4NR6A

Crystal structure of the bromodomain of human crebbp in complex with an oxazepin ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/inhibitor
molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with an oxazepin ligand
rcsb
source organism Homo sapiens
total genus 42
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nr6A00
4XUBA 4HXOA 4NS5A 3O36A 4AKNA 5D3NA 4CUPA 5K29A 5F25A 5CUEA 4J3IA 3UV5A 3UW9A 5KU3A 5A83A 1ZS5A 5FE6A 4QR4A 2RFJA 5CUAA 5D3RA 1E6IA 4HXRA 5EK9A 4BW3A 2GRCA 4KV4A 4MR3A 4PTBA 5HCLA 3LQHA 2H60A 2YELA 5E3DA 4LRGA 5ENFA 5KO4A 4MEQA 4HXSA 4O72A 4QSQA 4CUSA 2YQDA 5HQ7A 5FBXA 4TTEA 3SVFA 5HQ6A 5KTWA 5F5ZA 3P1EA 5DY7A 5IGMA 5L8TA 4YY4A 1EQFA 3HMHA 4OUFA 4IR4A 5E73A 5HRVA 5FE9A 2WP1A 5CUCA 5F62A 4J1PA 5IBNA 4NR7A 5A5SA 5DYXA 4F3IA 2WP2A 3JVKA 4LDFA 5HELA 4A9MA 4LZSA 5DBMA 4HXNA 5I80A 5E9KA 5FE0A 3G0LA 4QYDA 5EP7A 4Z1SA 2MJVB 5TB6A 4O7EA 5F63A 5EVAA 4O75A 4QC1A 3JVJA 3LQJA 3RCWA 4HXMA 5EPBA 4TYLA 4NRCA 5F61A 4IR6A 5I83A 5LJ1A 5LKZA 5FFVA 5CUBA 5IG6A 5F36A 3HMEA 5CQAA 5AD2A 4QSRA 4TQNA 4UIWA 5J0DA 3UVYA 3U5OA 4C67A 2OUOA 5L98A 3ZYUA 5A81A 2L85A 5CQ4A 4TT4A 2L84A 5E9YA 4YYJA 5A7CA 3MB3A 2E7NA 4UIZA 4KV1A 3S92A 5LKTA 4LYIA 4O7BA 4O7AA 5EGUA 5FFWA 5FG5A 5TCMA 4HBVA 5A85A 4A9KA 4YYHA 4NYXA 3SVGA 4PKLA 5COIA 4OGIA 4N4FA 2N9GA 4Z6IA 3I3JA 2RO1A 5D3HA 5DYUA 5CS8A 5I88A 5KHMA 5DKHA 4QNSA 4CFKA 5FE2A 4NRAA 4XYAA 4UIXA 2YYNA 4CLBA 4CURA 2NXBA 4HBYA 5DFCA 4O76A 5H85A 4ZQLA 2YEMA 3DWYA 2I7KA 3MB4A 5EPRA 5KTUA 5C85A 5D26A 5L99A 5LVRA 4HXPA 4FLPA 4YYGA 2DVVA 3FKMX 4YYIA 5LKUA 5LJ2A 2FSAA 3ONIA 5A5RA 3LQIA 5CP5A 5D3LA 5E9MA 4A9JA 5C87A 3QZVA 4HBWA 2R0SA 5FG4A 5I86A 2YW5A 5FG6A 5EI4A 4QR5A 5CZGA 3MXFA 5L8UA 1N72A 4Q0NA 4MR6A 5FE1A 5DYCA 4QSUA 4QUUA 3UV2A 5CRMA 3IU5A 5H1VA 4NR5A 4NQNA 4QSWA 4BW4A 4QEWA 5E9VA 2DATA 2RNXA 4HXLA 4NRBA 4WHWA 4O78A 5ENEA 5FH8A 5HQ5A 4XY8A 4DONA 4QSTA 5A82A 4QUTA 5DKCA 5CGPA 3UVXA 4YBSA 3D7CA 3U5MA 5D3PA 4YYKA 5A5OA 5LJ0A 4ALHA 3U5PA 3U5NA 4CL9A 4MEOA 4Y03A 4NR8A 5CQTA 5E9IA 4NUCA 4N4IA 2I8NA 3S91A 4CUUA 5L96A 3SVHA 5I40A 3U5JA 3P1FA 5G4RA 3UV4A 4BW2A 5HRWA 2RS9B 4XY9A 5F60A 5I7YA 3O34A 5IGNA 2F6NA 3O35A 5D3SA 4Z1QA 5DW2A 4YADA 3GG3A 4YYDA 5BT4A 4NUDA 2R10A 5EICA 5FB1A 4PCIA 5ENBA 5ETDA 2DVQA 4CUQA 5ENHA 5HM0A 4QB3A 5HLSA 3MULA 5EWWA 5JI8A 4Q0OA 4NYVA 4NQMA 4TZ2A 4CUTA 4TU4A 4ALGA 4KCXA 4Z93A 4YY6A 3Q2EA 3P5OA 5ETBA 4OGJA 4UYEA 4IR3A 4QSPA 4WHUA 5H1UA 4MR4A 4UYGA 5FE5A 4O7FA 5EWCA 5EM3A 3JVMA 4HBXA 5DYAA 2D82A 2E7OA 4QEUA 5D3JA 5D25A 5H1TA 2YEKA 3DAIA 5L97A 4Z6HA 4A9IA 5CQ7A 2LSPB 4QZSA 4RVRA 3AADA 4O77A 4BHWA 5A5NA 4IOOA 5HENA 5E7DA 4UYFB 2R0YA 4IOQA 5A5QA 3HMFA 4NUEA 5F1LA 4J0SA 4E96A 4A9LA 4X2IA 5C7NA 4YABA 4YH3A 3TLPA 5FE4A 3IU6A 5C8GA 3O37A 5HFRA 5C4QA 5CRZA 2D9EA 4GPJA 5ENGA 4UIVA 5AD3A 4YC9A 4A9HA 5EWHA 5CUDA 5BT5A 5EV9A 4QR3A 5I89A 4A9EA 4YK0A 5G4SA 4YAXA 4A9NA 4UITA 4N4HA 5HJCA 4BJXA 4QEVA 4CFLA 4TU6A 5FFYA 5D3TA 5D0CA 3K2JA 5DFBA 5BT3A 3QZSA 4QBMA 2RNWA 5EISA 3NXBA 4NR9A 4NYWA 1X0JA 4YATA 1JM4B 2G4AA 2RNYA 5E9LA 4MEPA 3AQAA 3LJWA 5EA1A 2OSSA 4N3WA 3P1CA 5D24A 5FB0A 5EQ1A 5F1HA 5DW1A 5FE8A 3UVWA 2F6JA 5E3GA 4YH4A 5DLZA 5FH6A 5I1QA 4UYDA 4QSVA 4TZ8A 4QSXA 4LZRA 5F3AA 4ZW1A 1WUGA 4MENA 4NR6A 4NR4A 4YBMA 5DFDA 3U5KA 5CUGA 5C89A 4N4GA 4TS8A 2DKWA 4MR5A 5A5PA 4J0RA 2RI7A 4PY6A 4QSSA 4QY4A 5CY9A 3MQMA 3P1DA 2DVSA 4C66A 5FH7A 5DLXA 5ACYA 5LUUA 4IR5A 5LVQA 5DX4A 4A9FA 4O74A 5HFQA 5IIDA 1F68A 5E74A 3JVLA 4UIYA 5IGKA 5CQ8A 5AMFA 5FE3A 4UYFA 5HRXA 4TT2A 4PS5A 4IORA 5AMEA 5CQ6A 5CU8A 4YBTA 5EWDA 5CQ3A 2KTBB 4A9OA 5I7XA 5KTXA 3MUKA 2OO1A 5E0RA 4PCEA 2DVRA 2R0VA 2YDWA 5II1A 5JWMA 4XUAA 4ZC9A 1WUMA 4LYWA 5CPEA 4TT6A 4LC2A 2DWWA 5CQ5A 4WIVA 3U5LA 4LR6A 5HEMA 5LKXA 4BW1A 5EWVA 1JSPB 4O71A 3O33A 5EPSA 5ENJA 5CTLA 4YYMA 4QC3A 5ENCA 5CFWA 3Q2FA 4LZ2A 5FDZA 5F2PA 3G0JA 4QYLA 3UVDA 4HXKA 5IGLA 5FE7A 5D7XA 3LXJA 2L5EA 2E3KA 5DKDA 5I29A 4O7CA 4UIUA 5II2A 4UYHA 5EU1A 4NXJA 3QZTA 4LYSA 5ENIA 4O70A 4YYNA
