A;  5DFD A;  2D9E A;  5CZG A;  5H85 A;  1EQF A;  3G0L A;  4BW3 A;  3P1D A;  4HXL A;  5CRZ A;  5CGP A;  3O34 A;  5BT4 A;  2DAT A;  2E7O A;  2E3K A;  5H1V A;  4ZC9 A;  4J0R A;  5L97 A; 
#chains in the Genus database with same CATH homology
 5HRX A;  5FE0 A;  4CUT A;  4QNS A;  4BW4 A;  4A9N A;  2DVS A;  5AD2 A;  4A9K A;  5ENB A;  4BW2 A;  4J0S A;  2E7N A;  4UIY A;  5A5R A;  5D3T A;  5EPR A;  4LYI A;  2LSP B;  4HXK A;  4MEO A;  5E9I A;  5KU3 A;  5DYX A;  2F6J A;  4A9J A;  4QBM A;  4QYD A;  4QST A;  2RFJ A;  4LRG A;  4LR6 A;  5I40 A;  5E9M A;  4HXM A;  2WP2 A;  5IG6 A;  4LYS A;  4QSP A;  3U5M A;  4O7C A;  2RI7 A;  5CUE A;  4QSU A;  4QEV A;  4NRA A;  4XY9 A;  3P1C A;  4O76 A;  5EA1 A;  4RVR A;  5CQ3 A;  4Q0O A;  5ETB A;  5LVQ A;  5L96 A;  5CRM A;  4IR6 A;  4UYD A;  5FB1 A;  5D7X A;  4MR6 A;  1WUM A;  3MB3 A;  4NUD A;  5DKC A;  5I83 A;  4TTE A;  4PS5 A;  5ETD A;  3DWY A;  5LVR A;  4KV1 A;  4UIZ A;  5FBX A;  5C85 A;  3JVL A;  3MQM A;  3MUK A;  4TT6 A;  5D3H A;  3UV5 A;  4YAD A;  4IOR A;  1JSP B;  5CQ4 A;  4XUA A;  5TCM A;  4QSS A;  4J1P A;  5DFC A;  5EGU A;  5AME A;  5D3N A;  4TS8 A;  5E7D A;  5F62 A;  5J0D A;  4QSX A;  4UIV A;  5C4Q A;  5ENI A;  4TT4 A;  3ZYU A;  3LQH A;  5HCL A;  4QB3 A;  5F3A A;  4IR5 A;  4LZS A;  4NR4 A;  5DW1 A;  5I7Y A;  5I88 A;  4LZR A;  5FE1 A;  3I3J A;  3SVG A;  5JI8 A;  5EQ1 A;  4HXO A;  4QSR A;  2YQD A;  4YK0 A;  5EWD A;  5F5Z A;  2G4A A;  5FE4 A;  4HBV A;  5LKX A;  4UIX A;  3QZT A;  5E3D A;  2N9G A;  2OO1 A;  5DX4 A;  4YAB A;  5LUU A;  2RO1 A;  4LYW A;  4N4G A;  4YYI A;  5H1T A;  4BHW A;  2R0S A;  4CUR A;  3LXJ A;  4NR9 A;  5HQ6 A;  3AQA A;  5DFB A;  5F1L A;  4QSQ A;  5CY9 A;  5C87 A;  5AMF A;  5HQ5 A;  5CQT A;  4ZQL A;  4MEQ A;  5C7N A;  4QUU A;  4FLP A;  4TYL A;  4Z1S A;  5DYA A;  5I86 A;  2RS9 B;  5CQ7 A;  5LKT A;  4PCE A;  5E0R A;  4HXS A;  4A9L A;  5L99 A;  4QR5 A;  4XYA A;  5CTL A;  3TLP A;  5LJ0 A;  5CQ6 A;  5DLZ A;  2L85 A;  3SVH A;  5ENG A;  5ENJ A;  5CQ8 A;  4F3I A;  4GPJ A;  5IGK A;  4N3W A;  4PY6 A;  4UIW A;  4QSW A;  4O71 A;  4YYK A;  4O78 A;  4TU6 A;  5II2 A;  5JWM A;  2WP1 A;  4TU4 A;  5L8T A;  3UV4 A;  2DWW A;  4OGJ A;  5FE9 A;  5DYC A;  1WUG A;  3S91 A;  2R0V A;  5FE5 A;  4NXJ A;  5FH6 A;  5D3R A;  4IOQ A;  5FFV A;  4TZ2 A;  5FB0 A;  3LJW A;  2FSA A;  5BT5 A;  5A5Q A;  3QZS A;  4YYH A;  4YC9 A;  5HEL A;  4C67 A;  5D0C A;  5FDZ A;  5HEM A;  2YDW A;  3MUL A;  5EV9 A;  3UVW A;  5HEN A;  2RNY A;  4QEU A;  4QR3 A;  2DVV A;  5F2P A;  2R0Y A;  3P1E A;  5IBN A;  5AD3 A;  3IU6 A;  4YYM A;  5D3J A;  5KTU A;  5EK9 A;  5L98 A;  1E6I A;  4A9E A;  1X0J A;  5ENH A;  4NQM A;  5LKU A;  2F6N A;  4NYW A;  2DVQ A;  3DAI A;  5DLX A;  4ALH A;  4HXN A;  4QUT A;  5FE2 A;  5FG5 A;  5CUB A;  5HFR A;  3MB4 A;  4LDF A;  4HBX A;  5FE8 A;  4UYF A;  4HXR A;  5IGN A;  4N4F A;  