4NR6A

Crystal structure of the bromodomain of human crebbp in complex with an oxazepin ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
b'KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with an oxazepin ligand
rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 42
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nr6A00
5LUUA 5TCMA 5EV9A 2L84A 5L96A 5F62A 4YY6A 5E7DA 5EWWA 5FE1A 4UITA 4TZ2A 5CS8A 4KV4A 4WIVA 5DW2A 5CQ8A 5A85A 4Q0OA 4N4GA 2YELA 3UVWA 3D7CA 4YADA 5EICA 3JVMA 5I83A 2DVSA 5IIDA 5IG6A 4QSUA 2I8NA 3LJWA 5HCLA 1N72A 3UVXA 3IU6A 5D3HA 4LZSA 4A9OA 5EWCA 4XUAA 5E73A 5CRMA 3O37A 5D3TA 5DKCA 3DWYA 5CUCA 3AADA 4A9NA 5COIA 3RCWA 4NRCA 4O7EA 4TU6A 5HJCA 5KHMA 5E9MA 5F36A 5CUDA 4NYXA 5CQTA 5K29A 5H85A 4QSRA 4O75A 5CTLA 4TT6A 4LDFA 4ZQLA 5FH6A 4QC1A 5G4SA 4HBXA 5ETDA 5C87A 3S91A 4QSPA 4YATA 5DY7A 4YK0A 5EISA 5CQAA 4OGJA 4TS8A 4MR4A 4UIUA 4A9EA 5CUAA 4A9MA 4NR8A 5LKZA 3JVLA 5DFBA 3LQHA 5A5QA 4O7CA 2OO1A 4NR9A 5KU3A 3NXBA 4O70A 5F2PA 5D0CA 5FDZA 5I80A 4NQMA 4DONA 4QR4A 5DBMA 5A7CA 3ZYUA 5EI4A 4Q0NA 4E96A 5DYUA 5FG5A 3TLPA 5C7NA 3P1CA 5E9LA 5CP5A 5I1QA 1F68A 4UIZA 4MEPA 4IOQA 3JVJA 4CUTA 5EQ1A 4Z6IA 3MB3A 4CUSA 5F5ZA 5FB0A 4RVRA 2H60A 5C85A 5HQ6A 5BT3A 5L99A 4YYNA 2N9GA 5CFWA 5JWMA 4HXOA 4X2IA 5C89A 3U5PA 1JM4B 4C67A 4UYGA 5DW1A 2D9EA 4MENA 2RI7A 5FE7A 4ALHA 5HLSA 5CU8A 4ZW1A 4HBWA 3FKMX 5HM0A 5FH8A 4J1PA 5I7XA 3G0LA 4GPJA 5FE4A 5LKUA 5EM3A 5A83A 4FLPA 3P1FA 4LYIA 4NR4A 5F60A 5D3LA 4NR5A 3Q2EA 5A5PA 5AD2A 5ACYA 4HXKA 5L8TA 4CLBA 3G0JA 5FFWA 4KCXA 4MR5A 4YYJA 4Z1QA 3ONIA 2YQDA 4YYHA 2E3KA 5E9VA 3HMEA 5ENBA 4HBVA 5I40A 4QUTA 5EWVA 5FH7A 2YYNA 5CUBA 5ENEA 3LQJA 4UIWA 5CZGA 5LJ2A 1WUGA 5HRVA 5F61A 5CRZA 3Q2FA 5F3AA 4CFKA 5H1UA 4LZRA 5CY9A 4PKLA 4YBMA 5I89A 3UVDA 5H1VA 3MB4A 3P5OA 5CUEA 4F3IA 4Y03A 4CUQA 4N4IA 4QSSA 5D3SA 2G4AA 3O34A 5E9YA 4TT4A 4TQNA 5DFDA 5FG4A 1EQFA 3UVYA 4A9HA 3AQAA 3QZTA 2DWWA 4UYEA 4Z93A 3I3JA 4Z1SA 5FE6A 4BW4A 5ETBA 5D24A 4J3IA 3GG3A 4NXJA 4PY6A 5CQ4A 3UV4A 2DVQA 4XY9A 5HFQA 4LRGA 4O7BA 2LSPB 5DYXA 5FE2A 2YEMA 5D3PA 4NS5A 5E74A 5E0RA 5FG6A 4CUUA 4NR6A 3O33A 4O78A 5DLXA 4MR3A 4NR7A 5JI8A 5FE8A 4YH4A 5DKHA 3UV5A 5EK9A 5IGLA 4OUFA 4CFLA 4IR4A 4PCIA 2YEKA 4QR3A 4YBTA 5E9IA 3IU5A 4NYWA 3DAIA 3SVFA 5A5RA 2L5EA 2OSSA 5ENFA 4LC2A 4ZC9A 3UW9A 4TZ8A 5IGNA 4PTBA 5HRXA 2RFJA 5ENHA 4A9JA 5AMFA 2RNXA 4O72A 5AD3A 3U5NA 5EGUA 4O71A 5F1LA 5LKXA 4UYFB 2E7OA 5LVQA 4YYIA 5J0DA 2RS9B 5FBXA 2RO1A 4KV1A 5HELA 2GRCA 4HBYA 5KTWA 3SVHA 4UIVA 4XUBA 5ENIA 4QEUA 4IOOA 5HRWA 5LVRA 5CQ5A 4MR6A 1E6IA 3QZVA 4IR3A 3U5KA 4IORA 4A9FA 4CUPA 5CQ3A 5I86A 4TTEA 4UYFA 5I88A 5LKTA 4NUCA 4BW2A 4YH3A 4O77A 2F6JA 5EPSA 2NXBA 2YW5A 4YABA 3S92A 5HQ7A 2KTBB 5FE5A 4QNSA 5CQ7A 5DYAA 5EA1A 5ENJA 5FFYA 4O7AA 4UIXA 4PS5A 4BW3A 5CUGA 4LYSA 5BT4A 5E9KA 4C66A 4J0RA 5EP7A 5BT5A 4NQNA 5IBNA 3LXJA 2WP2A 4NYVA 4YAXA 4YYKA 4QEVA 5L97A 4HXRA 3K2JA 4HXMA 4MEOA 5D3RA 5DFCA 2OUOA 5KTXA 5EU1A 2RNWA 4LR6A 3P1EA 4A9KA 4QEWA 5DLZA 4CL9A 1JSPB 5DKDA 4A9LA 4QSVA 4QYLA 4QC3A 4J0SA 4LYWA 3SVGA 5D25A 4NUDA 4O7FA 4TT2A 5LJ1A 4AKNA 3HMHA 4WHUA 4NRAA 4IR5A 4YBSA 4YY4A 4N4FA 5EPRA 4QSXA 5LJ0A 4MEQA 5L98A 4NUEA 4XY8A 4A9IA 3U5OA 3O35A 5A5NA 5FE3A 5KO4A 4HXLA 5AMEA 4HXPA 5EWDA 5A82A 4N3WA 4LZ2A 5F63A 2D82A 4PCEA 4O76A 4BHWA 5F1HA 2R10A 5C4QA 3O36A 5EWHA 5FB1A 2I7KA 2MJVB 3UV2A 5C8GA 5I29A 4BW1A 4QSQA 5CGPA 5D3JA 2DVVA 2FSAA 5E3GA 5HENA 5FE0A 3QZSA 4OGIA 5D26A 5II1A 2DVRA 4TU4A 4UYHA 3U5MA 3MULA 5D7XA 5I7YA 4Z6HA 4UIYA 5TB6A 5H1TA 2E7NA 4ALGA 2YDWA 2RNYA 5FE9A 3LQIA 5FFVA 2F6NA 3P1DA 4HXNA 5DX4A 4QBMA 5IGKA 3MXFA 5KTUA 5L8UA 4CURA 5HFRA 4QY4A 5HQ5A 5IGMA 1X0JA 3U5LA 5DYCA 3JVKA 5ENCA 4UYDA 5ENGA 5II2A 4QSWA 5A5SA 4YYDA 4BJXA 4QR5A 3U5JA 4QB3A 5EVAA 2R0SA 4YC9A 5CPEA 2DATA 3MQMA 5F25A 2R0YA 4O74A 5G4RA 4IR6A 5E3DA 3MUKA 4YYMA 5HEMA 4QYDA 3HMFA 4WHWA 2R0VA 1WUMA 2L85A 4QUUA 4TYLA 4XYAA 2WP1A 4QSTA 1ZS5A 5CQ6A 4HXSA 4QZSA 5EPBA 5D3NA 4N4HA 2DKWA 4NRBA 4YYGA 5A81A 5A5OA