chains in the Genus database with same CATH superfamily
4XUBA 4HXOA 4NS5A 3O36A 4AKNA 5D3NA 4CUPA 5K29A 5F25A 5CUEA 4J3IA 3UV5A 3UW9A 5KU3A 5A83A 1ZS5A 5FE6A 4QR4A 2RFJA 5CUAA 5D3RA 1E6IA 4HXRA 5EK9A 4BW3A 2GRCA 4KV4A 4MR3A 4PTBA 5HCLA 3LQHA 2H60A 2YELA 5E3DA 4AI6A 4LRGA 5ENFA 5KO4A 4MEQA 4HXSA 4O72A 4QSQA 4CUSA 2YQDA 5HQ7A 5FBXA 4TTEA 3SVFA 5HQ6A 5KTWA 5F5ZA 3P1EA 5DY7A 5IGMA 5L8TA 4YY4A 1EQFA 3HMHA 4OUFA 4IR4A 5E73A 5HRVA 5FE9A 2WP1A 5CUCA 5F62A 4J1PA 5IBNA 4NR7A 5A5SA 5DYXA 4F3IA 2WP2A 3JVKA 4LDFA 5HELA 4A9MA 4LZSA 5DBMA 4HXNA 5I80A 5E9KA 5FE0A 3G0LA 4QYDA 5EP7A 4Z1SA 2MJVB 5TB6A 4O7EA 5F63A 5EVAA 4O75A 4QC1A 3JVJA 3LQJA 3RCWA 3D1DA 4HXMA 5EPBA 4TYLA 4NRCA 5F61A 4IR6A 5I83A 5LJ1A 5LKZA 5FFVA 5CUBA 5IG6A 5F36A 3HMEA 5CQAA 5AD2A 4QSRA 4TQNA 4UIWA 3ERRA 5J0DA 3UVYA 3U5OA 4C67A 2OUOA 5L98A 3ZYUA 5A81A 3VKHA 2L85A 5CQ4A 4TT4A 2L84A 5E9YA 4YYJA 5A7CA 4AKHA 3MB3A 2E7NA 4UIZA 4KV1A 3S92A 5LKTA 4LYIA 4O7BA 4O7AA 5EGUA 5FFWA 5FG5A 5TCMA 4HBVA 5A85A 4A9KA 4YYHA 4NYXA 3SVGA 4PKLA 5COIA 4OGIA 4N4FA 2N9GA 4Z6IA 3I3JA 2RO1A 5D3HA 5DYUA 5CS8A 5I88A 5KHMA 5DKHA 4QNSA 4CFKA 5FE2A 4NRAA 4XYAA 4UIXA 2YYNA 4CLBA 4CURA 2NXBA 4HBYA 5DFCA 4O76A 5H85A 4ZQLA 2YEMA 3DWYA 2I7KA 3MB4A 5EPRA 5KTUA 5C85A 5D26A 5L99A 4AKIA 5LVRA 4HXPA 4FLPA 4YYGA 2DVVA 3FKMX 4YYIA 5LKUA 5LJ2A 2FSAA 3ONIA 5A5RA 3LQIA 1PUOA 5CP5A 5D3LA 5E9MA 4A9JA 5C87A 3QZVA 4HBWA 2R0SA 5FG4A 5I86A 2YW5A 5FG6A 5EI4A 4QR5A 5CZGA 3MXFA 5L8UA 1N72A 4Q0NA 4MR6A 5FE1A 5DYCA 4QSUA 4QUUA 3UV2A 5CRMA 3IU5A 5H1VA 4NR5A 4NQNA 4QSWA 4BW4A 4QEWA 5E9VA 2DATA 2RNXA 4HXLA 4NRBA 4WHWA 4O78A 5ENEA 5FH8A 5HQ5A 4XY8A 4DONA 4QSTA 5A82A 4QUTA 5DKCA 5CGPA 3UVXA 4YBSA 3D7CA 3U5MA 5D3PA 4YYKA 5A5OA 5LJ0A 4ALHA 3U5PA 3U5NA 4CL9A 4MEOA 4Y03A 4NR8A 5CQTA 5E9IA 4NUCA 4N4IA 2I8NA 3S91A 4CUUA 5L96A 3SVHA 5I40A 3U5JA 3P1FA 5G4RA 3UV4A 4BW2A 5HRWA 2RS9B 4XY9A 5F60A 5I7YA 3O34A 5IGNA 2F6NA 3O35A 5D3SA 4Z1QA 5DW2A 4YADA 3GG3A 4YYDA 5BT4A 4NUDA 2R10A 5EICA 5FB1A 4PCIA 5ENBA 5ETDA 2DVQA 4CUQA 5ENHA 5HM0A 4QB3A 5HLSA 3MULA 5EWWA 5JI8A 4Q0OA 4NYVA 4NQMA 4TZ2A 4CUTA 4TU4A 4ALGA 4KCXA 4Z93A 4YY6A 3Q2EA 3P5OA 5ETBA 4OGJA 4UYEA 4IR3A 4QSPA 4WHUA 5H1UA 4MR4A 4UYGA 5FE5A 4O7FA 5EWCA 5EM3A 3JVMA 4HBXA 5DYAA 2D82A 2E7OA 2EJNA 4QEUA 5D3JA 5D25A 5H1TA 2YEKA 3DAIA 5L97A 4Z6HA 4A9IA 5CQ7A 2LSPB 4QZSA 4RVRA 3AADA 4O77A 4BHWA 5A5NA 4IOOA 5HENA 5E7DA 4UYFB 2R0YA 4AKGA 4IOQA 5A5QA 3HMFA 4NUEA 5F1LA 4J0SA 4E96A 4A9LA 4X2IA 5C7NA 4YABA 4YH3A 3TLPA 5FE4A 3IU6A 5C8GA 3O37A 5HFRA 5C4QA 5CRZA 2D9EA 4GPJA 5ENGA 4UIVA 3VKGA 5AD3A 4YC9A 4A9HA 5EWHA 5CUDA 5BT5A 5EV9A 4QR3A 5I89A 4A9EA 4YK0A 5G4SA 4YAXA 4A9NA 4UITA 4N4HA 5HJCA 4BJXA 4QEVA 4CFLA 4TU6A 5FFYA 5D3TA 5D0CA 3K2JA 5DFBA 5BT3A 3QZSA 4QBMA 2RNWA 5EISA 3NXBA 4NR9A 4NYWA 1X0JA 4YATA 1JM4B 2G4AA 2RNYA 5E9LA 4MEPA 3AQAA 3LJWA 5EA1A 2OSSA 4N3WA 3P1CA 5D24A 5FB0A 5EQ1A 5F1HA 5DW1A 5FE8A 3UVWA 2F6JA 5E3GA 4YH4A 5DLZA 5FH6A 5I1QA 3D1BA 4UYDA 4QSVA 4TZ8A 4QSXA 4LZRA 5F3AA 4ZW1A 1WUGA 4MENA 4NR6A 4NR4A 4YBMA 5DFDA 