4UYGA

C-terminal bromodomain of human brd2 with i-bet726 (gsk1324726a)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uygA00
3O34A 5I83A 4YY4A 5CU8A 4QSPA 5EWCA 4PS5A 2L84A 2RS9B 3UV4A 5II2A 5CY9A 4YATA 4QEWA 4ZC9A 4TT6A 4O78A 5DYUA 4QYDA 4IR3A 4NS5A 5F2PA 5FE3A 5BT3A 5I89A 5HQ6A 5TCMA 4MEPA 3QZVA 4QR4A 3UVWA 5G4RA 5F60A 5CGPA 2E7NA 5DW1A 2YEKA 4HXMA 5CFWA 5EM3A 5CQAA 2F6NA 4NQNA 4A9OA 5E3DA 4QSRA 4YYHA 4Z6HA 3TLPA 5C8GA 4QSVA 4O77A 3LJWA 4TZ8A 4YBMA 5HRXA 5E9KA 2E3KA 3P5OA 4KV1A 4XUAA 2YYNA 2YEMA 4J3IA 4LR6A 4A9JA 2NXBA 5AMEA 4YYKA 4YBTA 5EICA 4YYDA 2D82A 2WP2A 5A85A 5D3HA 3JVMA 4ALHA 2R0YA 4BJXA 5DX4A 4YH4A 5DW2A 5DKDA 4CUSA 4QNSA 3UVXA 5F25A 5I86A 4A9NA 5KU3A 3O37A 5E9MA 5LVRA 5EK9A 5CQ3A 5CUEA 3UW9A 3P1FA 5A5RA 4N4FA 4IOOA 4QC1A 5C89A 5CUGA 4HXRA 3GG3A 5CQ6A 2R0VA 5LVQA 5JI8A 5H85A 4UYFB 3D7CA 4BW1A 5HENA 2YQDA 3G0LA 4UYHA 5I80A 4N4GA 4YADA 4QSQA 4O75A 5E9IA 3ZYUA 4E96A 4NYVA 3U5LA 4YYJA 4HXSA 4QY4A 5C85A 2RO1A 4HXPA 5ENJA 5TB6A 3I3JA 4IR4A 4ALGA 4UYFA 4MR6A 2N9GA 5A5NA 4YK0A 5JWMA 5F63A 4BW2A 4UYEA 4OUFA 4MR3A 5F1LA 3DAIA 5FB1A 4N3WA 5A5QA 3NXBA 4TT2A 4QEVA 5EGUA 4QUUA 4CUUA 5DLXA 3ONIA 3MULA 3MXFA 2RNYA 5CRMA 5FDZA 5BT5A 4UIXA 4CL9A 4N4HA 4A9MA 5C7NA 4O76A 3MUKA 5FG6A 5L96A 5L98A 4AKNA 4O7FA 1JSPB 5H1UA 5CP5A 4O7CA 5IGMA 2RI7A 2FSAA 4Z1SA 4TS8A 2YW5A 4A9EA 5FE6A 4NRAA 3U5OA 4MEOA 4A9KA 4PKLA 2RNWA 4A9LA 5D3SA 4TU4A 4QSTA 5I1QA 3G0JA 4LYSA 4O7EA 2L5EA 5DYCA 4YC9A 4NRCA 5DFBA 4GPJA 2DVQA 3JVKA 5I40A 5FBXA 4CFLA 5CUDA 5HFQA 5E9VA 4Y03A 4OGIA 5KTXA 5LKTA 5AD2A 4UIWA 2G4AA 4YYGA 4O72A 2E7OA 3JVJA 3LQJA 3S91A 5HM0A 4NR8A 2R0SA 4QZSA 4IR6A 4BW4A 4TZ2A 4LYIA 4PTBA 4UIUA 4YABA 5L99A 4QR3A 5FG5A 3HMEA 2YELA 5IG6A 5CQ4A 4IR5A 4DONA 5FFVA 5D3PA 5I7XA 5KTWA 4C67A 5HQ7A 4PY6A 4Q0OA 5K29A 3JVLA 5ETDA 3UVYA 2RFJA 5E0RA 5LJ1A 5EVAA 3P1EA 5AD3A 4Z93A 3SVHA 5HQ5A 4NRBA 4NR9A 2I7KA 5II1A 4LDFA 4YYMA 2KTBB 1JM4B 4QEUA 5CZGA 5ENHA 3IU6A 2YDWA 4LC2A 5E73A 5EPBA 5H1VA 4WHWA 5A83A 5LJ2A 5LUUA 5FFWA 4O7AA 5CQTA 5HJCA 5FH8A 4HXLA 4J0RA 2OUOA 3QZSA 4QYLA 5HCLA 3S92A 2D9EA 5CUCA 5ENFA 2DVVA 5FG4A 5IIDA 3UV5A 5HRWA 2L85A 5FE5A 4NQMA 1X0JA 5FE0A 2LSPB 4QSSA 4KV4A 5ENCA 4MR4A 4TQNA 1ZS5A 4N4IA 4NUDA 4BHWA 2WP1A 4NYXA 5ENBA 4HBYA 5D3TA 4YYNA 5A5SA 4TT4A 5D3NA 5DY7A 4LZRA 4NXJA 5KTUA 4J1PA 4O70A 4QB3A 5HELA 5EA1A 3O33A 5ENGA 4IORA 4KCXA 4UYGA 2RNXA 4OGJA 4MENA 2OSSA 5E74A 4XUBA 4HXNA 5EV9A 5EU1A 3MB3A 4CLBA 5ACYA 4XY9A 5EI4A 4J0SA 4Q0NA 3FKMX 4YY6A 4O74A 3SVFA 5COIA 5KHMA 4TYLA 5D0CA 4YYIA 5D3RA 3SVGA 5L8UA 5HLSA 4XYAA 4A9FA 4LYWA 4TTEA 4Z6IA 5DYXA 4NR4A 3UV2A 4C66A 4QSUA 3U5NA 4NYWA 3Q2EA 4PCIA 5ENEA 5EISA 4IOQA 5FE9A 4ZQLA 4MEQA 2R10A 5IGNA 5LKUA 4FLPA 5FFYA 4X2IA 1WUGA 5FE7A 4HBXA 4CFKA 5D3JA 5FH6A 5J0DA 4NR7A 1E6IA 5FH7A 5BT4A 4CURA 5H1TA 4UITA 4CUQA 5C87A 3IU5A 5LKZA 4UIYA 4A9IA 5I7YA 5DYAA 4HBWA 2DWWA 5CS8A 4A9HA 5CQ5A 4YBSA 3P1DA 3RCWA 5D7XA 5DKHA 4HXKA 4NR6A 4QSXA 2DVSA 4O71A 4LZ2A 3MQMA 5I88A 1WUMA 4WHUA 3U5KA 5C4QA 5ENIA 5D24A 3QZTA 4QC3A 5ETBA 5EWHA 5E3GA 5F5ZA 5E9YA 5CRZA 