chains in the Genus database with same CATH superfamily
5LUUA 5TCMA 5EV9A 2L84A 5L96A 5F62A 4AKGA 4YY6A 5E7DA 5EWWA 5FE1A 4UITA 4TZ2A 5CS8A 4KV4A 4WIVA 5DW2A 5CQ8A 5A85A 4Q0OA 4N4GA 2YELA 3UVWA 3D7CA 4YADA 5EICA 3JVMA 5I83A 2DVSA 5IIDA 5IG6A 4QSUA 2I8NA 3LJWA 5HCLA 1N72A 3UVXA 3IU6A 5D3HA 4LZSA 4A9OA 5EWCA 4XUAA 5E73A 5CRMA 3O37A 5D3TA 5DKCA 3DWYA 5CUCA 3AADA 4A9NA 5COIA 3RCWA 4NRCA 4O7EA 4TU6A 5HJCA 5KHMA 5E9MA 5F36A 5CUDA 4NYXA 5CQTA 5K29A 5H85A 4QSRA 4O75A 5CTLA 4TT6A 4LDFA 4ZQLA 5FH6A 4QC1A 5G4SA 4HBXA 5ETDA 5C87A 3S91A 4QSPA 4YATA 5DY7A 4YK0A 5EISA 5CQAA 4OGJA 4TS8A 4MR4A 4UIUA 4A9EA 5CUAA 4A9MA 4NR8A 5LKZA 3JVLA 5DFBA 3LQHA 5A5QA 4O7CA 2OO1A 4NR9A 5KU3A 3NXBA 4O70A 5F2PA 5D0CA 5FDZA 5I80A 4NQMA 4DONA 4QR4A 5DBMA 5A7CA 3ZYUA 5EI4A 4Q0NA 4E96A 5DYUA 5FG5A 3TLPA 5C7NA 3P1CA 5E9LA 5CP5A 5I1QA 1F68A 4UIZA 4MEPA 4IOQA 3JVJA 4CUTA 5EQ1A 4Z6IA 3MB3A 4CUSA 5F5ZA 5FB0A 4RVRA 2H60A 5C85A 5HQ6A 5BT3A 5L99A 4YYNA 2N9GA 5CFWA 5JWMA 4HXOA 4X2IA 5C89A 3U5PA 1JM4B 4C67A 3VKHA 4UYGA 5DW1A 2D9EA 4MENA 2RI7A 5FE7A 4ALHA 5HLSA 5CU8A 4ZW1A 4HBWA 3FKMX 5HM0A 5FH8A 4J1PA 5I7XA 3G0LA 4GPJA 5FE4A 5LKUA 5EM3A 5A83A 4FLPA 3P1FA 4LYIA 4NR4A 5F60A 5D3LA 4NR5A 3Q2EA 5A5PA 5AD2A 5ACYA 4HXKA 5L8TA 4CLBA 3G0JA 5FFWA 4KCXA 4MR5A 4YYJA 4Z1QA 3ONIA 2YQDA 4YYHA 2E3KA 5E9VA 3HMEA 5ENBA 4HBVA 5I40A 4QUTA 5EWVA 5FH7A 2YYNA 5CUBA 5ENEA 3LQJA 4UIWA 5CZGA 5LJ2A 1WUGA 5HRVA 5F61A 5CRZA 3Q2FA 5F3AA 4CFKA 5H1UA 4LZRA 5CY9A 4PKLA 4YBMA 5I89A 3UVDA 5H1VA 3MB4A 3P5OA 5CUEA 4F3IA 4Y03A 4CUQA 4N4IA 4QSSA 5D3SA 2G4AA 3O34A 5E9YA 4TT4A 4TQNA 5DFDA 5FG4A 1EQFA 3UVYA 4A9HA 3AQAA 3QZTA 2DWWA 4UYEA 4Z93A 3I3JA 4Z1SA 5FE6A 4BW4A 5ETBA 5D24A 4J3IA 3GG3A 4NXJA 4PY6A 5CQ4A 3UV4A 2DVQA 4XY9A 5HFQA 4LRGA 4O7BA 2LSPB 5DYXA 5FE2A 2YEMA 5D3PA 4NS5A 5E74A 5E0RA 5FG6A 4CUUA 4NR6A 3O33A 4O78A 5DLXA 4MR3A 4NR7A 5JI8A 5FE8A 4YH4A 5DKHA 3UV5A 5EK9A 5IGLA 4OUFA 4CFLA 4IR4A 4PCIA 2YEKA 4QR3A 4YBTA 5E9IA 3IU5A 4NYWA 4AKIA 3DAIA 3SVFA 5A5RA 2L5EA 2OSSA 1ZKRA 4LC2A 5ENFA 4ZC9A 1PUOA 4TZ8A 3UW9A 5IGNA 4PTBA 5HRXA 2RFJA 5ENHA 4A9JA 5AMFA 2RNXA 4O72A 5AD3A 3U5NA 5EGUA 4O71A 5F1LA 5LKXA 4UYFB 2E7OA 5LVQA 4YYIA 5J0DA 2RS9B 5FBXA 2RO1A 4KV1A 5HELA 2GRCA 4HBYA 5KTWA 3SVHA 4UIVA 4XUBA 5ENIA 3D1DA 4QEUA 4IOOA 5HRWA 5LVRA 5CQ5A 4MR6A 1E6IA 3QZVA 4IR3A 3U5KA 4IORA 4A9FA 4CUPA 5CQ3A 5I86A 4TTEA 4UYFA 5I88A 5LKTA 4NUCA 4BW2A 4YH3A 4O77A 2F6JA 5EPSA 2NXBA 2YW5A 4YABA 3ERRA 3S92A 5HQ7A 2KTBB 5FE5A 4QNSA 5CQ7A 5DYAA 5EA1A 5ENJA 5FFYA 4O7AA 4UIXA 4PS5A 4BW3A 5CUGA 4LYSA 5BT4A 5E9KA 4C66A 4J0RA 5EP7A 5BT5A 4NQNA 5IBNA 3LXJA 2WP2A 4NYVA 4YAXA 4YYKA 4QEVA 5L97A 4HXRA 3K2JA 4HXMA 4MEOA 5D3RA 5DFCA 2OUOA 5KTXA 5EU1A 2RNWA 4LR6A 3P1EA 4A9KA 4QEWA 5DLZA 4CL9A 1JSPB 3D1BA 5DKDA 4A9LA 4QSVA 4QYLA 4QC3A 4J0SA 4LYWA 3SVGA 5D25A 4NUDA 4O7FA 4TT2A 5LJ1A 4AKNA 3HMHA 4WHUA 4NRAA 4IR5A 4YBSA 4YY4A 4N4FA 5EPRA 4QSXA 5LJ0A 4MEQA 5L98A 4NUEA 4XY8A 4A9IA 3U5OA 3O35A 4AKHA 5A5NA 5FE3A 5KO4A 4HXLA 5AMEA 4HXPA 5EWDA 5A82A 4N3WA 4AI6A 4LZ2A 5F63A 