3U5KA 5CUGA 5C89A 4N4GA 4TS8A 2DKWA 4MR5A 5A5PA 4J0RA 2RI7A 4PY6A 4QSSA 4QY4A 5CY9A 3MQMA 3P1DA 2DVSA 4C66A 5FH7A 5DLXA 5ACYA 5LUUA 4IR5A 5LVQA 5DX4A 4A9FA 4O74A 5HFQA 5IIDA 1F68A 5E74A 3JVLA 4UIYA 5IGKA 5CQ8A 5AMFA 5FE3A 4UYFA 5HRXA 4TT2A 4PS5A 4IORA 5AMEA 5CQ6A 5CU8A 4YBTA 5EWDA 5CQ3A 2KTBB 4A9OA 5I7XA 5KTXA 3MUKA 2OO1A 5E0RA 4PCEA 2DVRA 2R0VA 2YDWA 5II1A 5JWMA 4XUAA 4ZC9A 1WUMA 4LYWA 5CPEA 4TT6A 4LC2A 5CQ5A 2DWWA 4WIVA 3U5LA 4LR6A 5HEMA 5LKXA 4BW1A 5EWVA 1JSPB 4O71A 3O33A 5EPSA 5ENJA 5CTLA 4YYMA 4QC3A 5ENCA 5CFWA 3Q2FA 4LZ2A 5FDZA 5F2PA 3G0JA 4QYLA 3UVDA 4HXKA 5IGLA 5FE7A 5D7XA 3LXJA 2L5EA 2E3KA 5DKDA 5I29A 4O7CA 4UIUA 5II2A 4UYHA 5EU1A 4NXJA 1ZKRA 3QZTA 4LYSA 5ENIA 4O70A 4YYNA
chains in the Genus database with same CATH topology
4XUBA 4HXOA 4NS5A 3O36A 4AKNA 5D3NA 4CUPA 5K29A 5F25A 5CUEA 4J3IA 3UV5A 3UW9A 5KU3A 5A83A 1ZS5A 5FE6A 4QR4A 2RFJA 5CUAA 5D3RA 1E6IA 4HXRA 5EK9A 4BW3A 2GRCA 4KV4A 4MR3A 4PTBA 5HCLA 3LQHA 2H60A 2YELA 5E3DA 4LRGA 5ENFA 5KO4A 4MEQA 4HXSA 4O72A 4QSQA 4CUSA 2YQDA 5HQ7A 5FBXA 4TTEA 3SVFA 5HQ6A 5KTWA 5F5ZA 3P1EA 5DY7A 5IGMA 5L8TA 4YY4A 1EQFA 3HMHA 4OUFA 4IR4A 5E73A 5HRVA 5FE9A 2WP1A 5CUCA 5F62A 4J1PA 5IBNA 4NR7A 5A5SA 5DYXA 4F3IA 2WP2A 3JVKA 4LDFA 5HELA 4A9MA 4LZSA 5DBMA 4HXNA 5I80A 5E9KA 5FE0A 3G0LA 4QYDA 5EP7A 4Z1SA 2MJVB 5TB6A 4O7EA 5F63A 5EVAA 4O75A 4QC1A 3JVJA 3LQJA 3RCWA 4HXMA 5EPBA 4TYLA 4NRCA 5F61A 4IR6A 5I83A 5LJ1A 5LKZA 5FFVA 5CUBA 5IG6A 5F36A 3HMEA 5CQAA 5AD2A 4QSRA 4TQNA 4UIWA 5J0DA 3UVYA 3U5OA 4C67A 2OUOA 5L98A 3ZYUA 5A81A 2L85A 5CQ4A 4TT4A 2L84A 5E9YA 4YYJA 5A7CA 3MB3A 2E7NA 4UIZA 4KV1A 3S92A 5LKTA 4LYIA 4O7BA 4O7AA 5EGUA 5FFWA 5FG5A 5TCMA 4HBVA 5A85A 4A9KA 4YYHA 4NYXA 3SVGA 4PKLA 5COIA 4OGIA 4N4FA 2N9GA 4Z6IA 3I3JA 2RO1A 5D3HA 5DYUA 5CS8A 5I88A 5KHMA 5DKHA 4QNSA 4CFKA 5FE2A 4NRAA 4XYAA 4UIXA 2YYNA 4CLBA 4CURA 2NXBA 4HBYA 5DFCA 4O76A 5H85A 4ZQLA 2YEMA 3DWYA 2I7KA 3MB4A 5EPRA 5KTUA 5C85A 5D26A 5L99A 5LVRA 4HXPA 4FLPA 4YYGA 2DVVA 3FKMX 4YYIA 5LKUA 5LJ2A 2FSAA 3ONIA 5A5RA 3LQIA 5CP5A 5D3LA 5E9MA 4A9JA 5C87A 3QZVA 4HBWA 2R0SA 5FG4A 5I86A 2YW5A 5FG6A 5EI4A 4QR5A 5CZGA 3MXFA 5L8UA 1N72A 4Q0NA 4MR6A 5FE1A 5DYCA 4QSUA 4QUUA 3UV2A 5CRMA 3IU5A 5H1VA 4NR5A 4NQNA 4QSWA 4BW4A 4QEWA 5E9VA 2DATA 2RNXA 4HXLA 4NRBA 4WHWA 4O78A 5ENEA 5FH8A 5HQ5A 4XY8A 4DONA 4QSTA 5A82A 4QUTA 5DKCA 5CGPA 3UVXA 4YBSA 3D7CA 3U5MA 5D3PA 4YYKA 5A5OA 5LJ0A 4ALHA 3U5PA 3U5NA 4CL9A 4MEOA 4Y03A 4NR8A 5CQTA 5E9IA 4NUCA 4N4IA 2I8NA 3S91A 4CUUA 5L96A 3SVHA 5I40A 3U5JA 3P1FA 5G4RA 3UV4A 4BW2A 5HRWA 2RS9B 4XY9A 5F60A 5I7YA 3O34A 5IGNA 2F6NA 3O35A 5D3SA 4Z1QA 5DW2A 4YADA 3GG3A 4YYDA 5BT4A 4NUDA 2R10A 5EICA 5FB1A 4PCIA 5ENBA 5ETDA 2DVQA 4CUQA 5ENHA 5HM0A 4QB3A 5HLSA 3MULA 5EWWA 5JI8A 4Q0OA 4NYVA 4NQMA 4TZ2A 4CUTA 4TU4A 4ALGA 4KCXA 4Z93A 4YY6A 3Q2EA 3P5OA 5ETBA 4OGJA 4UYEA 4IR3A 4QSPA 4WHUA 5H1UA 4MR4A 4UYGA 5FE5A 4O7FA 5EWCA 5EM3A 3JVMA 4HBXA 5DYAA 2D82A 2E7OA 4QEUA 5D3JA 5D25A 5H1TA 2YEKA 3DAIA 5L97A 4Z6HA 4A9IA 5CQ7A 2LSPB 4QZSA 4RVRA 3AADA 4O77A 4BHWA 5A5NA 4IOOA 5HENA 5E7DA 4UYFB 2R0YA 4IOQA 5A5QA 3HMFA 4NUEA 5F1LA 4J0SA 4E96A 4A9LA 4X2IA 5C7NA 4YABA 4YH3A 3TLPA 5FE4A 3IU6A 5C8GA 3O37A 5HFRA 5C4QA 5CRZA 2D9EA 4GPJA 5ENGA 4UIVA 5AD3A 4YC9A 4A9HA 5EWHA 5CUDA 5BT5A 5EV9A 4QR3A 5I89A 4A9EA 4YK0A 5G4SA 4YAXA 4A9NA 4UITA 4N4HA 5HJCA 4BJXA 4QEVA 4CFLA 4TU6A 5FFYA 5D3TA 5D0CA 3K2JA 5DFBA 5BT3A 3QZSA 4QBMA 2RNWA 5EISA 3NXBA 4NR9A 4NYWA 1X0JA 4YATA 1JM4B 2G4AA 2RNYA 5E9LA 4MEPA 3AQAA 3LJWA 5EA1A 2OSSA 