4UYGA

C-terminal bromodomain of human brd2 with i-bet726 (gsk1324726a)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
b'SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uygA00
4AKNA 5KTWA 4HXRA 5A85A 5HLSA 4OGJA 2I8NA 5L99A 5A82A 3P1FA 5D26A 5FFYA 4A9HA 5F62A 4TQNA 5D3TA 5FH6A 2DATA 4MENA 5DW1A 5E7DA 5FFVA 4NRAA 5A5NA 4J0SA 3LJWA 5L96A 3SVFA 4NR5A 5AMEA 3UVWA 5FH7A 5C8GA 5KTXA 4TT2A 5DYCA 3LQHA 2MJVB 4QSUA 4LRGA 4ALHA 5FE9A 5J0DA 1F68A 5I7YA 5LKZA 2R0VA 4OGIA 5FE8A 5LUUA 4HBYA 3LQIA 5A7CA 5C7NA 2RFJA 5LJ1A 4MR6A 5CY9A 4QR4A 5K29A 3IU5A 5ETDA 5I80A 2OSSA 5DBMA 4YBTA 5FE6A 3P1EA 4Y03A 5DFBA 4NR6A 5D0CA 5AD2A 3MXFA 4A9FA 4UYGA 4YC9A 4FLPA 2LSPB 5HELA 2DVRA 3O33A 3P1CA 5DW2A 4TS8A 5HJCA 5C89A 2H60A 4QSQA 5FB1A 5D3PA 4YYIA 4QZSA 4BW3A 2NXBA 2R0SA 5ENBA 4HXPA 5ENJA 3P5OA 4MR3A 4N4FA 4X2IA 5F36A 4NRCA 5L97A 3D7CA 3U5JA 4O75A 5CPEA 4A9NA 5ENEA 3K2JA 5HEMA 4J0RA 3GG3A 1WUMA 4NYWA 5F1LA 3LQJA 4HBVA 5EWDA 4A9MA 5FG6A 4C66A 4HXMA 4PS5A 4UIYA 3JVMA 5E9MA 5D3SA 4QNSA 5FE4A 5F3AA 4RVRA 4UYHA 4E96A 5E73A 4O7CA 3RCWA 3U5OA 5II1A 5HRXA 4A9OA 4YYDA 5BT4A 4NQMA 5TCMA 4YYMA 5CQTA 3MUKA 4WHUA 5A83A 3MB4A 4XY8A 5EI4A 4KV1A 4YAXA 5IBNA 5DFDA 5C87A 4O7AA 4IR3A 5IGMA 2DWWA 5L8TA 5LVQA 5I88A 4QSPA 4Q0NA 3U5KA 2YEKA 4YYJA 4LYIA 5D24A 3Q2EA 1JSPB 4C67A 4UIXA 3UVXA 4UIZA 5HQ5A 5EISA 5E9LA 5COIA 5EV9A 5FE0A 5LKUA 4XYAA 4CL9A 5TB6A 5FE7A 4O7EA 5FG5A 1N72A 4YYKA 5CZGA 2E3KA 4QEWA 5II2A 4QYLA 5CQAA 4CLBA 4Z6IA 2OUOA 5HENA 4DONA 4MEOA 4QY4A 2R0YA 4QB3A 4NR9A 3HMEA 4PCIA 5E9YA 3O34A 5EWHA 4LYSA 5DKCA 4TTEA 5F5ZA 5HFQA 5D3RA 4TU6A 5DLXA 2RNXA 5DYAA 5FDZA 4KCXA 5E74A 2F6NA 4O77A 5FFWA 5HCLA 3HMHA 3U5PA 5KTUA 5CUDA 4IOOA 4N4GA 4TU4A 3QZVA 5CQ6A 5ETBA 5EP7A 2WP2A 4YH3A 5EGUA 4YADA 5CP5A 2D82A 5CUAA 4A9JA 3MB3A 4YYGA 5D3HA 1X0JA 4TT4A 5I1QA 5C85A 4A9KA 5CUCA 4ZQLA 3FKMX 4YY6A 4NR8A 5HQ7A 4O72A 3LXJA 5ENGA 4NS5A 5FH8A 3HMFA 4LC2A 5HRVA 5HRWA 5KO4A 5DY7A 4IR6A 5F2PA 5D3NA 5LJ0A 4HBXA 4LZSA 2E7NA 5CQ5A 4UIVA 5A5OA 4O78A 2FSAA 3U5LA 4UYFB 4QC1A 5KHMA 4HXKA 3TLPA 4A9EA 5A5QA 5HQ6A 4MR4A 5LJ2A 2RNWA 5H1UA 4O70A 4BW1A 4WIVA 3SVGA 4LYWA 4TT6A 4N4IA 4OUFA 4YBMA 5FE3A 5FG4A 4O74A 4ALGA 3S91A 4YBSA 5F63A 5LVRA 5CU8A 3O36A 5DKDA 5ACYA 4YABA 4CUQA 5FBXA 5E9VA 4QUTA 5CS8A 5E9IA 3QZTA 2RI7A 4NXJA 5D25A 5EICA 3S92A 1WUGA 5CRZA 5EPRA 4HXLA 5I89A 4TYLA 4YYHA 5I40A 3G0JA 4QR5A 4QSXA 4IORA 5E3GA 4NQNA 5DKHA 5EK9A 5I29A 5CGPA 4QSVA 3UV2A 3AQAA 3JVKA 4UIUA 5EPSA 4QYDA 4HBWA 4IOQA 2RO1A 4IR4A 4LZ2A 4ZC9A 4YATA 3UVDA 4NUDA 5CRMA 3MQMA 5AMFA 5IGLA 4CUPA 4QEVA 3JVJA 4BHWA 2RNYA 4NR4A 5ENHA 5CUEA 5EM3A 4QSRA 3I3JA 5G4RA 5CQ8A 2YW5A 3U5MA 4QSSA 4A9LA 4MEPA 4F3IA 2WP1A 4BJXA 5H1TA 3O37A 5ENCA 5G4SA 5H85A 5IGNA 5AD3A 5FE1A 4MEQA 3JVLA 5BT5A 5DYXA 4WHWA 5A5RA 2DKWA 5FB0A 5LKXA 2L85A 2L84A 5EPBA 4TZ2A 2KTBB 4UYFA 2E7OA 2YEMA 2DVSA 4XUAA 3DWYA 2I7KA 3P1DA 1E6IA 3QZSA 2YYNA 5EVAA 2YDWA 4YK0A 4CUUA 5BT3A 3UW9A 4QUUA 4QSTA 4QEUA 4UITA 4QBMA 4YYNA 2OO1A 2D9EA 4Z6HA 4GPJA 3ONIA 4LDFA 4Z1SA 4QC3A 4UYDA 4PY6A 5H1VA 5L8UA 5ENIA 5A81A 3NXBA 5HFRA 4NRBA 4NR7A 5F61A 5CTLA 4BW4A 3AADA 4XY9A 5FE5A 4HXSA 5ENFA 2R10A 5F1HA 3SVHA 5DLZA 4LZRA 5DYUA 5IG6A 4YY4A 2N9GA 5E0RA 4O71A 4ZW1A 4IR5A 4CURA 1EQFA 2GRCA 5CQ7A 5CQ3A 5A5PA 5E9KA 5IGKA 5JWMA 5F60A 2F6JA 5CUGA 4O7FA 2DVQA 3O35A 2YQDA 4CFKA 4PKLA 4O7BA 4UYEA 5JI8A 4O76A 1ZS5A 5I86A 5EWCA 4A9IA 3ZYUA 5DX4A 2YELA 5D3LA 5CFWA 5EQ1A 2DVVA 4KV4A 3DAIA 4CUTA 5I7XA 5E3DA 5IIDA 5C4QA 4LR6A 5DFCA 2L5EA 4NUEA 3UV5A 4TZ8A 5A5SA 5F25A 5KU3A 5D7XA 2G4AA 3IU6A 5LKTA 4J1PA 4Q0OA 5FE2A 4PTBA 3UV4A 5EU1A 4HXOA 4BW2A 5HM0A 4NYXA 4XUBA 4MR5A 5CQ4A 5EWVA 4CUSA 4QR3A 5CUBA 4Z1QA 4N4HA 5D3JA 5I83A 3MULA 1JM4B 4N3WA 4NYVA 4UIWA 5EA1A 3UVYA 4QSWA 4J3IA 3Q2FA 3U5NA 4YH4A 4CFLA 2RS9B 4Z93A 3G0LA 5L98A 4NUCA 5EWWA 4HXNA 4PCEA