2D82A 4PCEA 4O76A 4BHWA 3VKGA 5F1HA 2R10A 5C4QA 3O36A 5EWHA 5FB1A 2I7KA 2MJVB 3UV2A 5C8GA 5I29A 4BW1A 4QSQA 5CGPA 5D3JA 2DVVA 2FSAA 5E3GA 5HENA 5FE0A 3QZSA 4OGIA 5D26A 5II1A 2DVRA 4TU4A 4UYHA 3U5MA 3MULA 5D7XA 5I7YA 4Z6HA 4UIYA 5TB6A 5H1TA 2E7NA 4ALGA 2YDWA 2RNYA 5FE9A 3LQIA 5FFVA 2F6NA 3P1DA 4HXNA 5DX4A 4QBMA 5IGKA 3MXFA 5KTUA 5L8UA 2EJNA 4CURA 5HFRA 4QY4A 5HQ5A 5IGMA 1X0JA 3U5LA 5DYCA 3JVKA 5ENCA 4UYDA 5ENGA 5II2A 4QSWA 5A5SA 4YYDA 4BJXA 4QR5A 3U5JA 4QB3A 5EVAA 2R0SA 4YC9A 5CPEA 2DATA 3MQMA 5F25A 2R0YA 4O74A 5G4RA 4IR6A 5E3DA 3MUKA 4YYMA 5HEMA 4QYDA 3HMFA 4WHWA 2R0VA 1WUMA 2L85A 4QUUA 4TYLA 4XYAA 2WP1A 4QSTA 1ZS5A 5CQ6A 4HXSA 4QZSA 5EPBA 5D3NA 4N4HA 2DKWA 4NRBA 4YYGA 5A81A 5A5OA
chains in the Genus database with same CATH topology
5LUUA 5TCMA 5EV9A 2L84A 5L96A 5F62A 4YY6A 5E7DA 5EWWA 5FE1A 4UITA 4TZ2A 5CS8A 4KV4A 4WIVA 5DW2A 5CQ8A 5A85A 4Q0OA 4N4GA 2YELA 3UVWA 3D7CA 4YADA 5EICA 3JVMA 5I83A 2DVSA 5IIDA 5IG6A 4QSUA 2I8NA 3LJWA 5HCLA 1N72A 3UVXA 3IU6A 5D3HA 4LZSA 4A9OA 5EWCA 4XUAA 5E73A 5CRMA 3O37A 5D3TA 5DKCA 3DWYA 5CUCA 3AADA 4A9NA 5COIA 3RCWA 4NRCA 4O7EA 4TU6A 5HJCA 5KHMA 5E9MA 5F36A 5CUDA 4NYXA 5CQTA 5K29A 5H85A 4QSRA 4O75A 5CTLA 4TT6A 4LDFA 4ZQLA 5FH6A 4QC1A 5G4SA 4HBXA 5ETDA 5C87A 3S91A 4QSPA 4YATA 5DY7A 4YK0A 5EISA 5CQAA 4OGJA 4TS8A 4MR4A 4UIUA 4A9EA 5CUAA 4A9MA 4NR8A 5LKZA 3JVLA 5DFBA 3LQHA 5A5QA 4O7CA 2OO1A 4NR9A 5KU3A 3NXBA 4O70A 5F2PA 5D0CA 5FDZA 5I80A 4NQMA 4DONA 4QR4A 5DBMA 5A7CA 3ZYUA 5EI4A 4Q0NA 4E96A 5DYUA 5FG5A 3TLPA 5C7NA 3P1CA 5E9LA 5CP5A 5I1QA 1F68A 4UIZA 4MEPA 4IOQA 3JVJA 4CUTA 5EQ1A 4Z6IA 3MB3A 4CUSA 5F5ZA 5FB0A 4RVRA 2H60A 5C85A 5HQ6A 5BT3A 5L99A 4YYNA 2N9GA 5CFWA 5JWMA 4HXOA 4X2IA 5C89A 3U5PA 1JM4B 4C67A 4UYGA 5DW1A 2D9EA 4MENA 2RI7A 5FE7A 4ALHA 5HLSA 5CU8A 4ZW1A 4HBWA 3FKMX 5HM0A 5FH8A 4J1PA 5I7XA 3G0LA 4GPJA 5FE4A 5LKUA 5EM3A 5A83A 4FLPA 3P1FA 4LYIA 4NR4A 5F60A 5D3LA 4NR5A 3Q2EA 5A5PA 5AD2A 5ACYA 4HXKA 5L8TA 4CLBA 3G0JA 5FFWA 4KCXA 4MR5A 4YYJA 4Z1QA 3ONIA 2YQDA 4YYHA 2E3KA 5E9VA 3HMEA 5ENBA 4HBVA 5I40A 4QUTA 5EWVA 5FH7A 2YYNA 5CUBA 5ENEA 3LQJA 4UIWA 5CZGA 5LJ2A 1WUGA 5HRVA 5F61A 5CRZA 3Q2FA 5F3AA 4CFKA 5H1UA 4LZRA 5CY9A 4PKLA 4YBMA 5I89A 3UVDA 5H1VA 3MB4A 3P5OA 5CUEA 4F3IA 4Y03A 4CUQA 4N4IA 4QSSA 5D3SA 2G4AA 3O34A 5E9YA 4TT4A 4TQNA 5DFDA 5FG4A 1EQFA 3UVYA 4A9HA 3AQAA 3QZTA 2DWWA 4UYEA 4Z93A 3I3JA 4Z1SA 5FE6A 4BW4A 5ETBA 5D24A 4J3IA 3GG3A 4NXJA 4PY6A 5CQ4A 3UV4A 2DVQA 4XY9A 5HFQA 4LRGA 4O7BA 2LSPB 5DYXA 5FE2A 2YEMA 5D3PA 4NS5A 5E74A 5E0RA 5FG6A 4CUUA 4NR6A 3O33A 4O78A 5DLXA 4MR3A 4NR7A 5JI8A 5FE8A 4YH4A 5DKHA 3UV5A 5EK9A 5IGLA 4OUFA 4CFLA 4IR4A 4PCIA 2YEKA 4QR3A 4YBTA 5E9IA 3IU5A 4NYWA 3DAIA 3SVFA 5A5RA 2L5EA 2OSSA 5ENFA 4LC2A 4ZC9A 3UW9A 4TZ8A 5IGNA 4PTBA 5HRXA 2RFJA 5ENHA 4A9JA 5AMFA 2RNXA 4O72A 5AD3A 3U5NA 5EGUA 4O71A 5F1LA 5LKXA 4UYFB 2E7OA 5LVQA 4YYIA 5J0DA 2RS9B 5FBXA 2RO1A 4KV1A 5HELA 2GRCA 4HBYA 5KTWA 3SVHA 4UIVA 4XUBA 5ENIA 4QEUA 4IOOA 5HRWA 5LVRA 5CQ5A 4MR6A 1E6IA 3QZVA 4IR3A 3U5KA 4IORA 4A9FA 4CUPA 5CQ3A 5I86A 4TTEA 4UYFA 5I88A 5LKTA 4NUCA 4BW2A 4YH3A 4O77A 2F6JA 5EPSA 2NXBA 2YW5A 4YABA 3S92A 5HQ7A 2KTBB 5FE5A 4QNSA 5CQ7A 5DYAA 5EA1A 5ENJA 5FFYA 4O7AA 4UIXA 4PS5A 4BW3A 5CUGA 4LYSA 5BT4A 5E9KA 4C66A 4J0RA 5EP7A 5BT5A 4NQNA 5IBNA 3LXJA 2WP2A 4NYVA 4YAXA 4YYKA 4QEVA 5L97A 4HXRA 3K2JA 4HXMA 4MEOA 5D3RA 5DFCA 2OUOA 5KTXA 5EU1A 2RNWA 4LR6A 3P1EA 4A9KA 4QEWA 5DLZA 4CL9A 1JSPB 5DKDA 4A9LA 4QSVA 4QYLA 4QC3A 4J0SA 4LYWA 3SVGA 5D25A 4NUDA 4O7FA 4TT2A 5LJ1A 