4N3WA 3P1CA 5D24A 5FB0A 5EQ1A 5F1HA 5DW1A 5FE8A 3UVWA 2F6JA 5E3GA 4YH4A 5DLZA 5FH6A 5I1QA 4UYDA 4QSVA 4TZ8A 4QSXA 4LZRA 5F3AA 4ZW1A 1WUGA 4MENA 4NR6A 4NR4A 4YBMA 5DFDA 3U5KA 5CUGA 5C89A 4N4GA 4TS8A 2DKWA 4MR5A 5A5PA 4J0RA 2RI7A 4PY6A 4QSSA 4QY4A 5CY9A 3MQMA 3P1DA 2DVSA 4C66A 5FH7A 5DLXA 5ACYA 5LUUA 4IR5A 5LVQA 5DX4A 4A9FA 4O74A 5HFQA 5IIDA 1F68A 5E74A 3JVLA 4UIYA 5IGKA 5CQ8A 5AMFA 5FE3A 4UYFA 5HRXA 4TT2A 4PS5A 4IORA 5AMEA 5CQ6A 5CU8A 4YBTA 5EWDA 5CQ3A 2KTBB 4A9OA 5I7XA 5KTXA 3MUKA 2OO1A 5E0RA 4PCEA 2DVRA 2R0VA 2YDWA 5II1A 5JWMA 4XUAA 4ZC9A 1WUMA 4LYWA 5CPEA 4TT6A 4LC2A 2DWWA 5CQ5A 4WIVA 3U5LA 4LR6A 5HEMA 5LKXA 4BW1A 5EWVA 1JSPB 4O71A 3O33A 5EPSA 5ENJA 5CTLA 4YYMA 4QC3A 5ENCA 5CFWA 3Q2FA 4LZ2A 5FDZA 5F2PA 3G0JA 4QYLA 3UVDA 4HXKA 5IGLA 5FE7A 5D7XA 3LXJA 2L5EA 2E3KA 5DKDA 5I29A 4O7CA 4UIUA 5II2A 4UYHA 5EU1A 4NXJA 3QZTA 4LYSA 5ENIA 4O70A 4YYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUB A;  4HXO A;  4NS5 A;  3O36 A;  4AKN A;  5D3N A;  4CUP A;  5K29 A;  5F25 A;  5CUE A;  4J3I A;  3UV5 A;  3UW9 A;  5KU3 A;  5A83 A;  1ZS5 A;  5FE6 A;  4QR4 A;  2RFJ A;  5CUA A;  5D3R A;  1E6I A;  4HXR A;  5EK9 A;  4BW3 A;  2GRC A;  4KV4 A;  4MR3 A;  4PTB A;  5HCL A;  3LQH A;  2H60 A;  2YEL A;  5E3D A;  4LRG A;  5ENF A;  5KO4 A;  4MEQ A;  4HXS A;  4O72 A;  4QSQ A;  4CUS A;  2YQD A;  5HQ7 A;  5FBX A;  4TTE A;  3SVF A;  5HQ6 A;  5KTW A;  5F5Z A;  3P1E A;  5DY7 A;  5IGM A;  5L8T A;  4YY4 A;  1EQF A;  3HMH A;  4OUF A;  4IR4 A;  5E73 A;  5HRV A;  5FE9 A;  2WP1 A;  5CUC A;  5F62 A;  4J1P A;  5IBN A;  4NR7 A;  5A5S A;  5DYX A;  4F3I A;  2WP2 A;  3JVK A;  4LDF A;  5HEL A;  4A9M A;  4LZS A;  5DBM A;  4HXN A;  5I80 A;  5E9K A;  5FE0 A;  3G0L A;  4QYD A;  5EP7 A;  4Z1S A;  2MJV B;  5TB6 A;  4O7E A;  5F63 A;  5EVA A;  4O75 A;  4QC1 A;  3JVJ A;  3LQJ A;  3RCW A;  4HXM A;  5EPB A;  4TYL A;  4NRC A;  5F61 A;  4IR6 A;  5I83 A;  5LJ1 A;  5LKZ A;  5FFV A;  5CUB A;  5IG6 A;  5F36 A;  3HME A;  5CQA A;  5AD2 A;  4QSR A;  4TQN A;  4UIW A;  5J0D A;  3UVY A;  3U5O A;  4C67 A;  2OUO A;  5L98 A;  3ZYU A;  5A81 A;  2L85 A;  5CQ4 A;  4TT4 A;  2L84 A;  5E9Y A;  4YYJ A;  5A7C A;  3MB3 A;  2E7N A;  4UIZ A;  4KV1 A;  3S92 A;  5LKT A;  4LYI A;  4O7B A;  4O7A A;  5EGU A;  5FFW A;  5FG5 A;  5TCM A;  4HBV A;  5A85 A;  4A9K A;  4YYH A;  4NYX A;  3SVG A;  4PKL A;  5COI A;  4OGI A;  4N4F A;  2N9G A;  4Z6I A;  3I3J A;  2RO1 A;  5D3H A;  5DYU A;  5CS8 A;  5I88 A;  5KHM A;  5DKH A;  4QNS A;  4CFK A;  5FE2 A;  4NRA A;  4XYA A;  4UIX A;  2YYN A;  4CLB A;  4CUR A;  2NXB A;  4HBY A;  5DFC A;  4O76 A;  5H85 A;  4ZQL A;  2YEM A;  3DWY A;  2I7K A;  3MB4 A;  5EPR A;  5KTU A;  5C85 A;  5D26 A;  5L99 A;  5LVR A;  4HXP A;  4FLP A;  4YYG A;  2DVV A;  3FKM X;  4YYI A;  5LKU A;  5LJ2 A;  2FSA A;  3ONI A;  5A5R A;  3LQI A;  5CP5 A;  5D3L A;  5E9M A;  4A9J A;  5C87 A;  3QZV A;  4HBW A;  2R0S A;  5FG4 A;  5I86 A;  2YW5 A;  5FG6 A;  5EI4 A;  4QR5 A;  5CZG A;  3MXF A;  5L8U A;  1N72 A;  4Q0N A;  4MR6 A;  5FE1 A;  5DYC A;  4QSU A;  4QUU A;  3UV2 A;  5CRM A;  3IU5 A;  5H1V A;  4NR5 A;  4NQN A;  4QSW A;  4BW4 A;  4QEW A;  5E9V A;  2DAT A;  2RNX A;  4HXL A;  4NRB A;  4WHW A;  4O78 A;  5ENE A;  5FH8 A;  5HQ5 A;  4XY8 A;  4DON A;  4QST A;  5A82 A;  4QUT A;  5DKC A;  5CGP A;  3UVX A;  4YBS A;  3D7C A;  3U5M A;  5D3P A;  4YYK A;  5A5O A;  5LJ0 A;  4ALH A;  3U5P A;  3U5N A;  4CL9 A;  4MEO A;  4Y03 A;  4NR8 A;  5CQT A;  5E9I A;  4NUC A;  4N4I A;  2I8N A;  3S91 