chains in the Genus database with same CATH superfamily
4AKNA 5KTWA 4HXRA 5A85A 5HLSA 4OGJA 2I8NA 5L99A 5A82A 3P1FA 5D26A 5FFYA 4A9HA 5F62A 4TQNA 5D3TA 5FH6A 2DATA 4MENA 5DW1A 5E7DA 5FFVA 4NRAA 5A5NA 4J0SA 3LJWA 5L96A 3SVFA 4NR5A 5AMEA 3UVWA 5FH7A 5C8GA 5KTXA 4TT2A 5DYCA 3LQHA 2MJVB 4QSUA 4LRGA 4ALHA 5FE9A 5J0DA 1F68A 5I7YA 5LKZA 2R0VA 4OGIA 5FE8A 5LUUA 4HBYA 3LQIA 5A7CA 5C7NA 2RFJA 5LJ1A 4AKIA 4MR6A 5CY9A 4QR4A 5K29A 3IU5A 5ETDA 5I80A 2OSSA 5DBMA 4YBTA 5FE6A 3P1EA 4Y03A 5DFBA 4NR6A 5D0CA 5AD2A 3MXFA 4A9FA 4UYGA 4YC9A 4FLPA 2LSPB 5HELA 2DVRA 3O33A 3P1CA 5DW2A 4TS8A 5HJCA 5C89A 2H60A 4QSQA 5FB1A 5D3PA 4YYIA 4QZSA 4BW3A 2NXBA 2R0SA 5ENBA 4HXPA 5ENJA 3P5OA 4MR3A 4N4FA 4X2IA 5F36A 1ZKRA 4NRCA 5L97A 3D7CA 3U5JA 4O75A 5CPEA 4A9NA 5ENEA 3K2JA 5HEMA 4J0RA 3GG3A 1WUMA 4NYWA 5F1LA 3LQJA 4HBVA 5EWDA 4A9MA 5FG6A 4C66A 4HXMA 4PS5A 4UIYA 3JVMA 5E9MA 5D3SA 4QNSA 5FE4A 5F3AA 4RVRA 4UYHA 4E96A 5E73A 4O7CA 3RCWA 3U5OA 5II1A 5HRXA 4A9OA 4YYDA 5BT4A 4NQMA 2EJNA 5TCMA 4YYMA 5CQTA 4AKHA 3MUKA 4WHUA 5A83A 3MB4A 4XY8A 5EI4A 4KV1A 4YAXA 5IBNA 5DFDA 5C87A 4O7AA 4IR3A 5IGMA 2DWWA 5L8TA 5LVQA 5I88A 4QSPA 3D1DA 4Q0NA 3U5KA 2YEKA 4YYJA 4LYIA 3D1BA 3Q2EA 5D24A 1JSPB 4C67A 4UIXA 3UVXA 4UIZA 5HQ5A 5EISA 5E9LA 5COIA 5EV9A 5FE0A 5LKUA 4XYAA 4CL9A 5TB6A 5FE7A 4O7EA 5FG5A 1N72A 4YYKA 5CZGA 2E3KA 4QEWA 5II2A 4QYLA 5CQAA 4CLBA 4Z6IA 2OUOA 5HENA 4DONA 4MEOA 4QY4A 2R0YA 4QB3A 4NR9A 3HMEA 4PCIA 5E9YA 3O34A 5EWHA 4LYSA 5DKCA 4TTEA 5F5ZA 5HFQA 5D3RA 4TU6A 5DLXA 2RNXA 5DYAA 5FDZA 4KCXA 5E74A 2F6NA 4O77A 5FFWA 5HCLA 3HMHA 3U5PA 5KTUA 5CUDA 3ERRA 4IOOA 4N4GA 4TU4A 3QZVA 5CQ6A 5ETBA 5EP7A 2WP2A 4YH3A 5EGUA 4YADA 5CP5A 2D82A 5CUAA 4A9JA 3MB3A 4YYGA 5D3HA 1X0JA 4TT4A 5I1QA 5C85A 4A9KA 5CUCA 4ZQLA 3FKMX 4YY6A 4NR8A 5HQ7A 4O72A 3LXJA 5ENGA 4NS5A 5FH8A 3HMFA 4LC2A 5HRVA 5HRWA 5KO4A 5DY7A 4IR6A 5F2PA 5D3NA 5LJ0A 4HBXA 4LZSA 2E7NA 5CQ5A 4UIVA 5A5OA 4O78A 2FSAA 3U5LA 4UYFB 4QC1A 5KHMA 4HXKA 3TLPA 4A9EA 5A5QA 5HQ6A 4MR4A 5LJ2A 4AI6A 2RNWA 5H1UA 4O70A 4BW1A 4WIVA 3SVGA 4LYWA 4TT6A 4N4IA 4OUFA 4YBMA 5FE3A 5FG4A 4O74A 4ALGA 3S91A 4YBSA 5F63A 5LVRA 5CU8A 3O36A 5DKDA 5ACYA 3VKHA 4YABA 4CUQA 5FBXA 5E9VA 4QUTA 5CS8A 5E9IA 3QZTA 2RI7A 4NXJA 5D25A 5EICA 3S92A 1WUGA 5CRZA 5EPRA 4HXLA 5I89A 4TYLA 4YYHA 5I40A 3G0JA 4QR5A 4QSXA 4IORA 5E3GA 4NQNA 5DKHA 5EK9A 5I29A 5CGPA 4QSVA 3UV2A 3AQAA 3JVKA 4UIUA 5EPSA 4QYDA 4HBWA 4IOQA 2RO1A 4IR4A 4LZ2A 4ZC9A 4YATA 3UVDA 4NUDA 5CRMA 3MQMA 5AMFA 5IGLA 4CUPA 4QEVA 3JVJA 4BHWA 2RNYA 4NR4A 5ENHA 5CUEA 5EM3A 3VKGA 4QSRA 3I3JA 5G4RA 5CQ8A 2YW5A 3U5MA 4QSSA 4A9LA 4MEPA 4F3IA 2WP1A 4BJXA 5H1TA 3O37A 5ENCA 5G4SA 5H85A 5IGNA 5AD3A 5FE1A 4MEQA 3JVLA 5BT5A 5DYXA 4WHWA 5A5RA 2DKWA 5FB0A 5LKXA 2L85A 2L84A 5EPBA 4TZ2A 2KTBB 4UYFA 2E7OA 2YEMA 2DVSA 4XUAA 3DWYA 2I7KA 3P1DA 1E6IA 3QZSA 2YYNA 5EVAA 2YDWA 4YK0A 4CUUA 5BT3A 3UW9A 4QUUA 4QSTA 4QEUA 4UITA 4QBMA 4YYNA 2OO1A 2D9EA 4Z6HA 4GPJA 3ONIA 4LDFA 4Z1SA 4QC3A 4UYDA 4PY6A 5H1VA 5L8UA 5ENIA 5A81A 3NXBA 5HFRA 4NRBA 4NR7A 5F61A 5CTLA 4BW4A 3AADA 4XY9A 5FE5A 4HXSA 5ENFA 2R10A 5F1HA 3SVHA 5DLZA 4LZRA 5DYUA 5IG6A 4YY4A 2N9GA 5E0RA 4O71A 4ZW1A 4IR5A 4CURA 