5E9LA 5EWDA 3AADA 5IGLA 3MB4A 3U5PA 4CUTA 4YH3A 4QSWA 2DVRA 4XY8A 4CUPA 5IGKA 5HEMA 5CTLA 5HFRA 5FE4A 5A5PA 4HXOA 2OO1A 4QR5A 5D3LA 3O35A 5EWWA 3HMFA 5A81A 5L97A 5EWVA 3K2JA 3HMHA 3U5MA 5LKXA 5G4SA 2MJVB 4YAXA 3LXJA 3UVDA 4F3IA 5DFDA 5EQ1A 5FE1A 5EP7A 5FE2A 2GRCA 5LJ0A 4NR5A 5EPSA 5E7DA 1N72A 5KO4A 5F62A 5F61A 5FB0A 4UIVA 4PCEA 5DBMA 4WIVA 2DATA 3P1CA 5F3AA 5F36A 3AQAA 5F1HA 3O36A 1EQFA 5A5OA 4BW3A 5I29A 3Q2FA 4QUTA 4TU6A 3LQIA 5FE8A 1F68A 5CQ8A 4HBVA 2H60A 4MR5A 2DKWA 5DFCA 4NUCA 5DKCA 4RVRA 3LQHA 5D26A 4O7BA 5A7CA 4QBMA 2I8NA 4UYDA 5A82A 4LRGA 4Z1QA 3U5JA 5DLZA 5CUAA 3DWYA 5CPEA 4ZW1A 5CUBA 4NUEA 5L8TA 5AMFA 5HRVA 5IBNA 5EPRA 5D25A 2F6JA 4UIZA 5CQ7A 4LZSA
chains in the Genus database with same CATH superfamily
3O34A 5I83A 4YY4A 5CU8A 4QSPA 5EWCA 4PS5A 2L84A 2RS9B 3UV4A 5II2A 5CY9A 4YATA 4QEWA 4ZC9A 4TT6A 4O78A 5DYUA 4QYDA 4IR3A 4NS5A 5F2PA 5FE3A 5BT3A 5I89A 5HQ6A 5TCMA 4MEPA 3QZVA 4QR4A 3UVWA 5G4RA 5F60A 5CGPA 2E7NA 5DW1A 2YEKA 4HXMA 5CFWA 5EM3A 5CQAA 3ERRA 2F6NA 4NQNA 5E3DA 4QSRA 4A9OA 4YYHA 4Z6HA 3TLPA 5C8GA 4QSVA 4O77A 3LJWA 4TZ8A 4YBMA 5HRXA 5E9KA 2E3KA 3P5OA 4KV1A 4XUAA 2YYNA 2YEMA 4J3IA 4LR6A 4A9JA 2NXBA 5AMEA 4YYKA 4YBTA 5EICA 4YYDA 2D82A 2WP2A 5A85A 5D3HA 3JVMA 4ALHA 2R0YA 4BJXA 5DX4A 4YH4A 5DW2A 5DKDA 4CUSA 4QNSA 3UVXA 5F25A 5I86A 4A9NA 5KU3A 3O37A 5E9MA 5LVRA 5EK9A 5CQ3A 5CUEA 3UW9A 3P1FA 5A5RA 4AKGA 4N4FA 4IOOA 4QC1A 5C89A 5CUGA 4HXRA 3GG3A 4AKIA 3D1BA 5CQ6A 2R0VA 5LVQA 5JI8A 5H85A 4UYFB 3D7CA 4BW1A 5HENA 2YQDA 3G0LA 4UYHA 5I80A 4N4GA 4YADA 4QSQA 4O75A 5E9IA 3ZYUA 4E96A 4NYVA 3U5LA 4YYJA 4HXSA 4QY4A 5C85A 2RO1A 4HXPA 5ENJA 5TB6A 3I3JA 4IR4A 4ALGA 4UYFA 4MR6A 2N9GA 5A5NA 4YK0A 5JWMA 5F63A 4BW2A 4UYEA 4OUFA 4MR3A 5F1LA 3DAIA 5FB1A 4N3WA 5A5QA 3NXBA 4TT2A 4QEVA 5EGUA 4QUUA 4CUUA 5DLXA 3ONIA 3MULA 3MXFA 2RNYA 5CRMA 5FDZA 5BT5A 4UIXA 4CL9A 4N4HA 4A9MA 5C7NA 4O76A 3MUKA 5FG6A 5L96A 5L98A 4AKNA 4O7FA 1JSPB 5H1UA 5CP5A 4O7CA 5IGMA 2RI7A 2FSAA 4Z1SA 4TS8A 2YW5A 4A9EA 5FE6A 4NRAA 3U5OA 4MEOA 4A9KA 4PKLA 2RNWA 4A9LA 5D3SA 4TU4A 4QSTA 5I1QA 3G0JA 4LYSA 4O7EA 2L5EA 5DYCA 4YC9A 4NRCA 5DFBA 4GPJA 4AI6A 2DVQA 3JVKA 5I40A 5FBXA 4CFLA 5CUDA 5HFQA 5E9VA 4Y03A 4OGIA 5KTXA 5LKTA 5AD2A 4UIWA 2G4AA 4YYGA 4O72A 2E7OA 3JVJA 3LQJA 3S91A 5HM0A 4NR8A 2R0SA 4QZSA 4IR6A 4BW4A 4TZ2A 4LYIA 4PTBA 4UIUA 4YABA 5L99A 4QR3A 5FG5A 3HMEA 2YELA 5IG6A 5CQ4A 4IR5A 4DONA 5FFVA 5D3PA 5I7XA 5KTWA 4C67A 5HQ7A 4PY6A 4Q0OA 5K29A 3JVLA 5ETDA 3UVYA 2RFJA 5E0RA 5LJ1A 5EVAA 3P1EA 5AD3A 4Z93A 3SVHA 5HQ5A 4NRBA 4NR9A 2I7KA 5II1A 4LDFA 4YYMA 2KTBB 1JM4B 4QEUA 5CZGA 5ENHA 3IU6A 2YDWA 4LC2A 5E73A 5EPBA 5H1VA 4WHWA 5A83A 5LJ2A 5LUUA 5FFWA 4O7AA 3VKGA 5CQTA 5HJCA 5FH8A 4HXLA 4J0RA 2OUOA 3QZSA 4QYLA 5HCLA 3S92A 2D9EA 5CUCA 5ENFA 2DVVA 5FG4A 5IIDA 3UV5A 5HRWA 2L85A 5FE5A 4NQMA 1X0JA 5FE0A 2LSPB 4QSSA 4KV4A 5ENCA 4MR4A 4TQNA 1ZS5A 4N4IA 4NUDA 4BHWA 2WP1A 4NYXA 5ENBA 4HBYA 5D3TA 4YYNA 5A5SA 4TT4A 5D3NA 5DY7A 4LZRA 4NXJA 5KTUA 4J1PA 4O70A 4QB3A 5HELA 5EA1A 3O33A 5ENGA 4IORA 4KCXA 4UYGA 2RNXA 4OGJA 4MENA 2OSSA 5E74A 