A;  4CUU A;  5L96 A;  3SVH A;  5I40 A;  3U5J A;  3P1F A;  5G4R A;  3UV4 A;  4BW2 A;  5HRW A;  2RS9 B;  4XY9 A;  5F60 A;  5I7Y A;  3O34 A;  5IGN A;  2F6N A;  3O35 A;  5D3S A;  4Z1Q A;  5DW2 A;  4YAD A;  3GG3 A;  4YYD A;  5BT4 A;  4NUD A;  2R10 A;  5EIC A;  5FB1 A;  4PCI A;  5ENB A;  5ETD A;  2DVQ A;  4CUQ A;  5ENH A;  5HM0 A;  4QB3 A;  5HLS A;  3MUL A;  5EWW A;  5JI8 A;  4Q0O A;  4NYV A;  4NQM A;  4TZ2 A;  4CUT A;  4TU4 A;  4ALG A;  4KCX A;  4Z93 A;  4YY6 A;  3Q2E A;  3P5O A;  5ETB A;  4OGJ A;  4UYE A;  4IR3 A;  4QSP A;  4WHU A;  5H1U A;  4MR4 A;  4UYG A;  5FE5 A;  4O7F A;  5EWC A;  5EM3 A;  3JVM A;  4HBX A;  5DYA A;  2D82 A;  2E7O A;  4QEU A;  5D3J A;  5D25 A;  5H1T A;  2YEK A;  3DAI A;  5L97 A;  4Z6H A;  4A9I A;  5CQ7 A;  2LSP B;  4QZS A;  4RVR A;  3AAD A;  4O77 A;  4BHW A;  5A5N A;  4IOO A;  5HEN A;  5E7D A;  4UYF B;  2R0Y A;  4IOQ A;  5A5Q A;  3HMF A;  4NUE A;  5F1L A;  4J0S A;  4E96 A;  4A9L A;  4X2I A;  5C7N A;  4YAB A;  4YH3 A;  3TLP A;  5FE4 A;  3IU6 A;  5C8G A;  3O37 A;  5HFR A;  5C4Q A;  5CRZ A;  2D9E A;  4GPJ A;  5ENG A;  4UIV A;  5AD3 A;  4YC9 A;  4A9H A;  5EWH A;  5CUD A;  5BT5 A;  5EV9 A;  4QR3 A;  5I89 A;  4A9E A;  4YK0 A;  5G4S A;  4YAX A;  4A9N A;  4UIT A;  4N4H A;  5HJC A;  4BJX A;  4QEV A;  4CFL A;  4TU6 A;  5FFY A;  5D3T A;  5D0C A;  3K2J A;  5DFB A;  5BT3 A;  3QZS A;  4QBM A;  2RNW A;  5EIS A;  3NXB A;  4NR9 A;  4NYW A;  1X0J A;  4YAT A;  1JM4 B;  2G4A A;  2RNY A;  5E9L A;  4MEP A;  3AQA A;  3LJW A;  5EA1 A;  2OSS A;  4N3W A;  3P1C A;  5D24 A;  5FB0 A;  5EQ1 A;  5F1H A;  5DW1 A;  5FE8 A;  3UVW A;  2F6J A;  5E3G A;  4YH4 A;  5DLZ A;  5FH6 A;  5I1Q A;  4UYD A;  4QSV A;  4TZ8 A;  4QSX A;  4LZR A;  5F3A A;  4ZW1 A;  1WUG A;  4MEN A;  4NR6 A;  4NR4 A;  4YBM A;  5DFD A;  3U5K A;  5CUG A;  5C89 A;  4N4G A;  4TS8 A;  2DKW A;  4MR5 A;  5A5P A;  4J0R A;  2RI7 A;  4PY6 A;  4QSS A;  4QY4 A;  5CY9 A;  3MQM A;  3P1D A;  2DVS A;  4C66 A;  5FH7 A;  5DLX A;  5ACY A;  5LUU A;  4IR5 A;  5LVQ A;  5DX4 A;  4A9F A;  4O74 A;  5HFQ A;  5IID A;  1F68 A;  5E74 A;  3JVL A;  4UIY A;  5IGK A;  5CQ8 A;  5AMF A;  5FE3 A;  4UYF A;  5HRX A;  4TT2 A;  4PS5 A;  4IOR A;  5AME A;  5CQ6 A;  5CU8 A;  4YBT A;  5EWD A;  5CQ3 A;  2KTB B;  4A9O A;  5I7X A;  5KTX A;  3MUK A;  2OO1 A;  5E0R A;  4PCE A;  2DVR A;  2R0V A;  2YDW A;  5II1 A;  5JWM A;  4XUA A;  4ZC9 A;  1WUM A;  4LYW A;  5CPE A;  4TT6 A;  4LC2 A;  2DWW A;  5CQ5 A;  4WIV A;  3U5L A;  4LR6 A;  5HEM A;  5LKX A;  4BW1 A;  5EWV A;  1JSP B;  4O71 A;  3O33 A;  5EPS A;  5ENJ A;  5CTL A;  4YYM A;  4QC3 A;  5ENC A;  5CFW A;  3Q2F A;  4LZ2 A;  5FDZ A;  5F2P A;  3G0J A;  4QYL A;  3UVD A;  4HXK A;  5IGL A;  5FE7 A;  5D7X A;  3LXJ A;  2L5E A;  2E3K A;  5DKD A;  5I29 A;  4O7C A;  4UIU A;  5II2 A;  4UYH A;  5EU1 A;  4NXJ A;  3QZT A;  4LYS A;  5ENI A;  4O70 A;  4YYN A; 
#chains in the Genus database with same CATH topology
 4XUB A;  4HXO A;  4NS5 A;  3O36 A;  4AKN A;  5D3N A;  4CUP A;  5K29 A;  5F25 A;  5CUE A;  4J3I A;  3UV5 A;  3UW9 A;  5KU3 A;  5A83 A;  1ZS5 A;  5FE6 A;  4QR4 A;  2RFJ A;  5CUA A;  5D3R A;  1E6I A;  4HXR A;  5EK9 A;  4BW3 A;  2GRC A;  4KV4 A;  4MR3 A;  4PTB A;  5HCL A;  3LQH A;  2H60 A;  2YEL A;  5E3D A;  4AI6 A;  4LRG A;  5ENF A;  5KO4 A;  4MEQ A;  4HXS A;  4O72 A;  4QSQ A;  4CUS A;  2YQD A;  5HQ7 A;  5FBX A;  4TTE A;  3SVF A;  5HQ6 A;  5KTW A;  5F5Z A;  3P1E A;  5DY7 A;  5IGM A;  5L8T A;  4YY4 A;  1EQF A;  3HMH A;  4OUF A;  4IR4 A;  5E73 