1EQFA 2GRCA 5CQ7A 5CQ3A 5A5PA 5E9KA 5IGKA 5JWMA 5F60A 2F6JA 5CUGA 4O7FA 2DVQA 3O35A 2YQDA 4CFKA 4PKLA 4O7BA 4UYEA 5JI8A 4O76A 1ZS5A 5I86A 5EWCA 4A9IA 3ZYUA 5DX4A 2YELA 5D3LA 5CFWA 5EQ1A 2DVVA 4KV4A 3DAIA 4CUTA 5I7XA 5E3DA 5IIDA 5C4QA 4LR6A 5DFCA 2L5EA 4NUEA 3UV5A 4TZ8A 5A5SA 5F25A 5KU3A 5D7XA 2G4AA 3IU6A 5LKTA 4J1PA 4Q0OA 5FE2A 4PTBA 4AKGA 3UV4A 5EU1A 4HXOA 4BW2A 5HM0A 4NYXA 4XUBA 4MR5A 5CQ4A 5EWVA 4CUSA 4QR3A 5CUBA 4Z1QA 4N4HA 5D3JA 5I83A 3MULA 1JM4B 4N3WA 4NYVA 4UIWA 5EA1A 3UVYA 4QSWA 4J3IA 3Q2FA 3U5NA 4YH4A 4CFLA 2RS9B 4Z93A 3G0LA 1PUOA 5L98A 4NUCA 5EWWA 4HXNA 4PCEA
chains in the Genus database with same CATH topology
4AKNA 5KTWA 4HXRA 5A85A 5HLSA 4OGJA 2I8NA 5L99A 5A82A 3P1FA 5D26A 5FFYA 4A9HA 5F62A 4TQNA 5D3TA 5FH6A 2DATA 4MENA 5DW1A 5E7DA 5FFVA 4NRAA 5A5NA 4J0SA 3LJWA 5L96A 3SVFA 4NR5A 5AMEA 3UVWA 5FH7A 5C8GA 5KTXA 4TT2A 5DYCA 3LQHA 2MJVB 4QSUA 4LRGA 4ALHA 5FE9A 5J0DA 1F68A 5I7YA 5LKZA 2R0VA 4OGIA 5FE8A 5LUUA 4HBYA 3LQIA 5A7CA 5C7NA 2RFJA 5LJ1A 4MR6A 5CY9A 4QR4A 5K29A 3IU5A 5ETDA 5I80A 2OSSA 5DBMA 4YBTA 5FE6A 3P1EA 4Y03A 5DFBA 4NR6A 5D0CA 5AD2A 3MXFA 4A9FA 4UYGA 4YC9A 4FLPA 2LSPB 5HELA 2DVRA 3O33A 3P1CA 5DW2A 4TS8A 5HJCA 5C89A 2H60A 4QSQA 5FB1A 5D3PA 4YYIA 4QZSA 4BW3A 2NXBA 2R0SA 5ENBA 4HXPA 5ENJA 3P5OA 4MR3A 4N4FA 4X2IA 5F36A 4NRCA 5L97A 3D7CA 3U5JA 4O75A 5CPEA 4A9NA 5ENEA 3K2JA 5HEMA 4J0RA 3GG3A 1WUMA 4NYWA 5F1LA 3LQJA 4HBVA 5EWDA 4A9MA 5FG6A 4C66A 4HXMA 4PS5A 4UIYA 3JVMA 5E9MA 5D3SA 4QNSA 5FE4A 5F3AA 4RVRA 4UYHA 4E96A 5E73A 4O7CA 3RCWA 3U5OA 5II1A 5HRXA 4A9OA 4YYDA 5BT4A 4NQMA 5TCMA 4YYMA 5CQTA 3MUKA 4WHUA 5A83A 3MB4A 4XY8A 5EI4A 4KV1A 4YAXA 5IBNA 5DFDA 5C87A 4O7AA 4IR3A 5IGMA 2DWWA 5L8TA 5LVQA 5I88A 4QSPA 4Q0NA 3U5KA 2YEKA 4YYJA 4LYIA 5D24A 3Q2EA 1JSPB 4C67A 4UIXA 3UVXA 4UIZA 5HQ5A 5EISA 5E9LA 5COIA 5EV9A 5FE0A 5LKUA 4XYAA 4CL9A 5TB6A 5FE7A 4O7EA 5FG5A 1N72A 4YYKA 5CZGA 2E3KA 4QEWA 5II2A 4QYLA 5CQAA 4CLBA 4Z6IA 2OUOA 5HENA 4DONA 4MEOA 4QY4A 2R0YA 4QB3A 4NR9A 3HMEA 4PCIA 5E9YA 3O34A 5EWHA 4LYSA 5DKCA 4TTEA 5F5ZA 5HFQA 5D3RA 4TU6A 5DLXA 2RNXA 5DYAA 5FDZA 4KCXA 5E74A 2F6NA 4O77A 5FFWA 5HCLA 3HMHA 3U5PA 5KTUA 5CUDA 4IOOA 4N4GA 4TU4A 3QZVA 5CQ6A 5ETBA 5EP7A 2WP2A 4YH3A 5EGUA 4YADA 5CP5A 2D82A 5CUAA 4A9JA 3MB3A 4YYGA 5D3HA 1X0JA 4TT4A 5I1QA 5C85A 4A9KA 5CUCA 4ZQLA 3FKMX 4YY6A 4NR8A 5HQ7A 4O72A 3LXJA 5ENGA 4NS5A 5FH8A 3HMFA 4LC2A 5HRVA 5HRWA 5KO4A 5DY7A 4IR6A 5F2PA 5D3NA 5LJ0A 4HBXA 4LZSA 2E7NA 5CQ5A 4UIVA 5A5OA 4O78A 2FSAA 3U5LA 4UYFB 4QC1A 5KHMA 4HXKA 3TLPA 4A9EA 5A5QA 5HQ6A 4MR4A 5LJ2A 2RNWA 5H1UA 4O70A 4BW1A 4WIVA 3SVGA 4LYWA 4TT6A 4N4IA 4OUFA 4YBMA 5FE3A 5FG4A 4O74A 4ALGA 3S91A 4YBSA 5F63A 5LVRA 5CU8A 3O36A 5DKDA 5ACYA 4YABA 4CUQA 5FBXA 5E9VA 4QUTA 5CS8A 5E9IA 3QZTA 2RI7A 4NXJA 5D25A 5EICA 3S92A 1WUGA 5CRZA 5EPRA 4HXLA 5I89A 4TYLA 4YYHA 5I40A 3G0JA 4QR5A 4QSXA 4IORA 5E3GA 4NQNA 5DKHA 5EK9A 5I29A 5CGPA 4QSVA 3UV2A 3AQAA 3JVKA 4UIUA 5EPSA 4QYDA 4HBWA 4IOQA 2RO1A 4IR4A 4LZ2A 4ZC9A 4YATA 3UVDA 4NUDA 5CRMA 3MQMA 5AMFA 5IGLA 4CUPA 4QEVA 3JVJA 4BHWA 2RNYA 4NR4A 5ENHA 5CUEA 5EM3A 4QSRA 3I3JA 5G4RA 5CQ8A 2YW5A 3U5MA 4QSSA 4A9LA 4MEPA 4F3IA 2WP1A 4BJXA 5H1TA 3O37A 5ENCA 5G4SA 5H85A 5IGNA 5AD3A 5FE1A 4MEQA 3JVLA 5BT5A 5DYXA 4WHWA 5A5RA 2DKWA 5FB0A 5LKXA 2L85A 2L84A 5EPBA 4TZ2A 2KTBB 4UYFA 2E7OA 2YEMA 2DVSA 4XUAA 3DWYA 2I7KA 3P1DA 1E6IA 3QZSA 2YYNA 5EVAA 2YDWA 4YK0A 4CUUA 5BT3A 3UW9A 4QUUA 4QSTA 4QEUA 4UITA 4QBMA 4YYNA 2OO1A 2D9EA 4Z6HA 4GPJA 3ONIA 4LDFA 4Z1SA 