4XUBA 4HXNA 5EV9A 5EU1A 3MB3A 4CLBA 5ACYA 4XY9A 5EI4A 4J0SA 4Q0NA 3FKMX 4YY6A 4O74A 3SVFA 5COIA 5KHMA 4TYLA 5D0CA 4YYIA 5D3RA 3SVGA 5L8UA 5HLSA 4XYAA 4A9FA 4LYWA 4TTEA 4Z6IA 1ZKRA 5DYXA 4NR4A 3UV2A 4C66A 4QSUA 3U5NA 4NYWA 3Q2EA 4PCIA 5ENEA 4AKHA 5EISA 4IOQA 5FE9A 4ZQLA 4MEQA 2R10A 5IGNA 5LKUA 4FLPA 5FFYA 4X2IA 1WUGA 5FE7A 4HBXA 1PUOA 4CFKA 5D3JA 5FH6A 5J0DA 4NR7A 1E6IA 5FH7A 5BT4A 4CURA 5H1TA 4UITA 4CUQA 5C87A 3IU5A 5LKZA 4UIYA 4A9IA 5I7YA 5DYAA 4HBWA 2DWWA 5CS8A 4A9HA 5CQ5A 4YBSA 3P1DA 3RCWA 5D7XA 5DKHA 4HXKA 4NR6A 4QSXA 2DVSA 4O71A 4LZ2A 3MQMA 5I88A 1WUMA 4WHUA 3U5KA 5C4QA 5ENIA 5D24A 3QZTA 4QC3A 5ETBA 5EWHA 5E3GA 5F5ZA 5E9YA 3D1DA 5CRZA 5E9LA 5EWDA 3AADA 5IGLA 3MB4A 3U5PA 4CUTA 2EJNA 4YH3A 4QSWA 2DVRA 4XY8A 4CUPA 5IGKA 5HEMA 5CTLA 5HFRA 5FE4A 5A5PA 4HXOA 2OO1A 4QR5A 5D3LA 3O35A 5EWWA 3HMFA 5A81A 5L97A 5EWVA 3K2JA 3HMHA 3U5MA 5LKXA 5G4SA 2MJVB 4YAXA 3LXJA 3UVDA 4F3IA 5DFDA 5EQ1A 5FE1A 5EP7A 5FE2A 2GRCA 5LJ0A 4NR5A 5EPSA 5E7DA 1N72A 5KO4A 5F62A 5F61A 5FB0A 3VKHA 4UIVA 4PCEA 5DBMA 4WIVA 2DATA 3P1CA 5F3AA 5F36A 3AQAA 5F1HA 3O36A 1EQFA 5A5OA 4BW3A 5I29A 3Q2FA 4QUTA 4TU6A 3LQIA 5FE8A 1F68A 5CQ8A 4HBVA 2H60A 4MR5A 2DKWA 5DFCA 4NUCA 5DKCA 4RVRA 3LQHA 5D26A 4O7BA 5A7CA 4QBMA 2I8NA 4UYDA 5A82A 4LRGA 4Z1QA 3U5JA 5DLZA 5CUAA 3DWYA 5CPEA 4ZW1A 5CUBA 4NUEA 5L8TA 5AMFA 5HRVA 5IBNA 5EPRA 5D25A 2F6JA 4UIZA 5CQ7A 4LZSA
chains in the Genus database with same CATH topology
3O34A 5I83A 4YY4A 5CU8A 4QSPA 5EWCA 4PS5A 2L84A 2RS9B 3UV4A 5II2A 5CY9A 4YATA 4QEWA 4ZC9A 4TT6A 4O78A 5DYUA 4QYDA 4IR3A 4NS5A 5F2PA 5FE3A 5BT3A 5I89A 5HQ6A 5TCMA 4MEPA 3QZVA 4QR4A 3UVWA 5G4RA 5F60A 5CGPA 2E7NA 5DW1A 2YEKA 4HXMA 5CFWA 5EM3A 5CQAA 2F6NA 4NQNA 4A9OA 5E3DA 4QSRA 4YYHA 4Z6HA 3TLPA 5C8GA 4QSVA 4O77A 3LJWA 4TZ8A 4YBMA 5HRXA 5E9KA 2E3KA 3P5OA 4KV1A 4XUAA 2YYNA 2YEMA 4J3IA 4LR6A 4A9JA 2NXBA 5AMEA 4YYKA 4YBTA 5EICA 4YYDA 2D82A 2WP2A 5A85A 5D3HA 3JVMA 4ALHA 2R0YA 4BJXA 5DX4A 4YH4A 5DW2A 5DKDA 4CUSA 4QNSA 3UVXA 5F25A 5I86A 4A9NA 5KU3A 3O37A 5E9MA 5LVRA 5EK9A 5CQ3A 5CUEA 3UW9A 3P1FA 5A5RA 4N4FA 4IOOA 4QC1A 5C89A 5CUGA 4HXRA 3GG3A 5CQ6A 2R0VA 5LVQA 5JI8A 5H85A 4UYFB 3D7CA 4BW1A 5HENA 2YQDA 3G0LA 4UYHA 5I80A 4N4GA 4YADA 4QSQA 4O75A 5E9IA 3ZYUA 4E96A 4NYVA 3U5LA 4YYJA 4HXSA 4QY4A 5C85A 2RO1A 4HXPA 5ENJA 5TB6A 3I3JA 4IR4A 4ALGA 4UYFA 4MR6A 2N9GA 5A5NA 4YK0A 5JWMA 5F63A 4BW2A 4UYEA 4OUFA 4MR3A 5F1LA 3DAIA 5FB1A 4N3WA 5A5QA 3NXBA 4TT2A 4QEVA 5EGUA 4QUUA 4CUUA 5DLXA 3ONIA 3MULA 3MXFA 2RNYA 5CRMA 5FDZA 5BT5A 4UIXA 4CL9A 4N4HA 4A9MA 5C7NA 4O76A 3MUKA 5FG6A 5L96A 5L98A 4AKNA 4O7FA 1JSPB 5H1UA 5CP5A 4O7CA 5IGMA 2RI7A 2FSAA 4Z1SA 4TS8A 2YW5A 4A9EA 5FE6A 4NRAA 3U5OA 4MEOA 4A9KA 4PKLA 2RNWA 4A9LA 5D3SA 4TU4A 4QSTA 5I1QA 3G0JA 4LYSA 4O7EA 2L5EA 5DYCA 4YC9A 4NRCA 5DFBA 4GPJA 2DVQA 3JVKA 5I40A 5FBXA 4CFLA 5CUDA 5HFQA 5E9VA 4Y03A 4OGIA 5KTXA 5LKTA 5AD2A 4UIWA 2G4AA 4YYGA 4O72A 2E7OA 3JVJA 3LQJA 3S91A 5HM0A 4NR8A 2R0SA 4QZSA 4IR6A 4BW4A 4TZ2A 4LYIA 4PTBA 4UIUA 4YABA 5L99A 4QR3A 5FG5A 3HMEA 2YELA 5IG6A 5CQ4A 4IR5A 4DONA 5FFVA 5D3PA 