4AKNA 3HMHA 4WHUA 4NRAA 4IR5A 4YBSA 4YY4A 4N4FA 5EPRA 4QSXA 5LJ0A 4MEQA 5L98A 4NUEA 4XY8A 4A9IA 3U5OA 3O35A 5A5NA 5FE3A 5KO4A 4HXLA 5AMEA 4HXPA 5EWDA 5A82A 4N3WA 4LZ2A 5F63A 2D82A 4PCEA 4O76A 4BHWA 5F1HA 2R10A 5C4QA 3O36A 5EWHA 5FB1A 2I7KA 2MJVB 3UV2A 5C8GA 5I29A 4BW1A 4QSQA 5CGPA 5D3JA 2DVVA 2FSAA 5E3GA 5HENA 5FE0A 3QZSA 4OGIA 5D26A 5II1A 2DVRA 4TU4A 4UYHA 3U5MA 3MULA 5D7XA 5I7YA 4Z6HA 4UIYA 5TB6A 5H1TA 2E7NA 4ALGA 2YDWA 2RNYA 5FE9A 3LQIA 5FFVA 2F6NA 3P1DA 4HXNA 5DX4A 4QBMA 5IGKA 3MXFA 5KTUA 5L8UA 4CURA 5HFRA 4QY4A 5HQ5A 5IGMA 1X0JA 3U5LA 5DYCA 3JVKA 5ENCA 4UYDA 5ENGA 5II2A 4QSWA 5A5SA 4YYDA 4BJXA 4QR5A 3U5JA 4QB3A 5EVAA 2R0SA 4YC9A 5CPEA 2DATA 3MQMA 5F25A 2R0YA 4O74A 5G4RA 4IR6A 5E3DA 3MUKA 4YYMA 5HEMA 4QYDA 3HMFA 4WHWA 2R0VA 1WUMA 2L85A 4QUUA 4TYLA 4XYAA 2WP1A 4QSTA 1ZS5A 5CQ6A 4HXSA 4QZSA 5EPBA 5D3NA 4N4HA 2DKWA 4NRBA 4YYGA 5A81A 5A5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LUU A;  5TCM A;  5EV9 A;  2L84 A;  5L96 A;  5F62 A;  4YY6 A;  5E7D A;  5EWW A;  5FE1 A;  4UIT A;  4TZ2 A;  5CS8 A;  4KV4 A;  4WIV A;  5DW2 A;  5CQ8 A;  5A85 A;  4Q0O A;  4N4G A;  2YEL A;  3UVW A;  3D7C A;  4YAD A;  5EIC A;  3JVM A;  5I83 A;  2DVS A;  5IID A;  5IG6 A;  4QSU A;  2I8N A;  3LJW A;  5HCL A;  1N72 A;  3UVX A;  3IU6 A;  5D3H A;  4LZS A;  4A9O A;  5EWC A;  4XUA A;  5E73 A;  5CRM A;  3O37 A;  5D3T A;  5DKC A;  3DWY A;  5CUC A;  3AAD A;  4A9N A;  5COI A;  3RCW A;  4NRC A;  4O7E A;  4TU6 A;  5HJC A;  5KHM A;  5E9M A;  5F36 A;  5CUD A;  4NYX A;  5CQT A;  5K29 A;  5H85 A;  4QSR A;  4O75 A;  5CTL A;  4TT6 A;  4LDF A;  4ZQL A;  5FH6 A;  4QC1 A;  5G4S A;  4HBX A;  5ETD A;  5C87 A;  3S91 A;  4QSP A;  4YAT A;  5DY7 A;  4YK0 A;  5EIS A;  5CQA A;  4OGJ A;  4TS8 A;  4MR4 A;  4UIU A;  4A9E A;  5CUA A;  4A9M A;  4NR8 A;  5LKZ A;  3JVL A;  5DFB A;  3LQH A;  5A5Q A;  4O7C A;  2OO1 A;  4NR9 A;  5KU3 A;  3NXB A;  4O70 A;  5F2P A;  5D0C A;  5FDZ A;  5I80 A;  4NQM A;  4DON A;  4QR4 A;  5DBM A;  5A7C A;  3ZYU A;  5EI4 A;  4Q0N A;  4E96 A;  5DYU A;  5FG5 A;  3TLP A;  5C7N A;  3P1C A;  5E9L A;  5CP5 A;  5I1Q A;  1F68 A;  4UIZ A;  4MEP A;  4IOQ A;  3JVJ A;  4CUT A;  5EQ1 A;  4Z6I A;  3MB3 A;  4CUS A;  5F5Z A;  5FB0 A;  4RVR A;  2H60 A;  5C85 A;  5HQ6 A;  5BT3 A;  5L99 A;  4YYN A;  2N9G A;  5CFW A;  5JWM A;  4HXO A;  4X2I A;  5C89 A;  3U5P A;  1JM4 B;  4C67 A;  4UYG A;  5DW1 A;  2D9E A;  4MEN A;  2RI7 A;  5FE7 A;  4ALH A;  5HLS A;  5CU8 A;  4ZW1 A;  4HBW A;  3FKM X;  5HM0 A;  5FH8 A;  4J1P A;  5I7X A;  3G0L A;  4GPJ A;  5FE4 A;  5LKU A;  5EM3 A;  5A83 A;  4FLP A;  3P1F A;  4LYI A;  4NR4 A;  5F60 A;  5D3L A;  4NR5 A;  3Q2E A;  5A5P A;  5AD2 A;  5ACY A;  4HXK A;  5L8T A;  4CLB A;  3G0J A;  5FFW A;  4KCX A;  4MR5 A;  4YYJ A;  4Z1Q A;  3ONI A;  2YQD A;  4YYH A;  2E3K A;  5E9V A;  3HME A;  5ENB A;  4HBV A;  5I40 A;  4QUT A;  5EWV A;  5FH7 A;  2YYN A;  5CUB A;  5ENE A;  3LQJ A;  4UIW A;  5CZG A;  5LJ2 A;  1WUG A;  5HRV A;  5F61 A;  5CRZ A;  3Q2F A;  5F3A A;  4CFK A;  5H1U A;  4LZR A;  5CY9 A;  4PKL A;  4YBM A;  5I89 A;  3UVD A;  5H1V A;  3MB4 A;  3P5O A;  5CUE A;  4F3I A;  4Y03 A;  4CUQ A;  4N4I A;  4QSS A;  5D3S A;  2G4A A;  3O34 A;  5E9Y A;  4TT4 A;  4TQN A;  5DFD A;  5FG4 A;  1EQF A;  3UVY A;  4A9H A;  3AQA A;  3QZT A;  2DWW A;  4UYE A;  4Z93 A;  3I3J A;  4Z1S A;  5FE6 A;  4BW4 A;  5ETB A;  5D24 A;  4J3I A;  3GG3 A;  4NXJ A;  4PY6 A;  5CQ4 A;  3UV4 A;  2DVQ A;  4XY9 A;  5HFQ A;  4LRG A;  4O7B A;  2LSP B;  5DYX