4QC3A 4UYDA 4PY6A 5H1VA 5L8UA 5ENIA 5A81A 3NXBA 5HFRA 4NRBA 4NR7A 5F61A 5CTLA 4BW4A 3AADA 4XY9A 5FE5A 4HXSA 5ENFA 2R10A 5F1HA 3SVHA 5DLZA 4LZRA 5DYUA 5IG6A 4YY4A 2N9GA 5E0RA 4O71A 4ZW1A 4IR5A 4CURA 1EQFA 2GRCA 5CQ7A 5CQ3A 5A5PA 5E9KA 5IGKA 5JWMA 5F60A 2F6JA 5CUGA 4O7FA 2DVQA 3O35A 2YQDA 4CFKA 4PKLA 4O7BA 4UYEA 5JI8A 4O76A 1ZS5A 5I86A 5EWCA 4A9IA 3ZYUA 5DX4A 2YELA 5D3LA 5CFWA 5EQ1A 2DVVA 4KV4A 3DAIA 4CUTA 5I7XA 5E3DA 5IIDA 5C4QA 4LR6A 5DFCA 2L5EA 4NUEA 3UV5A 4TZ8A 5A5SA 5F25A 5KU3A 5D7XA 2G4AA 3IU6A 5LKTA 4J1PA 4Q0OA 5FE2A 4PTBA 3UV4A 5EU1A 4HXOA 4BW2A 5HM0A 4NYXA 4XUBA 4MR5A 5CQ4A 5EWVA 4CUSA 4QR3A 5CUBA 4Z1QA 4N4HA 5D3JA 5I83A 3MULA 1JM4B 4N3WA 4NYVA 4UIWA 5EA1A 3UVYA 4QSWA 4J3IA 3Q2FA 3U5NA 4YH4A 4CFLA 2RS9B 4Z93A 3G0LA 5L98A 4NUCA 5EWWA 4HXNA 4PCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKN A;  5KTW A;  4HXR A;  5A85 A;  5HLS A;  4OGJ A;  2I8N A;  5L99 A;  5A82 A;  3P1F A;  5D26 A;  5FFY A;  4A9H A;  5F62 A;  4TQN A;  5D3T A;  5FH6 A;  2DAT A;  4MEN A;  5DW1 A;  5E7D A;  5FFV A;  4NRA A;  5A5N A;  4J0S A;  3LJW A;  5L96 A;  3SVF A;  4NR5 A;  5AME A;  3UVW A;  5FH7 A;  5C8G A;  5KTX A;  4TT2 A;  5DYC A;  3LQH A;  2MJV B;  4QSU A;  4LRG A;  4ALH A;  5FE9 A;  5J0D A;  1F68 A;  5I7Y A;  5LKZ A;  2R0V A;  4OGI A;  5FE8 A;  5LUU A;  4HBY A;  3LQI A;  5A7C A;  5C7N A;  2RFJ A;  5LJ1 A;  4MR6 A;  5CY9 A;  4QR4 A;  5K29 A;  3IU5 A;  5ETD A;  5I80 A;  2OSS A;  5DBM A;  4YBT A;  5FE6 A;  3P1E A;  4Y03 A;  5DFB A;  4NR6 A;  5D0C A;  5AD2 A;  3MXF A;  4A9F A;  4UYG A;  4YC9 A;  4FLP A;  2LSP B;  5HEL A;  2DVR A;  3O33 A;  3P1C A;  5DW2 A;  4TS8 A;  5HJC A;  5C89 A;  2H60 A;  4QSQ A;  5FB1 A;  5D3P A;  4YYI A;  4QZS A;  4BW3 A;  2NXB A;  2R0S A;  5ENB A;  4HXP A;  5ENJ A;  3P5O A;  4MR3 A;  4N4F A;  4X2I A;  5F36 A;  4NRC A;  5L97 A;  3D7C A;  3U5J A;  4O75 A;  5CPE A;  4A9N A;  5ENE A;  3K2J A;  5HEM A;  4J0R A;  3GG3 A;  1WUM A;  4NYW A;  5F1L A;  3LQJ A;  4HBV A;  5EWD A;  4A9M A;  5FG6 A;  4C66 A;  4HXM A;  4PS5 A;  4UIY A;  3JVM A;  5E9M A;  5D3S A;  4QNS A;  5FE4 A;  5F3A A;  4RVR A;  4UYH A;  4E96 A;  5E73 A;  4O7C A;  3RCW A;  3U5O A;  5II1 A;  5HRX A;  4A9O A;  4YYD A;  5BT4 A;  4NQM A;  5TCM A;  4YYM A;  5CQT A;  3MUK A;  4WHU A;  5A83 A;  3MB4 A;  4XY8 A;  5EI4 A;  4KV1 A;  4YAX A;  5IBN A;  5DFD A;  5C87 A;  4O7A A;  4IR3 A;  5IGM A;  2DWW A;  5L8T A;  5LVQ A;  5I88 A;  4QSP A;  4Q0N A;  3U5K A;  2YEK A;  4YYJ A;  4LYI A;  5D24 A;  3Q2E A;  1JSP B;  4C67 A;  4UIX A;  3UVX A;  4UIZ A;  5HQ5 A;  5EIS A;  5E9L A;  5COI A;  5EV9 A;  5FE0 A;  5LKU A;  4XYA A;  4CL9 A;  5TB6 A;  5FE7 A;  4O7E A;  5FG5 A;  1N72 A;  4YYK A;  5CZG A;  2E3K A;  4QEW A;  5II2 A;  4QYL A;  5CQA A;  4CLB A;  4Z6I A;  2OUO A;  5HEN A;  4DON A;  4MEO A;  4QY4 A;  2R0Y A;  4QB3 A;  4NR9 A;  3HME A;  4PCI A;  5E9Y A;  3O34 A;  5EWH A;  4LYS A;  5DKC A;  4TTE A;  5F5Z A;  5HFQ A;  5D3R A;  4TU6 A;  5DLX A;  2RNX A;  5DYA A;  5FDZ A;  4KCX A;  5E74 A;  2F6N A;  4O77 A;  5FFW A;  5HCL A;  3HMH A;  3U5P A;  5KTU A;  5CUD A;  4IOO A;  4N4G A;  4TU4 A;  3QZV A;  5CQ6 A;  5ETB A;  5EP7 A;  2WP2 A;  4YH3 A;  5EGU A;  4YAD A;  5CP5 A;  2D82 A;  5CUA A;  4A9J A;  3MB3 A;  4YYG A;  5D3H A;  1X0J A;  4TT4 A;  5I1Q A;  5C85 A;  4A9K A;  5CUC A;  4ZQL A;  3FKM X;  4YY6 A;  4NR8 A;  5HQ7 A;  4O72 A;  3LXJ A;  5ENG A;  4NS5 A;  5FH8 A;  3HMF A;  4LC2 A;  5HRV A;  5HRW A;  5KO4 A;  5DY7 A;  4IR6 A;  