1N72 A;  5CQA A;  5FH7 A;  4O7E A;  5KHM A;  4Z6H A;  3JVK A;  4CFL A;  3U5K A;  5C89 A;  4NYV A;  5DKH A;  2H60 A;  3UV2 A;  4J3I A;  4HBW A;  4PTB A;  4QZS A;  3P1F A;  4NS5 A;  4QC3 A;  5F36 A;  4Y03 A;  5FE3 A;  3O35 A;  5G4S A;  2YEK A;  4IR3 A;  1JM4 B;  4MR5 A;  4MR4 A;  4CUQ A;  4NYX A;  4YY4 A;  2YEL A;  3LQI A;  1F68 A;  5E74 A;  5CUG A;  5EVA A;  3U5N A;  2RNW A;  5EM3 A;  4YH3 A;  4TT2 A;  2YYN A;  4YYJ A;  5CPE A;  3U5O A;  5A83 A;  4Z1Q A;  5D24 A;  3O36 A;  4YYN A;  3U5J A;  5A5N A;  5E9K A;  4ALG A;  3O37 A;  5DW2 A;  5TB6 A;  3QZV A;  3SVF A;  5E9Y A;  4CFK A;  5FE7 A;  3JVM A;  4MR3 A;  4NUE A;  2L5E A;  5A5S A;  4A9I A;  4QC1 A;  4CLB A;  2L84 A;  4XUB A;  3G0J A;  4TZ8 A;  4A9H A;  5L8U A;  5FH8 A;  4UYG A;  4UYF B;  4YBT A;  5KO4 A;  4C66 A;  1ZS5 A;  5FG4 A;  4YY6 A;  4UYH A;  4KV4 A;  5EWC A;  5II1 A;  4X2I A;  5F61 A;  3LQJ A;  5EIS A;  4NR7 A;  3UW9 A;  2I8N A;  4CL9 A;  4NRB A;  5EPS A;  4A9F A;  5A85 A;  5HRV A;  4O72 A;  5FG6 A;  5I29 A;  2OSS A;  5DBM A;  4QSV A;  5F1H A;  5F60 A;  5CUA A;  4E96 A;  5K29 A;  4O7B A;  5D26 A;  4O74 A;  4AKN A;  4O7A A;  5E9V A;  5COI A;  3HMH A;  2RNX A;  4IOO A;  2NXB A;  4QEW A;  4CUU A;  5CUD A;  5E73 A;  4N4H A;  5EPB A;  4YBM A;  4O70 A;  4LZ2 A;  4YYG A;  4NR8 A;  5A7C A;  5A5O A;  2YW5 A;  2KTB B;  5KTW A;  5EI4 A;  2DVR A;  5CFW A;  4O75 A;  3GG3 A;  4OGI A;  5A82 A;  5D3L A;  5IID A;  3NXB A;  4QY4 A;  5ENC A;  4YAT A;  4YAX A;  4MEP A;  5HRW A;  5BT3 A;  5IGL A;  5HLS A;  4CUS A;  5H1U A;  5F63 A;  4UIU A;  4NQN A;  4Z6I A;  4UIT A;  5CP5 A;  3IU5 A;  5DY7 A;  5A5P A;  5I80 A;  5IGM A;  4KCX A;  4MEN A;  5FFY A;  5DYU A;  5ENF A;  4YBS A;  4HXP A;  2R10 A;  4OUF A;  5E9L A;  5HM0 A;  5EIC A;  5CS8 A;  2GRC A;  4Z93 A;  3UVX A;  2MJV B;  4YH4 A;  4WHU A;  4NR5 A;  4HBY A;  5HQ7 A;  4LC2 A;  2OUO A;  4XY8 A;  5CU8 A;  4WIV A;  4ZW1 A;  4Q0N A;  5FFW A;  2DKW A;  3K2J A;  4WHW A;  3S92 A;  4IR4 A;  5HJC A;  3HME A;  4NUC A;  5LJ1 A;  3MXF A;  5I1Q A;  4DON A;  5I89 A;  5ACY A;  2I7K A;  3Q2E A;  5E3G A;  5EP7 A;  5EWV A;  3UVY A;  4BJX A;  4QYL A;  5EU1 A;  5G4R A;  4PKL A;  5F25 A;  3AAD A;  5LKZ A;  4BW1 A;  5EWH A;  3RCW A;  4O7F A;  5CQ5 A;  4CUP A;  5LJ2 A;  4A9M A;  4PCI A;  5KTX A;  3ONI A;  3P5O A;  4TQN A;  5D3P A;  4O77 A;  4YYD A;  5HFQ A;  5CUC A;  5D3S A;  5EWW A;  2YEM A;  5DKD A;  5ENE A;  3U5L A;  4QR4 A;  3U5P A;  5FE6 A;  4NRC A;  4A9O A;  4NR6 A;  5I7X A;  4N4I A;  3JVJ A;  5D25 A;  3D7C A;  5C8G A;  3O33 A;  4UYE A;  3FKM X;  3Q2F A;  3HMF A;  5A81 A;  2D82 A;  3UVD A;  5DFD A;  2D9E A;  5CZG A;  5H85 A;  1EQF A;  3G0L A;  4BW3 A;  3P1D A;  4HXL A;  5CRZ A;  5CGP A;  3O34 A;  5BT4 A;  2DAT A;  2E7O A;  2E3K A;  5H1V A;  4ZC9 A;  4J0R A;  5L97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...