5I7XA 5KTWA 4C67A 5HQ7A 4PY6A 4Q0OA 5K29A 3JVLA 5ETDA 3UVYA 2RFJA 5E0RA 5LJ1A 5EVAA 3P1EA 5AD3A 4Z93A 3SVHA 5HQ5A 4NRBA 4NR9A 2I7KA 5II1A 4LDFA 4YYMA 2KTBB 1JM4B 4QEUA 5CZGA 5ENHA 3IU6A 2YDWA 4LC2A 5E73A 5EPBA 5H1VA 4WHWA 5A83A 5LJ2A 5LUUA 5FFWA 4O7AA 5CQTA 5HJCA 5FH8A 4HXLA 4J0RA 2OUOA 3QZSA 4QYLA 5HCLA 3S92A 2D9EA 5CUCA 5ENFA 2DVVA 5FG4A 5IIDA 3UV5A 5HRWA 2L85A 5FE5A 4NQMA 1X0JA 5FE0A 2LSPB 4QSSA 4KV4A 5ENCA 4MR4A 4TQNA 1ZS5A 4N4IA 4NUDA 4BHWA 2WP1A 4NYXA 5ENBA 4HBYA 5D3TA 4YYNA 5A5SA 4TT4A 5D3NA 5DY7A 4LZRA 4NXJA 5KTUA 4J1PA 4O70A 4QB3A 5HELA 5EA1A 3O33A 5ENGA 4IORA 4KCXA 4UYGA 2RNXA 4OGJA 4MENA 2OSSA 5E74A 4XUBA 4HXNA 5EV9A 5EU1A 3MB3A 4CLBA 5ACYA 4XY9A 5EI4A 4J0SA 4Q0NA 3FKMX 4YY6A 4O74A 3SVFA 5COIA 5KHMA 4TYLA 5D0CA 4YYIA 5D3RA 3SVGA 5L8UA 5HLSA 4XYAA 4A9FA 4LYWA 4TTEA 4Z6IA 5DYXA 4NR4A 3UV2A 4C66A 4QSUA 3U5NA 4NYWA 3Q2EA 4PCIA 5ENEA 5EISA 4IOQA 5FE9A 4ZQLA 4MEQA 2R10A 5IGNA 5LKUA 4FLPA 5FFYA 4X2IA 1WUGA 5FE7A 4HBXA 4CFKA 5D3JA 5FH6A 5J0DA 4NR7A 1E6IA 5FH7A 5BT4A 4CURA 5H1TA 4UITA 4CUQA 5C87A 3IU5A 5LKZA 4UIYA 4A9IA 5I7YA 5DYAA 4HBWA 2DWWA 5CS8A 4A9HA 5CQ5A 4YBSA 3P1DA 3RCWA 5D7XA 5DKHA 4HXKA 4NR6A 4QSXA 2DVSA 4O71A 4LZ2A 3MQMA 5I88A 1WUMA 4WHUA 3U5KA 5C4QA 5ENIA 5D24A 3QZTA 4QC3A 5ETBA 5EWHA 5E3GA 5F5ZA 5E9YA 5CRZA 5E9LA 5EWDA 3AADA 5IGLA 3MB4A 3U5PA 4CUTA 4YH3A 4QSWA 2DVRA 4XY8A 4CUPA 5IGKA 5HEMA 5CTLA 5HFRA 5FE4A 5A5PA 4HXOA 2OO1A 4QR5A 5D3LA 3O35A 5EWWA 3HMFA 5A81A 5L97A 5EWVA 3K2JA 3HMHA 3U5MA 5LKXA 5G4SA 2MJVB 4YAXA 3LXJA 3UVDA 4F3IA 5DFDA 5EQ1A 5FE1A 5EP7A 5FE2A 2GRCA 5LJ0A 4NR5A 5EPSA 5E7DA 1N72A 5KO4A 5F62A 5F61A 5FB0A 4UIVA 4PCEA 5DBMA 4WIVA 2DATA 3P1CA 5F3AA 5F36A 3AQAA 5F1HA 3O36A 1EQFA 5A5OA 4BW3A 5I29A 3Q2FA 4QUTA 4TU6A 3LQIA 5FE8A 1F68A 5CQ8A 4HBVA 2H60A 4MR5A 2DKWA 5DFCA 4NUCA 5DKCA 4RVRA 3LQHA 5D26A 4O7BA 5A7CA 4QBMA 2I8NA 4UYDA 5A82A 4LRGA 4Z1QA 3U5JA 5DLZA 5CUAA 3DWYA 5CPEA 4ZW1A 5CUBA 4NUEA 5L8TA 5AMFA 5HRVA 5IBNA 5EPRA 5D25A 2F6JA 4UIZA 5CQ7A 4LZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O34 A;  5I83 A;  4YY4 A;  5CU8 A;  4QSP A;  5EWC A;  4PS5 A;  2L84 A;  2RS9 B;  3UV4 A;  5II2 A;  5CY9 A;  4YAT A;  4QEW A;  4ZC9 A;  4TT6 A;  4O78 A;  5DYU A;  4QYD A;  4IR3 A;  4NS5 A;  5F2P A;  5FE3 A;  5BT3 A;  5I89 A;  5HQ6 A;  5TCM A;  4MEP A;  3QZV A;  4QR4 A;  3UVW A;  5G4R A;  5F60 A;  5CGP A;  2E7N A;  5DW1 A;  2YEK A;  4HXM A;  5CFW A;  5EM3 A;  5CQA A;  2F6N A;  4NQN A;  4A9O A;  5E3D A;  4QSR A;  4YYH A;  4Z6H A;  3TLP A;  5C8G A;  4QSV A;  4O77 A;  3LJW A;  4TZ8 A;  4YBM A;  5HRX A;  5E9K A;  2E3K A;  3P5O A;  4KV1 A;  4XUA A;  2YYN A;  2YEM A;  4J3I A;  4LR6 A;  4A9J A;  2NXB A;  5AME A;  4YYK A;  4YBT A;  5EIC A;  4YYD A;  2D82 A;  2WP2 A;  5A85 A;  5D3H A;  3JVM A;  4ALH A;  2R0Y A;  4BJX A;  5DX4 A;  4YH4 A;  5DW2 A;  5DKD A;  4CUS A;  4QNS A;  3UVX A;  5F25 A;  5I86 A;  4A9N A;  5KU3 A;  3O37 A;  5E9M A;  5LVR A;  5EK9 A;  5CQ3 A;  5CUE A;  3UW9 A;  3P1F A;  5A5R A;  4N4F A;  4IOO A;  4QC1 A;  5C89 A;  5CUG A;  4HXR A;  3GG3 