A;  5FE2 A;  2YEM A;  5D3P A;  4NS5 A;  5E74 A;  5E0R A;  5FG6 A;  4CUU A;  4NR6 A;  3O33 A;  4O78 A;  5DLX A;  4MR3 A;  4NR7 A;  5JI8 A;  5FE8 A;  4YH4 A;  5DKH A;  3UV5 A;  5EK9 A;  5IGL A;  4OUF A;  4CFL A;  4IR4 A;  4PCI A;  2YEK A;  4QR3 A;  4YBT A;  5E9I A;  3IU5 A;  4NYW A;  3DAI A;  3SVF A;  5A5R A;  2L5E A;  2OSS A;  5ENF A;  4LC2 A;  4ZC9 A;  3UW9 A;  4TZ8 A;  5IGN A;  4PTB A;  5HRX A;  2RFJ A;  5ENH A;  4A9J A;  5AMF A;  2RNX A;  4O72 A;  5AD3 A;  3U5N A;  5EGU A;  4O71 A;  5F1L A;  5LKX A;  4UYF B;  2E7O A;  5LVQ A;  4YYI A;  5J0D A;  2RS9 B;  5FBX A;  2RO1 A;  4KV1 A;  5HEL A;  2GRC A;  4HBY A;  5KTW A;  3SVH A;  4UIV A;  4XUB A;  5ENI A;  4QEU A;  4IOO A;  5HRW A;  5LVR A;  5CQ5 A;  4MR6 A;  1E6I A;  3QZV A;  4IR3 A;  3U5K A;  4IOR A;  4A9F A;  4CUP A;  5CQ3 A;  5I86 A;  4TTE A;  4UYF A;  5I88 A;  5LKT A;  4NUC A;  4BW2 A;  4YH3 A;  4O77 A;  2F6J A;  5EPS A;  2NXB A;  2YW5 A;  4YAB A;  3S92 A;  5HQ7 A;  2KTB B;  5FE5 A;  4QNS A;  5CQ7 A;  5DYA A;  5EA1 A;  5ENJ A;  5FFY A;  4O7A A;  4UIX A;  4PS5 A;  4BW3 A;  5CUG A;  4LYS A;  5BT4 A;  5E9K A;  4C66 A;  4J0R A;  5EP7 A;  5BT5 A;  4NQN A;  5IBN A;  3LXJ A;  2WP2 A;  4NYV A;  4YAX A;  4YYK A;  4QEV A;  5L97 A;  4HXR A;  3K2J A;  4HXM A;  4MEO A;  5D3R A;  5DFC A;  2OUO A;  5KTX A;  5EU1 A;  2RNW A;  4LR6 A;  3P1E A;  4A9K A;  4QEW A;  5DLZ A;  4CL9 A;  1JSP B;  5DKD A;  4A9L A;  4QSV A;  4QYL A;  4QC3 A;  4J0S A;  4LYW A;  3SVG A;  5D25 A;  4NUD A;  4O7F A;  4TT2 A;  5LJ1 A;  4AKN A;  3HMH A;  4WHU A;  4NRA A;  4IR5 A;  4YBS A;  4YY4 A;  4N4F A;  5EPR A;  4QSX A;  5LJ0 A;  4MEQ A;  5L98 A;  4NUE A;  4XY8 A;  4A9I A;  3U5O A;  3O35 A;  5A5N A;  5FE3 A;  5KO4 A;  4HXL A;  5AME A;  4HXP A;  5EWD A;  5A82 A;  4N3W A;  4LZ2 A;  5F63 A;  2D82 A;  4PCE A;  4O76 A;  4BHW A;  5F1H A;  2R10 A;  5C4Q A;  3O36 A;  5EWH A;  5FB1 A;  2I7K A;  2MJV B;  3UV2 A;  5C8G A;  5I29 A;  4BW1 A;  4QSQ A;  5CGP A;  5D3J A;  2DVV A;  2FSA A;  5E3G A;  5HEN A;  5FE0 A;  3QZS A;  4OGI A;  5D26 A;  5II1 A;  2DVR A;  4TU4 A;  4UYH A;  3U5M A;  3MUL A;  5D7X A;  5I7Y A;  4Z6H A;  4UIY A;  5TB6 A;  5H1T A;  2E7N A;  4ALG A;  2YDW A;  2RNY A;  5FE9 A;  3LQI A;  5FFV A;  2F6N A;  3P1D A;  4HXN A;  5DX4 A;  4QBM A;  5IGK A;  3MXF A;  5KTU A;  5L8U A;  4CUR A;  5HFR A;  4QY4 A;  5HQ5 A;  5IGM A;  1X0J A;  3U5L A;  5DYC A;  3JVK A;  5ENC A;  4UYD A;  5ENG A;  5II2 A;  4QSW A;  5A5S A;  4YYD A;  4BJX A;  4QR5 A;  3U5J A;  4QB3 A;  5EVA A;  2R0S A;  4YC9 A;  5CPE A;  2DAT A;  3MQM A;  5F25 A;  2R0Y A;  4O74 A;  5G4R A;  4IR6 A;  5E3D A;  3MUK A;  4YYM A;  5HEM A;  4QYD A;  3HMF A;  4WHW A;  2R0V A;  1WUM A;  2L85 A;  4QUU A;  4TYL A;  4XYA A;  2WP1 A;  4QST A;  1ZS5 A;  5CQ6 A;  4HXS A;  4QZS A;  5EPB A;  5D3N A;  4N4H A;  2DKW A;  4NRB A;  4YYG A;  5A81 A;  5A5O A; 
#chains in the Genus database with same CATH topology
 5LUU A;  5TCM A;  5EV9 A;  2L84 A;  5L96 A;  5F62 A;  4AKG A;  4YY6 A;  5E7D A;  5EWW A;  5FE1 A;  4UIT A;  4TZ2 A;  5CS8 A;  4KV4 A;  4WIV A;  5DW2 A;  5CQ8 A;  5A85 A;  4Q0O A;  4N4G A;  2YEL A;  3UVW A;  3D7C A;  4YAD A;  5EIC A;  3JVM A;  5I83 A;  2DVS A;  5IID A;  5IG6 A;  4QSU A;  2I8N A;  3LJW A;  5HCL A;  1N72 A;  3UVX A;  3IU6 A;  5D3H A;  4LZS A;  4A9O A;  5EWC A;  4XUA A;  5E73 A;  5CRM A;  3O37 A;  5D3T A;  5DKC A;  3DWY A;  5CUC A;  3AAD A;  4A9N A;  5COI A;  3RCW A;  4NRC A;  4O7E A;  4TU6 A;  5HJC A;  5KHM A;  5E9M A;  5F36 