5F2P A;  5D3N A;  5LJ0 A;  4HBX A;  4LZS A;  2E7N A;  5CQ5 A;  4UIV A;  5A5O A;  4O78 A;  2FSA A;  3U5L A;  4UYF B;  4QC1 A;  5KHM A;  4HXK A;  3TLP A;  4A9E A;  5A5Q A;  5HQ6 A;  4MR4 A;  5LJ2 A;  2RNW A;  5H1U A;  4O70 A;  4BW1 A;  4WIV A;  3SVG A;  4LYW A;  4TT6 A;  4N4I A;  4OUF A;  4YBM A;  5FE3 A;  5FG4 A;  4O74 A;  4ALG A;  3S91 A;  4YBS A;  5F63 A;  5LVR A;  5CU8 A;  3O36 A;  5DKD A;  5ACY A;  4YAB A;  4CUQ A;  5FBX A;  5E9V A;  4QUT A;  5CS8 A;  5E9I A;  3QZT A;  2RI7 A;  4NXJ A;  5D25 A;  5EIC A;  3S92 A;  1WUG A;  5CRZ A;  5EPR A;  4HXL A;  5I89 A;  4TYL A;  4YYH A;  5I40 A;  3G0J A;  4QR5 A;  4QSX A;  4IOR A;  5E3G A;  4NQN A;  5DKH A;  5EK9 A;  5I29 A;  5CGP A;  4QSV A;  3UV2 A;  3AQA A;  3JVK A;  4UIU A;  5EPS A;  4QYD A;  4HBW A;  4IOQ A;  2RO1 A;  4IR4 A;  4LZ2 A;  4ZC9 A;  4YAT A;  3UVD A;  4NUD A;  5CRM A;  3MQM A;  5AMF A;  5IGL A;  4CUP A;  4QEV A;  3JVJ A;  4BHW A;  2RNY A;  4NR4 A;  5ENH A;  5CUE A;  5EM3 A;  4QSR A;  3I3J A;  5G4R A;  5CQ8 A;  2YW5 A;  3U5M A;  4QSS A;  4A9L A;  4MEP A;  4F3I A;  2WP1 A;  4BJX A;  5H1T A;  3O37 A;  5ENC A;  5G4S A;  5H85 A;  5IGN A;  5AD3 A;  5FE1 A;  4MEQ A;  3JVL A;  5BT5 A;  5DYX A;  4WHW A;  5A5R A;  2DKW A;  5FB0 A;  5LKX A;  2L85 A;  2L84 A;  5EPB A;  4TZ2 A;  2KTB B;  4UYF A;  2E7O A;  2YEM A;  2DVS A;  4XUA A;  3DWY A;  2I7K A;  3P1D A;  1E6I A;  3QZS A;  2YYN A;  5EVA A;  2YDW A;  4YK0 A;  4CUU A;  5BT3 A;  3UW9 A;  4QUU A;  4QST A;  4QEU A;  4UIT A;  4QBM A;  4YYN A;  2OO1 A;  2D9E A;  4Z6H A;  4GPJ A;  3ONI A;  4LDF A;  4Z1S A;  4QC3 A;  4UYD A;  4PY6 A;  5H1V A;  5L8U A;  5ENI A;  5A81 A;  3NXB A;  5HFR A;  4NRB A;  4NR7 A;  5F61 A;  5CTL A;  4BW4 A;  3AAD A;  4XY9 A;  5FE5 A;  4HXS A;  5ENF A;  2R10 A;  5F1H A;  3SVH A;  5DLZ A;  4LZR A;  5DYU A;  5IG6 A;  4YY4 A;  2N9G A;  5E0R A;  4O71 A;  4ZW1 A;  4IR5 A;  4CUR A;  1EQF A;  2GRC A;  5CQ7 A;  5CQ3 A;  5A5P A;  5E9K A;  5IGK A;  5JWM A;  5F60 A;  2F6J A;  5CUG A;  4O7F A;  2DVQ A;  3O35 A;  2YQD A;  4CFK A;  4PKL A;  4O7B A;  4UYE A;  5JI8 A;  4O76 A;  1ZS5 A;  5I86 A;  5EWC A;  4A9I A;  3ZYU A;  5DX4 A;  2YEL A;  5D3L A;  5CFW A;  5EQ1 A;  2DVV A;  4KV4 A;  3DAI A;  4CUT A;  5I7X A;  5E3D A;  5IID A;  5C4Q A;  4LR6 A;  5DFC A;  2L5E A;  4NUE A;  3UV5 A;  4TZ8 A;  5A5S A;  5F25 A;  5KU3 A;  5D7X A;  2G4A A;  3IU6 A;  5LKT A;  4J1P A;  4Q0O A;  5FE2 A;  4PTB A;  3UV4 A;  5EU1 A;  4HXO A;  4BW2 A;  5HM0 A;  4NYX A;  4XUB A;  4MR5 A;  5CQ4 A;  5EWV A;  4CUS A;  4QR3 A;  5CUB A;  4Z1Q A;  4N4H A;  5D3J A;  5I83 A;  3MUL A;  1JM4 B;  4N3W A;  4NYV A;  4UIW A;  5EA1 A;  3UVY A;  4QSW A;  4J3I A;  3Q2F A;  3U5N A;  4YH4 A;  4CFL A;  2RS9 B;  4Z93 A;  3G0L A;  5L98 A;  4NUC A;  5EWW A;  4HXN A;  4PCE A; 
#chains in the Genus database with same CATH topology
 4AKN A;  5KTW A;  4HXR A;  5A85 A;  5HLS A;  4OGJ A;  2I8N A;  5L99 A;  5A82 A;  3P1F A;  5D26 A;  5FFY A;  4A9H A;  5F62 A;  4TQN A;  5D3T A;  5FH6 A;  2DAT A;  4MEN A;  5DW1 A;  5E7D A;  5FFV A;  4NRA A;  5A5N A;  4J0S A;  3LJW A;  5L96 A;  3SVF A;  4NR5 A;  5AME A;  3UVW A;  5FH7 A;  5C8G A;  5KTX A;  4TT2 A;  5DYC A;  3LQH A;  2MJV B;  4QSU A;  4LRG A;  4ALH A;  5FE9 A;  5J0D A;  1F68 A;  5I7Y A;  5LKZ A;  2R0V A;  4OGI A;  5FE8 A;  5LUU A;  4HBY A;  3LQI A;  5A7C A;  5C7N A;  2RFJ A;  5LJ1 A;  4AKI A;  4MR6 A;  5CY9 A;  4QR4 A;  5K29 A;  3IU5 A;  5ETD A;  5I80 A;  2OSS A;  5DBM A;  4YBT A;  