A;  5CQ6 A;  2R0V A;  5LVQ A;  5JI8 A;  5H85 A;  4UYF B;  3D7C A;  4BW1 A;  5HEN A;  2YQD A;  3G0L A;  4UYH A;  5I80 A;  4N4G A;  4YAD A;  4QSQ A;  4O75 A;  5E9I A;  3ZYU A;  4E96 A;  4NYV A;  3U5L A;  4YYJ A;  4HXS A;  4QY4 A;  5C85 A;  2RO1 A;  4HXP A;  5ENJ A;  5TB6 A;  3I3J A;  4IR4 A;  4ALG A;  4UYF A;  4MR6 A;  2N9G A;  5A5N A;  4YK0 A;  5JWM A;  5F63 A;  4BW2 A;  4UYE A;  4OUF A;  4MR3 A;  5F1L A;  3DAI A;  5FB1 A;  4N3W A;  5A5Q A;  3NXB A;  4TT2 A;  4QEV A;  5EGU A;  4QUU A;  4CUU A;  5DLX A;  3ONI A;  3MUL A;  3MXF A;  2RNY A;  5CRM A;  5FDZ A;  5BT5 A;  4UIX A;  4CL9 A;  4N4H A;  4A9M A;  5C7N A;  4O76 A;  3MUK A;  5FG6 A;  5L96 A;  5L98 A;  4AKN A;  4O7F A;  1JSP B;  5H1U A;  5CP5 A;  4O7C A;  5IGM A;  2RI7 A;  2FSA A;  4Z1S A;  4TS8 A;  2YW5 A;  4A9E A;  5FE6 A;  4NRA A;  3U5O A;  4MEO A;  4A9K A;  4PKL A;  2RNW A;  4A9L A;  5D3S A;  4TU4 A;  4QST A;  5I1Q A;  3G0J A;  4LYS A;  4O7E A;  2L5E A;  5DYC A;  4YC9 A;  4NRC A;  5DFB A;  4GPJ A;  2DVQ A;  3JVK A;  5I40 A;  5FBX A;  4CFL A;  5CUD A;  5HFQ A;  5E9V A;  4Y03 A;  4OGI A;  5KTX A;  5LKT A;  5AD2 A;  4UIW A;  2G4A A;  4YYG A;  4O72 A;  2E7O A;  3JVJ A;  3LQJ A;  3S91 A;  5HM0 A;  4NR8 A;  2R0S A;  4QZS A;  4IR6 A;  4BW4 A;  4TZ2 A;  4LYI A;  4PTB A;  4UIU A;  4YAB A;  5L99 A;  4QR3 A;  5FG5 A;  3HME A;  2YEL A;  5IG6 A;  5CQ4 A;  4IR5 A;  4DON A;  5FFV A;  5D3P A;  5I7X A;  5KTW A;  4C67 A;  5HQ7 A;  4PY6 A;  4Q0O A;  5K29 A;  3JVL A;  5ETD A;  3UVY A;  2RFJ A;  5E0R A;  5LJ1 A;  5EVA A;  3P1E A;  5AD3 A;  4Z93 A;  3SVH A;  5HQ5 A;  4NRB A;  4NR9 A;  2I7K A;  5II1 A;  4LDF A;  4YYM A;  2KTB B;  1JM4 B;  4QEU A;  5CZG A;  5ENH A;  3IU6 A;  2YDW A;  4LC2 A;  5E73 A;  5EPB A;  5H1V A;  4WHW A;  5A83 A;  5LJ2 A;  5LUU A;  5FFW A;  4O7A A;  5CQT A;  5HJC A;  5FH8 A;  4HXL A;  4J0R A;  2OUO A;  3QZS A;  4QYL A;  5HCL A;  3S92 A;  2D9E A;  5CUC A;  5ENF A;  2DVV A;  5FG4 A;  5IID A;  3UV5 A;  5HRW A;  2L85 A;  5FE5 A;  4NQM A;  1X0J A;  5FE0 A;  2LSP B;  4QSS A;  4KV4 A;  5ENC A;  4MR4 A;  4TQN A;  1ZS5 A;  4N4I A;  4NUD A;  4BHW A;  2WP1 A;  4NYX A;  5ENB A;  4HBY A;  5D3T A;  4YYN A;  5A5S A;  4TT4 A;  5D3N A;  5DY7 A;  4LZR A;  4NXJ A;  5KTU A;  4J1P A;  4O70 A;  4QB3 A;  5HEL A;  5EA1 A;  3O33 A;  5ENG A;  4IOR A;  4KCX A;  4UYG A;  2RNX A;  4OGJ A;  4MEN A;  2OSS A;  5E74 A;  4XUB A;  4HXN A;  5EV9 A;  5EU1 A;  3MB3 A;  4CLB A;  5ACY A;  4XY9 A;  5EI4 A;  4J0S A;  4Q0N A;  3FKM X;  4YY6 A;  4O74 A;  3SVF A;  5COI A;  5KHM A;  4TYL A;  5D0C A;  4YYI A;  5D3R A;  3SVG A;  5L8U A;  5HLS A;  4XYA A;  4A9F A;  4LYW A;  4TTE A;  4Z6I A;  5DYX A;  4NR4 A;  3UV2 A;  4C66 A;  4QSU A;  3U5N A;  4NYW A;  3Q2E A;  4PCI A;  5ENE A;  5EIS A;  4IOQ A;  5FE9 A;  4ZQL A;  4MEQ A;  2R10 A;  5IGN A;  5LKU A;  4FLP A;  5FFY A;  4X2I A;  1WUG A;  5FE7 A;  4HBX A;  4CFK A;  5D3J A;  5FH6 A;  5J0D A;  4NR7 A;  1E6I A;  5FH7 A;  5BT4 A;  4CUR A;  5H1T A;  4UIT A;  4CUQ A;  5C87 A;  3IU5 A;  5LKZ A;  4UIY A;  4A9I A;  5I7Y