A;  5HRV A;  5FE9 A;  2WP1 A;  5CUC A;  5F62 A;  4J1P A;  5IBN A;  4NR7 A;  5A5S A;  5DYX A;  4F3I A;  2WP2 A;  3JVK A;  4LDF A;  5HEL A;  4A9M A;  4LZS A;  5DBM A;  4HXN A;  5I80 A;  5E9K A;  5FE0 A;  3G0L A;  4QYD A;  5EP7 A;  4Z1S A;  2MJV B;  5TB6 A;  4O7E A;  5F63 A;  5EVA A;  4O75 A;  4QC1 A;  3JVJ A;  3LQJ A;  3RCW A;  3D1D A;  4HXM A;  5EPB A;  4TYL A;  4NRC A;  5F61 A;  4IR6 A;  5I83 A;  5LJ1 A;  5LKZ A;  5FFV A;  5CUB A;  5IG6 A;  5F36 A;  3HME A;  5CQA A;  5AD2 A;  4QSR A;  4TQN A;  4UIW A;  3ERR A;  5J0D A;  3UVY A;  3U5O A;  4C67 A;  2OUO A;  5L98 A;  3ZYU A;  5A81 A;  3VKH A;  2L85 A;  5CQ4 A;  4TT4 A;  2L84 A;  5E9Y A;  4YYJ A;  5A7C A;  4AKH A;  3MB3 A;  2E7N A;  4UIZ A;  4KV1 A;  3S92 A;  5LKT A;  4LYI A;  4O7B A;  4O7A A;  5EGU A;  5FFW A;  5FG5 A;  5TCM A;  4HBV A;  5A85 A;  4A9K A;  4YYH A;  4NYX A;  3SVG A;  4PKL A;  5COI A;  4OGI A;  4N4F A;  2N9G A;  4Z6I A;  3I3J A;  2RO1 A;  5D3H A;  5DYU A;  5CS8 A;  5I88 A;  5KHM A;  5DKH A;  4QNS A;  4CFK A;  5FE2 A;  4NRA A;  4XYA A;  4UIX A;  2YYN A;  4CLB A;  4CUR A;  2NXB A;  4HBY A;  5DFC A;  4O76 A;  5H85 A;  4ZQL A;  2YEM A;  3DWY A;  2I7K A;  3MB4 A;  5EPR A;  5KTU A;  5C85 A;  5D26 A;  5L99 A;  4AKI A;  5LVR A;  4HXP A;  4FLP A;  4YYG A;  2DVV A;  3FKM X;  4YYI A;  5LKU A;  5LJ2 A;  2FSA A;  3ONI A;  5A5R A;  3LQI A;  1PUO A;  5CP5 A;  5D3L A;  5E9M A;  4A9J A;  5C87 A;  3QZV A;  4HBW A;  2R0S A;  5FG4 A;  5I86 A;  2YW5 A;  5FG6 A;  5EI4 A;  4QR5 A;  5CZG A;  3MXF A;  5L8U A;  1N72 A;  4Q0N A;  4MR6 A;  5FE1 A;  5DYC A;  4QSU A;  4QUU A;  3UV2 A;  5CRM A;  3IU5 A;  5H1V A;  4NR5 A;  4NQN A;  4QSW A;  4BW4 A;  4QEW A;  5E9V A;  2DAT A;  2RNX A;  4HXL A;  4NRB A;  4WHW A;  4O78 A;  5ENE A;  5FH8 A;  5HQ5 A;  4XY8 A;  4DON A;  4QST A;  5A82 A;  4QUT A;  5DKC A;  5CGP A;  3UVX A;  4YBS A;  3D7C A;  3U5M A;  5D3P A;  4YYK A;  5A5O A;  5LJ0 A;  4ALH A;  3U5P A;  3U5N A;  4CL9 A;  4MEO A;  4Y03 A;  4NR8 A;  5CQT A;  5E9I A;  4NUC A;  4N4I A;  2I8N A;  3S91 A;  4CUU A;  5L96 A;  3SVH A;  5I40 A;  3U5J A;  3P1F A;  5G4R A;  3UV4 A;  4BW2 A;  5HRW A;  2RS9 B;  4XY9 A;  5F60 A;  5I7Y A;  3O34 A;  5IGN A;  2F6N A;  3O35 A;  5D3S A;  4Z1Q A;  5DW2 A;  4YAD A;  3GG3 A;  4YYD A;  5BT4 A;  4NUD A;  2R10 A;  5EIC A;  5FB1 A;  4PCI A;  5ENB A;  5ETD A;  2DVQ A;  4CUQ A;  5ENH A;  5HM0 A;  4QB3 A;  5HLS A;  3MUL A;  5EWW A;  5JI8 A;  4Q0O A;  4NYV A;  4NQM A;  4TZ2 A;  4CUT A;  4TU4 A;  4ALG A;  4KCX A;  4Z93 A;  4YY6 A;  3Q2E A;  3P5O A;  5ETB A;  4OGJ A;  4UYE A;  4IR3 A;  4QSP A;  4WHU A;  5H1U A;  4MR4 A;  4UYG A;  5FE5 A;  4O7F A;  5EWC A;  5EM3 A;  3JVM A;  4HBX A;  5DYA A;  2D82 A;  2E7O A;  2EJN A;  4QEU A;  5D3J A;  5D25 A;  5H1T A;  2YEK A;  3DAI A;  5L97 A;  4Z6H A;  4A9I A;  5CQ7 A;  2LSP B;  4QZS A;  4RVR A;  3AAD A;  4O77 A;  4BHW A;  5A5N A;  4IOO A;  5HEN A;  5E7D A;  4UYF B;  2R0Y A;  4AKG A;  4IOQ A;  5A5Q A;  3HMF A;  4NUE A;  5F1L A;  4J0S A;  4E96 A;  4A9L A;  4X2I A;  5C7N A;  4YAB A;  4YH3 A;  3TLP A;  5FE4 A;  3IU6 A;  5C8G A;  3O37 A;  5HFR A;  5C4Q A;  5CRZ A;  2D9E A;  4GPJ A;  5ENG A;  4UIV A;  3VKG A;  5AD3 A;  4YC9 A;  4A9H A;  5EWH A;  5CUD A;  5BT5 A;  5EV9 A;  4QR3 A;  5I89 A;  4A9E A;  4YK0 A;  5G4S A;  4YAX A;  4A9N A;  4UIT A;  4N4H A;  5HJC A;  4BJX A;  4QEV A;  4CFL A;  4TU6 A;  5FFY A;  5D3T A;  5D0C A;  3K2J A;  5DFB A;  5BT3 A;  3QZS A;  4QBM A;  2RNW A;  5EIS A;  3NXB A;  4NR9 A;  4NYW