5FE6 A;  3P1E A;  4Y03 A;  5DFB A;  4NR6 A;  5D0C A;  5AD2 A;  3MXF A;  4A9F A;  4UYG A;  4YC9 A;  4FLP A;  2LSP B;  5HEL A;  2DVR A;  3O33 A;  3P1C A;  5DW2 A;  4TS8 A;  5HJC A;  5C89 A;  2H60 A;  4QSQ A;  5FB1 A;  5D3P A;  4YYI A;  4QZS A;  4BW3 A;  2NXB A;  2R0S A;  5ENB A;  4HXP A;  5ENJ A;  3P5O A;  4MR3 A;  4N4F A;  4X2I A;  5F36 A;  1ZKR A;  4NRC A;  5L97 A;  3D7C A;  3U5J A;  4O75 A;  5CPE A;  4A9N A;  5ENE A;  3K2J A;  5HEM A;  4J0R A;  3GG3 A;  1WUM A;  4NYW A;  5F1L A;  3LQJ A;  4HBV A;  5EWD A;  4A9M A;  5FG6 A;  4C66 A;  4HXM A;  4PS5 A;  4UIY A;  3JVM A;  5E9M A;  5D3S A;  4QNS A;  5FE4 A;  5F3A A;  4RVR A;  4UYH A;  4E96 A;  5E73 A;  4O7C A;  3RCW A;  3U5O A;  5II1 A;  5HRX A;  4A9O A;  4YYD A;  5BT4 A;  4NQM A;  2EJN A;  5TCM A;  4YYM A;  5CQT A;  4AKH A;  3MUK A;  4WHU A;  5A83 A;  3MB4 A;  4XY8 A;  5EI4 A;  4KV1 A;  4YAX A;  5IBN A;  5DFD A;  5C87 A;  4O7A A;  4IR3 A;  5IGM A;  2DWW A;  5L8T A;  5LVQ A;  5I88 A;  4QSP A;  3D1D A;  4Q0N A;  3U5K A;  2YEK A;  4YYJ A;  4LYI A;  3D1B A;  3Q2E A;  5D24 A;  1JSP B;  4C67 A;  4UIX A;  3UVX A;  4UIZ A;  5HQ5 A;  5EIS A;  5E9L A;  5COI A;  5EV9 A;  5FE0 A;  5LKU A;  4XYA A;  4CL9 A;  5TB6 A;  5FE7 A;  4O7E A;  5FG5 A;  1N72 A;  4YYK A;  5CZG A;  2E3K A;  4QEW A;  5II2 A;  4QYL A;  5CQA A;  4CLB A;  4Z6I A;  2OUO A;  5HEN A;  4DON A;  4MEO A;  4QY4 A;  2R0Y A;  4QB3 A;  4NR9 A;  3HME A;  4PCI A;  5E9Y A;  3O34 A;  5EWH A;  4LYS A;  5DKC A;  4TTE A;  5F5Z A;  5HFQ A;  5D3R A;  4TU6 A;  5DLX A;  2RNX A;  5DYA A;  5FDZ A;  4KCX A;  5E74 A;  2F6N A;  4O77 A;  5FFW A;  5HCL A;  3HMH A;  3U5P A;  5KTU A;  5CUD A;  3ERR A;  4IOO A;  4N4G A;  4TU4 A;  3QZV A;  5CQ6 A;  5ETB A;  5EP7 A;  2WP2 A;  4YH3 A;  5EGU A;  4YAD A;  5CP5 A;  2D82 A;  5CUA A;  4A9J A;  3MB3 A;  4YYG A;  5D3H A;  1X0J A;  4TT4 A;  5I1Q A;  5C85 A;  4A9K A;  5CUC A;  4ZQL A;  3FKM X;  4YY6 A;  4NR8 A;  5HQ7 A;  4O72 A;  3LXJ A;  5ENG A;  4NS5 A;  5FH8 A;  3HMF A;  4LC2 A;  5HRV A;  5HRW A;  5KO4 A;  5DY7 A;  4IR6 A;  5F2P A;  5D3N A;  5LJ0 A;  4HBX A;  4LZS A;  2E7N A;  5CQ5 A;  4UIV A;  5A5O A;  4O78 A;  2FSA A;  3U5L A;  4UYF B;  4QC1 A;  5KHM A;  4HXK A;  3TLP A;  4A9E A;  5A5Q A;  5HQ6 A;  4MR4 A;  5LJ2 A;  4AI6 A;  2RNW A;  5H1U A;  4O70 A;  4BW1 A;  4WIV A;  3SVG A;  4LYW A;  4TT6 A;  4N4I A;  4OUF A;  4YBM A;  5FE3 A;  5FG4 A;  4O74 A;  4ALG A;  3S91 A;  4YBS A;  5F63 A;  5LVR A;  5CU8 A;  3O36 A;  5DKD A;  5ACY A;  3VKH A;  4YAB A;  4CUQ A;  5FBX A;  5E9V A;  4QUT A;  5CS8 A;  5E9I A;  3QZT A;  2RI7 A;  4NXJ A;  5D25 A;  5EIC A;  3S92 A;  1WUG A;  5CRZ A;  5EPR A;  4HXL A;  5I89 A;  4TYL A;  4YYH A;  5I40 A;  3G0J A;  4QR5 A;  4QSX A;  4IOR A;  5E3G A;  4NQN A;  5DKH A;  5EK9 A;  5I29 A;  5CGP A;  4QSV A;  3UV2 A;  3AQA A;  3JVK A;  4UIU A;  5EPS A;  4QYD A;  4HBW A;  4IOQ A;  2RO1 A;  4IR4 A;  4LZ2 A;  4ZC9 A;  4YAT A;  3UVD A;  4NUD A;  5CRM A;  3MQM A;  5AMF A;  5IGL A;  4CUP A;  4QEV A;  3JVJ A;  4BHW A;  2RNY A;  4NR4 A;  5ENH A;  5CUE A;  5EM3 A;  3VKG A;  4QSR A;  3I3J A;  5G4R A;  5CQ8 A;  2YW5 A;  3U5M A;  4QSS A;  4A9L A;  4MEP A;  4F3I A;  2WP1 A;  4BJX A;  5H1T A;  3O37 A;  5ENC A;  5G4S A;  5H85 A;  5IGN A;  5AD3 A;  5FE1 A;  4MEQ A;  3JVL A;  5BT5 A;  5DYX A;  4WHW A;  5A5R A;  2DKW A;  5FB0 A;  5LKX A;  2L85 A;  2L84 A;  5EPB A;  4TZ2 A;  2KTB B;  4UYF A;  2E7O A;  2YEM A;  2DVS A;  4XUA A;  3DWY A;  2I7K A;  3P1D A;  