A;  5DYA A;  4HBW A;  2DWW A;  5CS8 A;  4A9H A;  5CQ5 A;  4YBS A;  3P1D A;  3RCW A;  5D7X A;  5DKH A;  4HXK A;  4NR6 A;  4QSX A;  2DVS A;  4O71 A;  4LZ2 A;  3MQM A;  5I88 A;  1WUM A;  4WHU A;  3U5K A;  5C4Q A;  5ENI A;  5D24 A;  3QZT A;  4QC3 A;  5ETB A;  5EWH A;  5E3G A;  5F5Z A;  5E9Y A;  5CRZ A;  5E9L A;  5EWD A;  3AAD A;  5IGL A;  3MB4 A;  3U5P A;  4CUT A;  4YH3 A;  4QSW A;  2DVR A;  4XY8 A;  4CUP A;  5IGK A;  5HEM A;  5CTL A;  5HFR A;  5FE4 A;  5A5P A;  4HXO A;  2OO1 A;  4QR5 A;  5D3L A;  3O35 A;  5EWW A;  3HMF A;  5A81 A;  5L97 A;  5EWV A;  3K2J A;  3HMH A;  3U5M A;  5LKX A;  5G4S A;  2MJV B;  4YAX A;  3LXJ A;  3UVD A;  4F3I A;  5DFD A;  5EQ1 A;  5FE1 A;  5EP7 A;  5FE2 A;  2GRC A;  5LJ0 A;  4NR5 A;  5EPS A;  5E7D A;  1N72 A;  5KO4 A;  5F62 A;  5F61 A;  5FB0 A;  4UIV A;  4PCE A;  5DBM A;  4WIV A;  2DAT A;  3P1C A;  5F3A A;  5F36 A;  3AQA A;  5F1H A;  3O36 A;  1EQF A;  5A5O A;  4BW3 A;  5I29 A;  3Q2F A;  4QUT A;  4TU6 A;  3LQI A;  5FE8 A;  1F68 A;  5CQ8 A;  4HBV A;  2H60 A;  4MR5 A;  2DKW A;  5DFC A;  4NUC A;  5DKC A;  4RVR A;  3LQH A;  5D26 A;  4O7B A;  5A7C A;  4QBM A;  2I8N A;  4UYD A;  5A82 A;  4LRG A;  4Z1Q A;  3U5J A;  5DLZ A;  5CUA A;  3DWY A;  5CPE A;  4ZW1 A;  5CUB A;  4NUE A;  5L8T A;  5AMF A;  5HRV A;  5IBN A;  5EPR A;  5D25 A;  2F6J A;  4UIZ A;  5CQ7 A;  4LZS A; 
#chains in the Genus database with same CATH topology
 3O34 A;  5I83 A;  4YY4 A;  5CU8 A;  4QSP A;  5EWC A;  4PS5 A;  2L84 A;  2RS9 B;  3UV4 A;  5II2 A;  5CY9 A;  4YAT A;  4QEW A;  4ZC9 A;  4TT6 A;  4O78 A;  5DYU A;  4QYD A;  4IR3 A;  4NS5 A;  5F2P A;  5FE3 A;  5BT3 A;  5I89 A;  5HQ6 A;  5TCM A;  4MEP A;  3QZV A;  4QR4 A;  3UVW A;  5G4R A;  5F60 A;  5CGP A;  2E7N A;  5DW1 A;  2YEK A;  4HXM A;  5CFW A;  5EM3 A;  5CQA A;  3ERR A;  2F6N A;  4NQN A;  5E3D A;  4QSR A;  4A9O A;  4YYH A;  4Z6H A;  3TLP A;  5C8G A;  4QSV A;  4O77 A;  3LJW A;  4TZ8 A;  4YBM A;  5HRX A;  5E9K A;  2E3K A;  3P5O A;  4KV1 A;  4XUA A;  2YYN A;  2YEM A;  4J3I A;  4LR6 A;  4A9J A;  2NXB A;  5AME A;  4YYK A;  4YBT A;  5EIC A;  4YYD A;  2D82 A;  2WP2 A;  5A85 A;  5D3H A;  3JVM A;  4ALH A;  2R0Y A;  4BJX A;  5DX4 A;  4YH4 A;  5DW2 A;  5DKD A;  4CUS A;  4QNS A;  3UVX A;  5F25 A;  5I86 A;  4A9N A;  5KU3 A;  3O37 A;  5E9M A;  5LVR A;  5EK9 A;  5CQ3 A;  5CUE A;  3UW9 A;  3P1F A;  5A5R A;  4AKG A;  4N4F A;  4IOO A;  4QC1 A;  5C89 A;  5CUG A;  4HXR A;  3GG3 A;  4AKI A;  3D1B A;  5CQ6 A;  2R0V A;  5LVQ A;  5JI8 A;  5H85 A;  4UYF B;  3D7C A;  4BW1 A;  5HEN A;  2YQD A;  3G0L A;  4UYH A;  5I80 A;  4N4G A;  4YAD A;  4QSQ A;  4O75 A;  5E9I A;  3ZYU A;  4E96 A;  4NYV A;  3U5L A;  4YYJ A;  4HXS A;  4QY4 A;  5C85 A;  2RO1 A;  4HXP A;  5ENJ A;  5TB6 A;  3I3J A;  4IR4 A;  4ALG A;  4UYF A;  4MR6 A;  2N9G A;  5A5N A;  4YK0 A;  5JWM A;  5F63 A;  4BW2 A;  4UYE A;  4OUF A;  4MR3 A;  5F1L A;  3DAI A;  5FB1 A;  4N3W A;  5A5Q A;  3NXB A;  4TT2 A;  4QEV A;  5EGU A;  4QUU A;  4CUU A;  5DLX A;  3ONI A;  3MUL A;  3MXF A;  2RNY A;  5CRM A;  5FDZ A;  5BT5 