A;  1X0J A;  4YAT A;  1JM4 B;  2G4A A;  2RNY A;  5E9L A;  4MEP A;  3AQA A;  3LJW A;  5EA1 A;  2OSS A;  4N3W A;  3P1C A;  5D24 A;  5FB0 A;  5EQ1 A;  5F1H A;  5DW1 A;  5FE8 A;  3UVW A;  2F6J A;  5E3G A;  4YH4 A;  5DLZ A;  5FH6 A;  5I1Q A;  3D1B A;  4UYD A;  4QSV A;  4TZ8 A;  4QSX A;  4LZR A;  5F3A A;  4ZW1 A;  1WUG A;  4MEN A;  4NR6 A;  4NR4 A;  4YBM A;  5DFD A;  3U5K A;  5CUG A;  5C89 A;  4N4G A;  4TS8 A;  2DKW A;  4MR5 A;  5A5P A;  4J0R A;  2RI7 A;  4PY6 A;  4QSS A;  4QY4 A;  5CY9 A;  3MQM A;  3P1D A;  2DVS A;  4C66 A;  5FH7 A;  5DLX A;  5ACY A;  5LUU A;  4IR5 A;  5LVQ A;  5DX4 A;  4A9F A;  4O74 A;  5HFQ A;  5IID A;  1F68 A;  5E74 A;  3JVL A;  4UIY A;  5IGK A;  5CQ8 A;  5AMF A;  5FE3 A;  4UYF A;  5HRX A;  4TT2 A;  4PS5 A;  4IOR A;  5AME A;  5CQ6 A;  5CU8 A;  4YBT A;  5EWD A;  5CQ3 A;  2KTB B;  4A9O A;  5I7X A;  5KTX A;  3MUK A;  2OO1 A;  5E0R A;  4PCE A;  2DVR A;  2R0V A;  2YDW A;  5II1 A;  5JWM A;  4XUA A;  4ZC9 A;  1WUM A;  4LYW A;  5CPE A;  4TT6 A;  4LC2 A;  5CQ5 A;  2DWW A;  4WIV A;  3U5L A;  4LR6 A;  5HEM A;  5LKX A;  4BW1 A;  5EWV A;  1JSP B;  4O71 A;  3O33 A;  5EPS A;  5ENJ A;  5CTL A;  4YYM A;  4QC3 A;  5ENC A;  5CFW A;  3Q2F A;  4LZ2 A;  5FDZ A;  5F2P A;  3G0J A;  4QYL A;  3UVD A;  4HXK A;  5IGL A;  5FE7 A;  5D7X A;  3LXJ A;  2L5E A;  2E3K A;  5DKD A;  5I29 A;  4O7C A;  4UIU A;  5II2 A;  4UYH A;  5EU1 A;  4NXJ A;  1ZKR A;  3QZT A;  4LYS A;  5ENI A;  4O70 A;  4YYN A; 
#chains in the Genus database with same CATH homology
 4XUB A;  4HXO A;  4NS5 A;  3O36 A;  4AKN A;  5D3N A;  4CUP A;  5K29 A;  5F25 A;  5CUE A;  4J3I A;  3UV5 A;  3UW9 A;  5KU3 A;  5A83 A;  1ZS5 A;  5FE6 A;  4QR4 A;  2RFJ A;  5CUA A;  5D3R A;  1E6I A;  4HXR A;  5EK9 A;  4BW3 A;  2GRC A;  4KV4 A;  4MR3 A;  4PTB A;  5HCL A;  3LQH A;  2H60 A;  2YEL A;  5E3D A;  4LRG A;  5ENF A;  5KO4 A;  4MEQ A;  4HXS A;  4O72 A;  4QSQ A;  4CUS A;  2YQD A;  5HQ7 A;  5FBX A;  4TTE A;  3SVF A;  5HQ6 A;  5KTW A;  5F5Z A;  3P1E A;  5DY7 A;  5IGM A;  5L8T A;  4YY4 A;  1EQF A;  3HMH A;  4OUF A;  4IR4 A;  5E73 A;  5HRV A;  5FE9 A;  2WP1 A;  5CUC A;  5F62 A;  4J1P A;  5IBN A;  4NR7 A;  5A5S A;  5DYX A;  4F3I A;  2WP2 A;  3JVK A;  4LDF A;  5HEL A;  4A9M A;  4LZS A;  5DBM A;  4HXN A;  5I80 A;  5E9K A;  5FE0 A;  3G0L A;  4QYD A;  5EP7 A;  4Z1S A;  2MJV B;  5TB6 A;  4O7E A;  5F63 A;  5EVA A;  4O75 A;  4QC1 A;  3JVJ A;  3LQJ A;  3RCW A;  4HXM A;  5EPB A;  4TYL A;  4NRC A;  5F61 A;  4IR6 A;  5I83 A;  5LJ1 A;  5LKZ A;  5FFV A;  5CUB A;  5IG6 A;  5F36 A;  3HME A;  5CQA A;  5AD2 A;  4QSR A;  4TQN A;  4UIW A;  5J0D A;  3UVY A;  3U5O A;  4C67 A;  2OUO A;  5L98 A;  3ZYU A;  5A81 A;  2L85 A;  5CQ4 A;  4TT4 A;  2L84 A;  5E9Y A;  4YYJ A;  5A7C A;  3MB3 A;  2E7N A;  4UIZ A;  4KV1 A;  3S92 A;  5LKT A;  4LYI A;  4O7B A;  4O7A A;  5EGU A;  5FFW A;  5FG5 A;  5TCM A;  4HBV A;  5A85 A;  4A9K A;  4YYH A;  4NYX A;  3SVG A;  4PKL A;  5COI A;  4OGI A;  4N4F A;  2N9G A;  4Z6I A;  3I3J A;  2RO1 A;  5D3H A;  5DYU A;  5CS8 A;  5I88 A;  5KHM A;  5DKH A;  4QNS A;  4CFK A;  5FE2 A;  4NRA A;  4XYA A;  4UIX A;  2YYN A;  4CLB A;  4CUR A;  2NXB A;  4HBY A;  5DFC A;  4O76 A;  5H85 A;  4ZQL A;  2YEM A;  3DWY A;  2I7K A;  3MB4 A;  5EPR A;  5KTU A;  5C85 A;  5D26 A;  5L99 A;  5LVR A;  4HXP A;  4FLP A;  4YYG A;  2DVV A;  3FKM X;  4YYI A;  5LKU A;  5LJ2 A;  2FSA A;  3ONI A;  5A5R A;  3LQI A;  5CP5 A;  5D3L A;  5E9M A;  4A9J A;  5C87 A;  3QZV A;  4HBW A;  2R0S A;  5FG4 A;  5I86 