A;  5CUD A;  4NYX A;  5CQT A;  5K29 A;  5H85 A;  4QSR A;  4O75 A;  5CTL A;  4TT6 A;  4LDF A;  4ZQL A;  5FH6 A;  4QC1 A;  5G4S A;  4HBX A;  5ETD A;  5C87 A;  3S91 A;  4QSP A;  4YAT A;  5DY7 A;  4YK0 A;  5EIS A;  5CQA A;  4OGJ A;  4TS8 A;  4MR4 A;  4UIU A;  4A9E A;  5CUA A;  4A9M A;  4NR8 A;  5LKZ A;  3JVL A;  5DFB A;  3LQH A;  5A5Q A;  4O7C A;  2OO1 A;  4NR9 A;  5KU3 A;  3NXB A;  4O70 A;  5F2P A;  5D0C A;  5FDZ A;  5I80 A;  4NQM A;  4DON A;  4QR4 A;  5DBM A;  5A7C A;  3ZYU A;  5EI4 A;  4Q0N A;  4E96 A;  5DYU A;  5FG5 A;  3TLP A;  5C7N A;  3P1C A;  5E9L A;  5CP5 A;  5I1Q A;  1F68 A;  4UIZ A;  4MEP A;  4IOQ A;  3JVJ A;  4CUT A;  5EQ1 A;  4Z6I A;  3MB3 A;  4CUS A;  5F5Z A;  5FB0 A;  4RVR A;  2H60 A;  5C85 A;  5HQ6 A;  5BT3 A;  5L99 A;  4YYN A;  2N9G A;  5CFW A;  5JWM A;  4HXO A;  4X2I A;  5C89 A;  3U5P A;  1JM4 B;  4C67 A;  3VKH A;  4UYG A;  5DW1 A;  2D9E A;  4MEN A;  2RI7 A;  5FE7 A;  4ALH A;  5HLS A;  5CU8 A;  4ZW1 A;  4HBW A;  3FKM X;  5HM0 A;  5FH8 A;  4J1P A;  5I7X A;  3G0L A;  4GPJ A;  5FE4 A;  5LKU A;  5EM3 A;  5A83 A;  4FLP A;  3P1F A;  4LYI A;  4NR4 A;  5F60 A;  5D3L A;  4NR5 A;  3Q2E A;  5A5P A;  5AD2 A;  5ACY A;  4HXK A;  5L8T A;  4CLB A;  3G0J A;  5FFW A;  4KCX A;  4MR5 A;  4YYJ A;  4Z1Q A;  3ONI A;  2YQD A;  4YYH A;  2E3K A;  5E9V A;  3HME A;  5ENB A;  4HBV A;  5I40 A;  4QUT A;  5EWV A;  5FH7 A;  2YYN A;  5CUB A;  5ENE A;  3LQJ A;  4UIW A;  5CZG A;  5LJ2 A;  1WUG A;  5HRV A;  5F61 A;  5CRZ A;  3Q2F A;  5F3A A;  4CFK A;  5H1U A;  4LZR A;  5CY9 A;  4PKL A;  4YBM A;  5I89 A;  3UVD A;  5H1V A;  3MB4 A;  3P5O A;  5CUE A;  4F3I A;  4Y03 A;  4CUQ A;  4N4I A;  4QSS A;  5D3S A;  2G4A A;  3O34 A;  5E9Y A;  4TT4 A;  4TQN A;  5DFD A;  5FG4 A;  1EQF A;  3UVY A;  4A9H A;  3AQA A;  3QZT A;  2DWW A;  4UYE A;  4Z93 A;  3I3J A;  4Z1S A;  5FE6 A;  4BW4 A;  5ETB A;  5D24 A;  4J3I A;  3GG3 A;  4NXJ A;  4PY6 A;  5CQ4 A;  3UV4 A;  2DVQ A;  4XY9 A;  5HFQ A;  4LRG A;  4O7B A;  2LSP B;  5DYX A;  5FE2 A;  2YEM A;  5D3P A;  4NS5 A;  5E74 A;  5E0R A;  5FG6 A;  4CUU A;  4NR6 A;  3O33 A;  4O78 A;  5DLX A;  4MR3 A;  4NR7 A;  5JI8 A;  5FE8 A;  4YH4 A;  5DKH A;  3UV5 A;  5EK9 A;  5IGL A;  4OUF A;  4CFL A;  4IR4 A;  4PCI A;  2YEK A;  4QR3 A;  4YBT A;  5E9I A;  3IU5 A;  4NYW A;  4AKI A;  3DAI A;  3SVF A;  5A5R A;  2L5E A;  2OSS A;  1ZKR A;  4LC2 A;  5ENF A;  4ZC9 A;  1PUO A;  4TZ8 A;  3UW9 A;  5IGN A;  4PTB A;  5HRX A;  2RFJ A;  5ENH A;  4A9J A;  5AMF A;  2RNX A;  4O72 A;  5AD3 A;  3U5N A;  5EGU A;  4O71 A;  5F1L A;  5LKX A;  4UYF B;  2E7O A;  5LVQ A;  4YYI A;  5J0D A;  2RS9 B;  5FBX A;  2RO1 A;  4KV1 A;  5HEL A;  2GRC A;  4HBY A;  5KTW A;  3SVH A;  4UIV A;  4XUB A;  5ENI A;  3D1D A;  4QEU A;  4IOO A;  5HRW A;  5LVR A;  5CQ5 A;  4MR6 A;  1E6I A;  3QZV A;  4IR3 A;  3U5K A;  4IOR A;  4A9F A;  4CUP A;  5CQ3 A;  5I86 A;  4TTE A;  4UYF A;  5I88 A;  5LKT A;  4NUC A;  4BW2 A;  4YH3 A;  4O77 A;  2F6J A;  5EPS A;  2NXB A;  2YW5 A;  4YAB A;  3ERR A;  3S92 A;  5HQ7 A;  2KTB B;  5FE5 A;  4QNS A;  5CQ7 A;  5DYA A;  5EA1 A;  5ENJ A;  5FFY A;  4O7A A;  4UIX A;  4PS5 A;  4BW3 A;  5CUG A;  4LYS A;  5BT4 A;  5E9K A;  4C66 A;  4J0R A;  5EP7 A;  5BT5 A;  4NQN A;  5IBN A;  3LXJ A;  2WP2 A;  4NYV A;  4YAX A;  4YYK A;  4QEV A;  5L97 A;  4HXR A;  3K2J A;  4HXM A;  4MEO A;  5D3R A;  5DFC A;  2OUO A;  5KTX A;  5EU1 A;  2RNW A;  4LR6 A;  3P1E A;  4A9K A;  4QEW A;  5DLZ A;  4CL9 A;  1JSP B;  3D1B A;  5DKD A;  4A9L A;  4QSV A;  4QYL