A;  4UIX A;  4CL9 A;  4N4H A;  4A9M A;  5C7N A;  4O76 A;  3MUK A;  5FG6 A;  5L96 A;  5L98 A;  4AKN A;  4O7F A;  1JSP B;  5H1U A;  5CP5 A;  4O7C A;  5IGM A;  2RI7 A;  2FSA A;  4Z1S A;  4TS8 A;  2YW5 A;  4A9E A;  5FE6 A;  4NRA A;  3U5O A;  4MEO A;  4A9K A;  4PKL A;  2RNW A;  4A9L A;  5D3S A;  4TU4 A;  4QST A;  5I1Q A;  3G0J A;  4LYS A;  4O7E A;  2L5E A;  5DYC A;  4YC9 A;  4NRC A;  5DFB A;  4GPJ A;  4AI6 A;  2DVQ A;  3JVK A;  5I40 A;  5FBX A;  4CFL A;  5CUD A;  5HFQ A;  5E9V A;  4Y03 A;  4OGI A;  5KTX A;  5LKT A;  5AD2 A;  4UIW A;  2G4A A;  4YYG A;  4O72 A;  2E7O A;  3JVJ A;  3LQJ A;  3S91 A;  5HM0 A;  4NR8 A;  2R0S A;  4QZS A;  4IR6 A;  4BW4 A;  4TZ2 A;  4LYI A;  4PTB A;  4UIU A;  4YAB A;  5L99 A;  4QR3 A;  5FG5 A;  3HME A;  2YEL A;  5IG6 A;  5CQ4 A;  4IR5 A;  4DON A;  5FFV A;  5D3P A;  5I7X A;  5KTW A;  4C67 A;  5HQ7 A;  4PY6 A;  4Q0O A;  5K29 A;  3JVL A;  5ETD A;  3UVY A;  2RFJ A;  5E0R A;  5LJ1 A;  5EVA A;  3P1E A;  5AD3 A;  4Z93 A;  3SVH A;  5HQ5 A;  4NRB A;  4NR9 A;  2I7K A;  5II1 A;  4LDF A;  4YYM A;  2KTB B;  1JM4 B;  4QEU A;  5CZG A;  5ENH A;  3IU6 A;  2YDW A;  4LC2 A;  5E73 A;  5EPB A;  5H1V A;  4WHW A;  5A83 A;  5LJ2 A;  5LUU A;  5FFW A;  4O7A A;  3VKG A;  5CQT A;  5HJC A;  5FH8 A;  4HXL A;  4J0R A;  2OUO A;  3QZS A;  4QYL A;  5HCL A;  3S92 A;  2D9E A;  5CUC A;  5ENF A;  2DVV A;  5FG4 A;  5IID A;  3UV5 A;  5HRW A;  2L85 A;  5FE5 A;  4NQM A;  1X0J A;  5FE0 A;  2LSP B;  4QSS A;  4KV4 A;  5ENC A;  4MR4 A;  4TQN A;  1ZS5 A;  4N4I A;  4NUD A;  4BHW A;  2WP1 A;  4NYX A;  5ENB A;  4HBY A;  5D3T A;  4YYN A;  5A5S A;  4TT4 A;  5D3N A;  5DY7 A;  4LZR A;  4NXJ A;  5KTU A;  4J1P A;  4O70 A;  4QB3 A;  5HEL A;  5EA1 A;  3O33 A;  5ENG A;  4IOR A;  4KCX A;  4UYG A;  2RNX A;  4OGJ A;  4MEN A;  2OSS A;  5E74 A;  4XUB A;  4HXN A;  5EV9 A;  5EU1 A;  3MB3 A;  4CLB A;  5ACY A;  4XY9 A;  5EI4 A;  4J0S A;  4Q0N A;  3FKM X;  4YY6 A;  4O74 A;  3SVF A;  5COI A;  5KHM A;  4TYL A;  5D0C A;  4YYI A;  5D3R A;  3SVG A;  5L8U A;  5HLS A;  4XYA A;  4A9F A;  4LYW A;  4TTE A;  4Z6I A;  1ZKR A;  5DYX A;  4NR4 A;  3UV2 A;  4C66 A;  4QSU A;  3U5N A;  4NYW A;  3Q2E A;  4PCI A;  5ENE A;  4AKH A;  5EIS A;  4IOQ A;  5FE9 A;  4ZQL A;  4MEQ A;  2R10 A;  5IGN A;  5LKU A;  4FLP A;  5FFY A;  4X2I A;  1WUG A;  5FE7 A;  4HBX A;  1PUO A;  4CFK A;  5D3J A;  5FH6 A;  5J0D A;  4NR7 A;  1E6I A;  5FH7 A;  5BT4 A;  4CUR A;  5H1T A;  4UIT A;  4CUQ A;  5C87 A;  3IU5 A;  5LKZ A;  4UIY A;  4A9I A;  5I7Y A;  5DYA A;  4HBW A;  2DWW A;  5CS8 A;  4A9H A;  5CQ5 A;  4YBS A;  3P1D A;  3RCW A;  5D7X A;  5DKH A;  4HXK A;  4NR6 A;  4QSX A;  2DVS A;  4O71 A;  4LZ2 A;  3MQM A;  5I88 A;  1WUM A;  4WHU A;  3U5K A;  5C4Q A;  5ENI A;  5D24 A;  3QZT A;  4QC3 A;  5ETB A;  5EWH A;  5E3G A;  5F5Z A;  5E9Y A;  3D1D A;  5CRZ A;  5E9L A;  5EWD A;  3AAD A;  5IGL A;  3MB4 A;  3U5P A;  4CUT A;  2EJN A;  4YH3 A;  4QSW A;  2DVR A;  4XY8 A;  4CUP A;  5IGK A;  5HEM A;  5CTL A;  5HFR A;  5FE4 A;  5A5P A;  4HXO A;  2OO1 A;  4QR5 A;  5D3L A;  3O35 