A;  2YW5 A;  5FG6 A;  5EI4 A;  4QR5 A;  5CZG A;  3MXF A;  5L8U A;  1N72 A;  4Q0N A;  4MR6 A;  5FE1 A;  5DYC A;  4QSU A;  4QUU A;  3UV2 A;  5CRM A;  3IU5 A;  5H1V A;  4NR5 A;  4NQN A;  4QSW A;  4BW4 A;  4QEW A;  5E9V A;  2DAT A;  2RNX A;  4HXL A;  4NRB A;  4WHW A;  4O78 A;  5ENE A;  5FH8 A;  5HQ5 A;  4XY8 A;  4DON A;  4QST A;  5A82 A;  4QUT A;  5DKC A;  5CGP A;  3UVX A;  4YBS A;  3D7C A;  3U5M A;  5D3P A;  4YYK A;  5A5O A;  5LJ0 A;  4ALH A;  3U5P A;  3U5N A;  4CL9 A;  4MEO A;  4Y03 A;  4NR8 A;  5CQT A;  5E9I A;  4NUC A;  4N4I A;  2I8N A;  3S91 A;  4CUU A;  5L96 A;  3SVH A;  5I40 A;  3U5J A;  3P1F A;  5G4R A;  3UV4 A;  4BW2 A;  5HRW A;  2RS9 B;  4XY9 A;  5F60 A;  5I7Y A;  3O34 A;  5IGN A;  2F6N A;  3O35 A;  5D3S A;  4Z1Q A;  5DW2 A;  4YAD A;  3GG3 A;  4YYD A;  5BT4 A;  4NUD A;  2R10 A;  5EIC A;  5FB1 A;  4PCI A;  5ENB A;  5ETD A;  2DVQ A;  4CUQ A;  5ENH A;  5HM0 A;  4QB3 A;  5HLS A;  3MUL A;  5EWW A;  5JI8 A;  4Q0O A;  4NYV A;  4NQM A;  4TZ2 A;  4CUT A;  4TU4 A;  4ALG A;  4KCX A;  4Z93 A;  4YY6 A;  3Q2E A;  3P5O A;  5ETB A;  4OGJ A;  4UYE A;  4IR3 A;  4QSP A;  4WHU A;  5H1U A;  4MR4 A;  4UYG A;  5FE5 A;  4O7F A;  5EWC A;  5EM3 A;  3JVM A;  4HBX A;  5DYA A;  2D82 A;  2E7O A;  4QEU A;  5D3J A;  5D25 A;  5H1T A;  2YEK A;  3DAI A;  5L97 A;  4Z6H A;  4A9I A;  5CQ7 A;  2LSP B;  4QZS A;  4RVR A;  3AAD A;  4O77 A;  4BHW A;  5A5N A;  4IOO A;  5HEN A;  5E7D A;  4UYF B;  2R0Y A;  4IOQ A;  5A5Q A;  3HMF A;  4NUE A;  5F1L A;  4J0S A;  4E96 A;  4A9L A;  4X2I A;  5C7N A;  4YAB A;  4YH3 A;  3TLP A;  5FE4 A;  3IU6 A;  5C8G A;  3O37 A;  5HFR A;  5C4Q A;  5CRZ A;  2D9E A;  4GPJ A;  5ENG A;  4UIV A;  5AD3 A;  4YC9 A;  4A9H A;  5EWH A;  5CUD A;  5BT5 A;  5EV9 A;  4QR3 A;  5I89 A;  4A9E A;  4YK0 A;  5G4S A;  4YAX A;  4A9N A;  4UIT A;  4N4H A;  5HJC A;  4BJX A;  4QEV A;  4CFL A;  4TU6 A;  5FFY A;  5D3T A;  5D0C A;  3K2J A;  5DFB A;  5BT3 A;  3QZS A;  4QBM A;  2RNW A;  5EIS A;  3NXB A;  4NR9 A;  4NYW A;  1X0J A;  4YAT A;  1JM4 B;  2G4A A;  2RNY A;  5E9L A;  4MEP A;  3AQA A;  3LJW A;  5EA1 A;  2OSS A;  4N3W A;  3P1C A;  5D24 A;  5FB0 A;  5EQ1 A;  5F1H A;  5DW1 A;  5FE8 A;  3UVW A;  2F6J A;  5E3G A;  4YH4 A;  5DLZ A;  5FH6 A;  5I1Q A;  4UYD A;  4QSV A;  4TZ8 A;  4QSX A;  4LZR A;  5F3A A;  4ZW1 A;  1WUG A;  4MEN A;  4NR6 A;  4NR4 A;  4YBM A;  5DFD A;  3U5K A;  5CUG A;  5C89 A;  4N4G A;  4TS8 A;  2DKW A;  4MR5 A;  5A5P A;  4J0R A;  2RI7 A;  4PY6 A;  4QSS A;  4QY4 A;  5CY9 A;  3MQM A;  3P1D A;  2DVS A;  4C66 A;  5FH7 A;  5DLX A;  5ACY A;  5LUU A;  4IR5 A;  5LVQ A;  5DX4 A;  4A9F A;  4O74 A;  5HFQ A;  5IID A;  1F68 A;  5E74 A;  3JVL A;  4UIY A;  5IGK A;  5CQ8 A;  5AMF A;  5FE3 A;  4UYF A;  5HRX A;  4TT2 A;  4PS5 A;  4IOR A;  5AME A;  5CQ6 A;  5CU8 A;  4YBT A;  5EWD A;  5CQ3 A;  2KTB B;  4A9O A;  5I7X A;  5KTX A;  3MUK A;  2OO1 A;  5E0R A;  4PCE A;  2DVR A;  2R0V A;  2YDW A;  5II1 A;  5JWM A;  4XUA A;  4ZC9 A;  1WUM A;  4LYW A;  5CPE A;  4TT6 A;  4LC2 A;  2DWW A;  5CQ5 A;  4WIV A;  3U5L A;  4LR6 A;  5HEM A;  5LKX A;  4BW1 A;  5EWV A;  1JSP B;  4O71 A;  3O33 A;  5EPS A;  5ENJ A;  5CTL A;  4YYM A;  4QC3 A;  5ENC A;  5CFW A;  3Q2F A;  4LZ2 A;  5FDZ A;  5F2P A;  3G0J A;  4QYL A;  3UVD A;  4HXK A;  5IGL A;  5FE7 A;  5D7X A;  3LXJ A;  2L5E A;  2E3K A;  5DKD A;  5I29 A;  4O7C A;  4UIU A;  5II2 A;  4UYH A;  5EU1 A;  4NXJ A;  3QZT A;  4LYS A;  5ENI A;  4O70 A;  4YYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...