1E6I A;  3QZS A;  2YYN A;  5EVA A;  2YDW A;  4YK0 A;  4CUU A;  5BT3 A;  3UW9 A;  4QUU A;  4QST A;  4QEU A;  4UIT A;  4QBM A;  4YYN A;  2OO1 A;  2D9E A;  4Z6H A;  4GPJ A;  3ONI A;  4LDF A;  4Z1S A;  4QC3 A;  4UYD A;  4PY6 A;  5H1V A;  5L8U A;  5ENI A;  5A81 A;  3NXB A;  5HFR A;  4NRB A;  4NR7 A;  5F61 A;  5CTL A;  4BW4 A;  3AAD A;  4XY9 A;  5FE5 A;  4HXS A;  5ENF A;  2R10 A;  5F1H A;  3SVH A;  5DLZ A;  4LZR A;  5DYU A;  5IG6 A;  4YY4 A;  2N9G A;  5E0R A;  4O71 A;  4ZW1 A;  4IR5 A;  4CUR A;  1EQF A;  2GRC A;  5CQ7 A;  5CQ3 A;  5A5P A;  5E9K A;  5IGK A;  5JWM A;  5F60 A;  2F6J A;  5CUG A;  4O7F A;  2DVQ A;  3O35 A;  2YQD A;  4CFK A;  4PKL A;  4O7B A;  4UYE A;  5JI8 A;  4O76 A;  1ZS5 A;  5I86 A;  5EWC A;  4A9I A;  3ZYU A;  5DX4 A;  2YEL A;  5D3L A;  5CFW A;  5EQ1 A;  2DVV A;  4KV4 A;  3DAI A;  4CUT A;  5I7X A;  5E3D A;  5IID A;  5C4Q A;  4LR6 A;  5DFC A;  2L5E A;  4NUE A;  3UV5 A;  4TZ8 A;  5A5S A;  5F25 A;  5KU3 A;  5D7X A;  2G4A A;  3IU6 A;  5LKT A;  4J1P A;  4Q0O A;  5FE2 A;  4PTB A;  4AKG A;  3UV4 A;  5EU1 A;  4HXO A;  4BW2 A;  5HM0 A;  4NYX A;  4XUB A;  4MR5 A;  5CQ4 A;  5EWV A;  4CUS A;  4QR3 A;  5CUB A;  4Z1Q A;  4N4H A;  5D3J A;  5I83 A;  3MUL A;  1JM4 B;  4N3W A;  4NYV A;  4UIW A;  5EA1 A;  3UVY A;  4QSW A;  4J3I A;  3Q2F A;  3U5N A;  4YH4 A;  4CFL A;  2RS9 B;  4Z93 A;  3G0L A;  1PUO A;  5L98 A;  4NUC A;  5EWW A;  4HXN A;  4PCE A; 
#chains in the Genus database with same CATH homology
 4AKN A;  5KTW A;  4HXR A;  5A85 A;  5HLS A;  4OGJ A;  2I8N A;  5L99 A;  5A82 A;  3P1F A;  5D26 A;  5FFY A;  4A9H A;  5F62 A;  4TQN A;  5D3T A;  5FH6 A;  2DAT A;  4MEN A;  5DW1 A;  5E7D A;  5FFV A;  4NRA A;  5A5N A;  4J0S A;  3LJW A;  5L96 A;  3SVF A;  4NR5 A;  5AME A;  3UVW A;  5FH7 A;  5C8G A;  5KTX A;  4TT2 A;  5DYC A;  3LQH A;  2MJV B;  4QSU A;  4LRG A;  4ALH A;  5FE9 A;  5J0D A;  1F68 A;  5I7Y A;  5LKZ A;  2R0V A;  4OGI A;  5FE8 A;  5LUU A;  4HBY A;  3LQI A;  5A7C A;  5C7N A;  2RFJ A;  5LJ1 A;  4MR6 A;  5CY9 A;  4QR4 A;  5K29 A;  3IU5 A;  5ETD A;  5I80 A;  2OSS A;  5DBM A;  4YBT A;  5FE6 A;  3P1E A;  4Y03 A;  5DFB A;  4NR6 A;  5D0C A;  5AD2 A;  3MXF A;  4A9F A;  4UYG A;  4YC9 A;  4FLP A;  2LSP B;  5HEL A;  2DVR A;  3O33 A;  3P1C A;  5DW2 A;  4TS8 A;  5HJC A;  5C89 A;  2H60 A;  4QSQ A;  5FB1 A;  5D3P A;  4YYI A;  4QZS A;  4BW3 A;  2NXB A;  2R0S A;  5ENB A;  4HXP A;  5ENJ A;  3P5O A;  4MR3 A;  4N4F A;  4X2I A;  5F36 A;  4NRC A;  5L97 A;  3D7C A;  3U5J A;  4O75 A;  5CPE A;  4A9N A;  5ENE A;  3K2J A;  5HEM A;  4J0R A;  3GG3 A;  1WUM A;  4NYW A;  5F1L A;  3LQJ A;  4HBV A;  5EWD A;  4A9M A;  5FG6 A;  4C66 A;  4HXM A;  4PS5 A;  4UIY A;  3JVM A;  5E9M A;  5D3S A;  4QNS A;  5FE4 A;  5F3A A;  4RVR A;  4UYH A;  4E96 A;  5E73 A;  4O7C A;  3RCW A;  3U5O A;  5II1 A;  5HRX A;  4A9O A;  4YYD A;  5BT4 A;  4NQM A;  5TCM A;  4YYM A;  5CQT A;  3MUK A;  4WHU A;  5A83 A;  3MB4 A;  4XY8 A;  5EI4 A;  4KV1 A;  4YAX A;  5IBN A;  5DFD A;  5C87 A;  4O7A A;  4IR3 A;  5IGM A;  2DWW A;  5L8T A;  5LVQ A;  5I88 A;  4QSP A;  4Q0N A;  3U5K A;  2YEK A;  4YYJ A;  4LYI A;  5D24 A;  3Q2E A;  1JSP B;  4C67 A;  4UIX A;  3UVX A;  4UIZ A;  5HQ5 A;  5EIS A;  5E9L A;  5COI A;  5EV9 A;  5FE0 A;  5LKU A;  4XYA A;  4CL9 A;  5TB6 A;  5FE7 A;  4O7E A;  5FG5 A;  1N72 A;  4YYK A;  5CZG A;  2E3K A;  4QEW A;  5II2 A;  4QYL A;  5CQA A;  4CLB A;  4Z6I A;  2OUO A;  5HEN A;  4DON A;  4MEO A;  4QY4 A;  2R0Y A;  4QB3 A;  4NR9 A;  3HME A;  4PCI A;  5E9Y A;  3O34 A;  5EWH A;  4LYS A;  5DKC A;  4TTE A;  5F5Z A;  5HFQ A;  5D3R A;  4TU6 A;  5DLX A;  2RNX A;  5DYA A;  5FDZ A;  4KCX A;  5E74 A;  2F6N A;  4O77 A;  5FFW A;  5HCL A;  3HMH A;  3U5P A;  5KTU A;  5CUD A;  4IOO A;  4N4G A;  4TU4 A;  3QZV A;  5CQ6 A;  5ETB A;  5EP7 A;  2WP2 A;  4YH3 A;  5EGU A;  4YAD A;  5CP5 A;  2D82 A;  5CUA A;  4A9J A;  3MB3 A;  4YYG A;  5D3H A;  1X0J A;  4TT4 A;  5I1Q A;  5C85 A;  4A9K A;  5CUC A;  4ZQL A;  3FKM X;  4YY6 A;  4NR8 A;  5HQ7 A;  4O72 A;  3LXJ A;  5ENG A;  4NS5 A;  5FH8 A;  3HMF A;  4LC2 A;  5HRV A;  5HRW A;  5KO4 A;  5DY7 A;  4IR6 A;  5F2P A;  5D3N A;  5LJ0 A;  4HBX A;  4LZS A;  2E7N A;  5CQ5 A;  4UIV A;  5A5O A;  4O78 A;  2FSA A;  3U5L A;  4UYF B;  4QC1 A;  5KHM A;  4HXK A;  3TLP A;  4A9E A;  5A5Q A;  5HQ6 A;  4MR4 A;  5LJ2 A;  2RNW A;  5H1U A;  4O70 A;  4BW1 A;  4WIV A;  3SVG A;  4LYW A;  4TT6 A;  4N4I A;  4OUF A;  4YBM A;  5FE3 A;  5FG4 A;  4O74 A;  4ALG A;  3S91 A;  4YBS A;  5F63 A;  5LVR A;  5CU8 A;  3O36 A;  5DKD A;  5ACY A;  4YAB A;  4CUQ A;  5FBX A;  5E9V A;  4QUT A;  5CS8 A;  5E9I A;  3QZT A;  2RI7 A;  4NXJ A;  5D25 A;  5EIC A;  3S92 A;  1WUG A;  5CRZ A;  5EPR A;  4HXL A;  5I89 A;  4TYL A;  4YYH A;  5I40 A;  3G0J A;  4QR5 A;  4QSX A;  4IOR A;  5E3G A;  4NQN A;  5DKH A;  5EK9 A;  5I29 A;  5CGP A;  4QSV A;  3UV2 A;  3AQA A;  3JVK A;  4UIU A;  5EPS A;  4QYD A;  4HBW A;  4IOQ A;  2RO1 A;  4IR4 A;  4LZ2 A;  4ZC9 A;  4YAT A;  3UVD A;  4NUD A;  5CRM A;  3MQM A;  5AMF A;  5IGL A;  4CUP A;  4QEV A;  3JVJ A;  4BHW A;  2RNY A;  4NR4 A;  5ENH A;  5CUE A;  5EM3 A;  4QSR A;  3I3J A;  5G4R A;  5CQ8 A;  2YW5 A;  3U5M A;  4QSS A;  4A9L A;  4MEP A;  4F3I A;  2WP1 A;  4BJX A;  5H1T A;  3O37 A;  5ENC A;  5G4S A;  5H85 A;  5IGN A;  5AD3 A;  5FE1 A;  4MEQ A;  3JVL A;  5BT5 A;  5DYX A;  4WHW A;  5A5R A;  2DKW A;  5FB0 A;  5LKX A;  2L85 A;  2L84 A;  5EPB A;  4TZ2 A;  2KTB B;  4UYF A;  2E7O A;  2YEM A;  2DVS A;  4XUA A;  3DWY A;  2I7K A;  3P1D A;  1E6I A;  3QZS A;  2YYN A;  5EVA A;  2YDW A;  4YK0 A;  4CUU A;  5BT3 A;  3UW9 A;  4QUU A;  4QST A;  4QEU A;  4UIT A;  4QBM A;  4YYN A;  2OO1 A;  2D9E A;  4Z6H A;  4GPJ A;  3ONI A;  4LDF A;  4Z1S A;  4QC3 A;  4UYD A;  4PY6 A;  5H1V A;  5L8U A;  5ENI A;  5A81 A;  3NXB A;  5HFR A;  4NRB A;  4NR7 A;  5F61 A;  5CTL A;  4BW4 A;  3AAD A;  4XY9 A;  5FE5 A;  4HXS A;  5ENF A;  2R10 A;  5F1H A;  3SVH A;  5DLZ A;  4LZR A;  5DYU A;  5IG6 A;  4YY4 A;  2N9G A;  5E0R A;  4O71 A;  4ZW1 A;  4IR5 A;  4CUR A;  1EQF A;  2GRC A;  5CQ7 A;  5CQ3 A;  5A5P A;  5E9K A;  5IGK A;  5JWM A;  5F60 A;  2F6J A;  5CUG A;  4O7F A;  2DVQ A;  3O35 A;  2YQD A;  4CFK A;  4PKL A;  4O7B A;  4UYE A;  5JI8 A;  4O76 A;  1ZS5 A;  5I86 A;  5EWC A;  4A9I A;  3ZYU A;  5DX4 A;  2YEL A;  5D3L A;  5CFW A;  5EQ1 A;  2DVV A;  4KV4 A;  3DAI A;  4CUT A;  5I7X A;  5E3D A;  5IID A;  5C4Q A;  4LR6 A;  5DFC A;  2L5E A;  4NUE A;  3UV5 A;  4TZ8 A;  5A5S A;  5F25 A;  5KU3 A;  5D7X A;  2G4A A;  3IU6 A;  5LKT A;  4J1P A;  4Q0O A;  5FE2 A;  4PTB A;  3UV4 A;  5EU1 A;  4HXO A;  4BW2 A;  5HM0 A;  4NYX A;  4XUB A;  4MR5 A;  5CQ4 A;  5EWV A;  4CUS A;  4QR3 A;  5CUB A;  4Z1Q A;  4N4H A;  5D3J A;  5I83 A;  3MUL A;  1JM4 B;  4N3W A;  4NYV A;  4UIW A;  5EA1 A;  3UVY A;  4QSW A;  4J3I A;  3Q2F A;  3U5N A;  4YH4 A;  4CFL A;  2RS9 B;  4Z93 A;  3G0L A;  5L98 A;  4NUC A;  5EWW A;  4HXN A;  4PCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...