A;  4QC3 A;  4J0S A;  4LYW A;  3SVG A;  5D25 A;  4NUD A;  4O7F A;  4TT2 A;  5LJ1 A;  4AKN A;  3HMH A;  4WHU A;  4NRA A;  4IR5 A;  4YBS A;  4YY4 A;  4N4F A;  5EPR A;  4QSX A;  5LJ0 A;  4MEQ A;  5L98 A;  4NUE A;  4XY8 A;  4A9I A;  3U5O A;  3O35 A;  4AKH A;  5A5N A;  5FE3 A;  5KO4 A;  4HXL A;  5AME A;  4HXP A;  5EWD A;  5A82 A;  4N3W A;  4AI6 A;  4LZ2 A;  5F63 A;  2D82 A;  4PCE A;  4O76 A;  4BHW A;  3VKG A;  5F1H A;  2R10 A;  5C4Q A;  3O36 A;  5EWH A;  5FB1 A;  2I7K A;  2MJV B;  3UV2 A;  5C8G A;  5I29 A;  4BW1 A;  4QSQ A;  5CGP A;  5D3J A;  2DVV A;  2FSA A;  5E3G A;  5HEN A;  5FE0 A;  3QZS A;  4OGI A;  5D26 A;  5II1 A;  2DVR A;  4TU4 A;  4UYH A;  3U5M A;  3MUL A;  5D7X A;  5I7Y A;  4Z6H A;  4UIY A;  5TB6 A;  5H1T A;  2E7N A;  4ALG A;  2YDW A;  2RNY A;  5FE9 A;  3LQI A;  5FFV A;  2F6N A;  3P1D A;  4HXN A;  5DX4 A;  4QBM A;  5IGK A;  3MXF A;  5KTU A;  5L8U A;  2EJN A;  4CUR A;  5HFR A;  4QY4 A;  5HQ5 A;  5IGM A;  1X0J A;  3U5L A;  5DYC A;  3JVK A;  5ENC A;  4UYD A;  5ENG A;  5II2 A;  4QSW A;  5A5S A;  4YYD A;  4BJX A;  4QR5 A;  3U5J A;  4QB3 A;  5EVA A;  2R0S A;  4YC9 A;  5CPE A;  2DAT A;  3MQM A;  5F25 A;  2R0Y A;  4O74 A;  5G4R A;  4IR6 A;  5E3D A;  3MUK A;  4YYM A;  5HEM A;  4QYD A;  3HMF A;  4WHW A;  2R0V A;  1WUM A;  2L85 A;  4QUU A;  4TYL A;  4XYA A;  2WP1 A;  4QST A;  1ZS5 A;  5CQ6 A;  4HXS A;  4QZS A;  5EPB A;  5D3N A;  4N4H A;  2DKW A;  4NRB A;  4YYG A;  5A81 A;  5A5O A; 
#chains in the Genus database with same CATH homology
 5LUU A;  5TCM A;  5EV9 A;  2L84 A;  5L96 A;  5F62 A;  4YY6 A;  5E7D A;  5EWW A;  5FE1 A;  4UIT A;  4TZ2 A;  5CS8 A;  4KV4 A;  4WIV A;  5DW2 A;  5CQ8 A;  5A85 A;  4Q0O A;  4N4G A;  2YEL A;  3UVW A;  3D7C A;  4YAD A;  5EIC A;  3JVM A;  5I83 A;  2DVS A;  5IID A;  5IG6 A;  4QSU A;  2I8N A;  3LJW A;  5HCL A;  1N72 A;  3UVX A;  3IU6 A;  5D3H A;  4LZS A;  4A9O A;  5EWC A;  4XUA A;  5E73 A;  5CRM A;  3O37 A;  5D3T A;  5DKC A;  3DWY A;  5CUC A;  3AAD A;  4A9N A;  5COI A;  3RCW A;  4NRC A;  4O7E A;  4TU6 A;  5HJC A;  5KHM A;  5E9M A;  5F36 A;  5CUD A;  4NYX A;  5CQT A;  5K29 A;  5H85 A;  4QSR A;  4O75 A;  5CTL A;  4TT6 A;  4LDF A;  4ZQL A;  5FH6 A;  4QC1 A;  5G4S A;  4HBX A;  5ETD A;  5C87 A;  3S91 A;  4QSP A;  4YAT A;  5DY7 A;  4YK0 A;  5EIS A;  5CQA A;  4OGJ A;  4TS8 A;  4MR4 A;  4UIU A;  4A9E A;  5CUA A;  4A9M A;  4NR8 A;  5LKZ A;  3JVL A;  5DFB A;  3LQH A;  5A5Q A;  4O7C A;  2OO1 A;  4NR9 A;  5KU3 A;  3NXB A;  4O70 A;  5F2P A;  5D0C A;  5FDZ A;  5I80 A;  4NQM A;  4DON A;  4QR4 A;  5DBM A;  5A7C A;  3ZYU A;  5EI4 A;  4Q0N A;  4E96 A;  5DYU A;  5FG5 A;  3TLP A;  5C7N A;  3P1C A;  5E9L A;  5CP5 A;  5I1Q A;  1F68 A;  4UIZ A;  4MEP A;  4IOQ A;  3JVJ A;  4CUT A;  5EQ1 A;  4Z6I A;  3MB3 A;  4CUS A;  5F5Z A;  5FB0 A;  4RVR A;  2H60 A;  5C85 A;  5HQ6 A;  5BT3 A;  5L99 A;  4YYN A;  2N9G A;  5CFW A;  5JWM A;  4HXO A;  4X2I A;  5C89 A;  3U5P A;  1JM4 B;  4C67 A;  4UYG A;  5DW1 A;  2D9E A;  4MEN A;  2RI7 A;  5FE7 A;  4ALH A;  5HLS A;  5CU8 A;  4ZW1 A;  4HBW A;  3FKM X;  5HM0 A;  5FH8 A;  4J1P A;  5I7X A;  3G0L A;  4GPJ A;  5FE4 A;  5LKU A;  5EM3 A;  5A83 A;  4FLP A;  3P1F A;  4LYI A;  4NR4 A;  5F60 A;  5D3L A;  4NR5 A;  3Q2E A;  5A5P A;  5AD2 A;  5ACY A;  4HXK A;  5L8T A;  4CLB A;  3G0J A;  5FFW A;  4KCX A;  4MR5 A;  4YYJ A;  4Z1Q A;  3ONI A;  2YQD A;  4YYH A;  2E3K A;  5E9V A;  3HME A;  5ENB A;  4HBV A;  5I40 A;  4QUT A;  5EWV A;  5FH7 A;  2YYN A;  5CUB A;  5ENE A;  3LQJ A;  4UIW A;  5CZG A;  5LJ2 A;  1WUG A;  5HRV A;  5F61 A;  5CRZ A;  3Q2F A;  5F3A A;  4CFK A;  5H1U A;  4LZR A;  5CY9 A;  4PKL A;  4YBM A;  5I89 A;  3UVD A;  5H1V A;  3MB4 A;  3P5O A;  5CUE A;  4F3I A;  4Y03 A;  4CUQ A;  4N4I A;  4QSS A;  5D3S A;  2G4A A;  3O34 A;  5E9Y A;  4TT4 A;  4TQN A;  5DFD A;  5FG4 A;  1EQF A;  3UVY A;  4A9H A;  3AQA A;  3QZT A;  2DWW A;  4UYE A;  4Z93 A;  3I3J A;  4Z1S A;  5FE6 A;  4BW4 A;  5ETB A;  5D24 A;  4J3I A;  3GG3 A;  4NXJ A;  4PY6 A;  5CQ4 A;  3UV4 A;  2DVQ A;  4XY9 A;  5HFQ A;  4LRG A;  4O7B A;  2LSP B;  5DYX A;  5FE2 A;  2YEM A;  5D3P A;  4NS5 A;  5E74 A;  5E0R A;  5FG6 A;  4CUU A;  4NR6 A;  3O33 A;  4O78 A;  5DLX A;  4MR3 A;  4NR7 A;  5JI8 A;  5FE8 A;  4YH4 A;  5DKH A;  3UV5 A;  5EK9 A;  5IGL A;  4OUF A;  4CFL A;  4IR4 A;  4PCI A;  2YEK A;  4QR3 A;  4YBT A;  5E9I A;  3IU5 A;  4NYW A;  3DAI A;  3SVF A;  5A5R A;  2L5E A;  2OSS A;  5ENF A;  4LC2 A;  4ZC9 A;  3UW9 A;  4TZ8 A;  5IGN A;  4PTB A;  5HRX A;  2RFJ A;  5ENH A;  4A9J A;  5AMF A;  2RNX A;  4O72 A;  5AD3 A;  3U5N A;  5EGU A;  4O71 A;  5F1L A;  5LKX A;  4UYF B;  2E7O A;  5LVQ A;  4YYI A;  5J0D A;  2RS9 B;  5FBX A;  2RO1 A;  4KV1 A;  5HEL A;  2GRC A;  4HBY A;  5KTW A;  3SVH A;  4UIV A;  4XUB A;  5ENI A;  4QEU A;  4IOO A;  5HRW A;  5LVR A;  5CQ5 A;  4MR6 A;  1E6I A;  3QZV A;  4IR3 A;  3U5K A;  4IOR A;  4A9F A;  4CUP A;  5CQ3 A;  5I86 A;  4TTE A;  4UYF A;  5I88 A;  5LKT A;  4NUC A;  4BW2 A;  4YH3 A;  4O77 A;  2F6J A;  5EPS A;  2NXB A;  2YW5 A;  4YAB A;  3S92 A;  5HQ7 A;  2KTB B;  5FE5 A;  4QNS A;  5CQ7 A;  5DYA A;  5EA1 A;  5ENJ A;  5FFY A;  4O7A A;  4UIX A;  4PS5 A;  4BW3 A;  5CUG A;  4LYS A;  5BT4 A;  5E9K A;  4C66 A;  4J0R A;  5EP7 A;  5BT5 A;  4NQN A;  5IBN A;  3LXJ A;  2WP2 A;  4NYV A;  4YAX A;  4YYK A;  4QEV A;  5L97 A;  4HXR A;  3K2J A;  4HXM A;  4MEO A;  5D3R A;  5DFC A;  2OUO A;  5KTX A;  5EU1 A;  2RNW A;  4LR6 A;  3P1E A;  4A9K A;  4QEW A;  5DLZ A;  4CL9 A;  1JSP B;  5DKD A;  4A9L A;  4QSV A;  4QYL A;  4QC3 A;  4J0S A;  4LYW A;  3SVG A;  5D25 A;  4NUD A;  4O7F A;  4TT2 A;  5LJ1 A;  4AKN A;  3HMH A;  4WHU A;  4NRA A;  4IR5 A;  4YBS A;  4YY4 A;  4N4F A;  5EPR A;  4QSX A;  5LJ0 A;  4MEQ A;  5L98 A;  4NUE A;  4XY8 A;  4A9I A;  3U5O A;  3O35 A;  5A5N A;  5FE3 A;  5KO4 A;  4HXL A;  5AME A;  4HXP A;  5EWD A;  5A82 A;  4N3W A;  4LZ2 A;  5F63 A;  2D82 A;  4PCE A;  4O76 A;  4BHW A;  5F1H A;  2R10 A;  5C4Q A;  3O36 A;  5EWH A;  5FB1 A;  2I7K A;  2MJV B;  3UV2 A;  5C8G A;  5I29 A;  4BW1 A;  4QSQ A;  5CGP A;  5D3J A;  2DVV A;  2FSA A;  5E3G A;  5HEN A;  5FE0 A;  3QZS A;  4OGI A;  5D26 A;  5II1 A;  2DVR A;  4TU4 A;  4UYH A;  3U5M A;  3MUL A;  5D7X A;  5I7Y A;  4Z6H A;  4UIY A;  5TB6 A;  5H1T A;  2E7N A;  4ALG A;  2YDW A;  2RNY A;  5FE9 A;  3LQI A;  5FFV A;  2F6N A;  3P1D A;  4HXN A;  5DX4 A;  4QBM A;  5IGK A;  3MXF A;  5KTU A;  5L8U A;  4CUR A;  5HFR A;  4QY4 A;  5HQ5 A;  5IGM A;  1X0J A;  3U5L A;  5DYC A;  3JVK A;  5ENC A;  4UYD A;  5ENG A;  5II2 A;  4QSW A;  5A5S A;  4YYD A;  4BJX A;  4QR5 A;  3U5J A;  4QB3 A;  5EVA A;  2R0S A;  4YC9 A;  5CPE A;  2DAT A;  3MQM A;  5F25 A;  2R0Y A;  4O74 A;  5G4R A;  4IR6 A;  5E3D A;  3MUK A;  4YYM A;  5HEM A;  4QYD A;  3HMF A;  4WHW A;  2R0V A;  1WUM A;  2L85 A;  4QUU A;  4TYL A;  4XYA A;  2WP1 A;  4QST A;  1ZS5 A;  5CQ6 A;  4HXS A;  4QZS A;  5EPB A;  5D3N A;  4N4H A;  2DKW A;  4NRB A;  4YYG A;  5A81 A;  5A5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...