A;  5EWW A;  3HMF A;  5A81 A;  5L97 A;  5EWV A;  3K2J A;  3HMH A;  3U5M A;  5LKX A;  5G4S A;  2MJV B;  4YAX A;  3LXJ A;  3UVD A;  4F3I A;  5DFD A;  5EQ1 A;  5FE1 A;  5EP7 A;  5FE2 A;  2GRC A;  5LJ0 A;  4NR5 A;  5EPS A;  5E7D A;  1N72 A;  5KO4 A;  5F62 A;  5F61 A;  5FB0 A;  3VKH A;  4UIV A;  4PCE A;  5DBM A;  4WIV A;  2DAT A;  3P1C A;  5F3A A;  5F36 A;  3AQA A;  5F1H A;  3O36 A;  1EQF A;  5A5O A;  4BW3 A;  5I29 A;  3Q2F A;  4QUT A;  4TU6 A;  3LQI A;  5FE8 A;  1F68 A;  5CQ8 A;  4HBV A;  2H60 A;  4MR5 A;  2DKW A;  5DFC A;  4NUC A;  5DKC A;  4RVR A;  3LQH A;  5D26 A;  4O7B A;  5A7C A;  4QBM A;  2I8N A;  4UYD A;  5A82 A;  4LRG A;  4Z1Q A;  3U5J A;  5DLZ A;  5CUA A;  3DWY A;  5CPE A;  4ZW1 A;  5CUB A;  4NUE A;  5L8T A;  5AMF A;  5HRV A;  5IBN A;  5EPR A;  5D25 A;  2F6J A;  4UIZ A;  5CQ7 A;  4LZS A; 
#chains in the Genus database with same CATH homology
 3O34 A;  5I83 A;  4YY4 A;  5CU8 A;  4QSP A;  5EWC A;  4PS5 A;  2L84 A;  2RS9 B;  3UV4 A;  5II2 A;  5CY9 A;  4YAT A;  4QEW A;  4ZC9 A;  4TT6 A;  4O78 A;  5DYU A;  4QYD A;  4IR3 A;  4NS5 A;  5F2P A;  5FE3 A;  5BT3 A;  5I89 A;  5HQ6 A;  5TCM A;  4MEP A;  3QZV A;  4QR4 A;  3UVW A;  5G4R A;  5F60 A;  5CGP A;  2E7N A;  5DW1 A;  2YEK A;  4HXM A;  5CFW A;  5EM3 A;  5CQA A;  2F6N A;  4NQN A;  4A9O A;  5E3D A;  4QSR A;  4YYH A;  4Z6H A;  3TLP A;  5C8G A;  4QSV A;  4O77 A;  3LJW A;  4TZ8 A;  4YBM A;  5HRX A;  5E9K A;  2E3K A;  3P5O A;  4KV1 A;  4XUA A;  2YYN A;  2YEM A;  4J3I A;  4LR6 A;  4A9J A;  2NXB A;  5AME A;  4YYK A;  4YBT A;  5EIC A;  4YYD A;  2D82 A;  2WP2 A;  5A85 A;  5D3H A;  3JVM A;  4ALH A;  2R0Y A;  4BJX A;  5DX4 A;  4YH4 A;  5DW2 A;  5DKD A;  4CUS A;  4QNS A;  3UVX A;  5F25 A;  5I86 A;  4A9N A;  5KU3 A;  3O37 A;  5E9M A;  5LVR A;  5EK9 A;  5CQ3 A;  5CUE A;  3UW9 A;  3P1F A;  5A5R A;  4N4F A;  4IOO A;  4QC1 A;  5C89 A;  5CUG A;  4HXR A;  3GG3 A;  5CQ6 A;  2R0V A;  5LVQ A;  5JI8 A;  5H85 A;  4UYF B;  3D7C A;  4BW1 A;  5HEN A;  2YQD A;  3G0L A;  4UYH A;  5I80 A;  4N4G A;  4YAD A;  4QSQ A;  4O75 A;  5E9I A;  3ZYU A;  4E96 A;  4NYV A;  3U5L A;  4YYJ A;  4HXS A;  4QY4 A;  5C85 A;  2RO1 A;  4HXP A;  5ENJ A;  5TB6 A;  3I3J A;  4IR4 A;  4ALG A;  4UYF A;  4MR6 A;  2N9G A;  5A5N A;  4YK0 A;  5JWM A;  5F63 A;  4BW2 A;  4UYE A;  4OUF A;  4MR3 A;  5F1L A;  3DAI A;  5FB1 A;  4N3W A;  5A5Q A;  3NXB A;  4TT2 A;  4QEV A;  5EGU A;  4QUU A;  4CUU A;  5DLX A;  3ONI A;  3MUL A;  3MXF A;  2RNY A;  5CRM A;  5FDZ A;  5BT5 A;  4UIX A;  4CL9 A;  4N4H A;  4A9M A;  5C7N A;  4O76 A;  3MUK A;  5FG6 A;  5L96 A;  5L98 A;  4AKN A;  4O7F A;  1JSP B;  5H1U A;  5CP5 A;  4O7C A;  5IGM A;  2RI7 A;  2FSA A;  4Z1S A;  4TS8 A;  2YW5 A;  4A9E A;  5FE6 A;  4NRA A;  3U5O A;  4MEO A;  4A9K A;  4PKL A;  2RNW A;  4A9L A;  5D3S A;  4TU4 A;  4QST A;  5I1Q A;  3G0J A;  4LYS A;  4O7E A;  2L5E A;  5DYC A;  4YC9 A;  4NRC A;  5DFB A;  4GPJ A;  2DVQ A;  3JVK A;  5I40 A;  5FBX A;  4CFL A;  5CUD A;  5HFQ A;  5E9V A;  4Y03 A;  4OGI A;  5KTX A;  5LKT A;  5AD2 A;  4UIW A;  2G4A A;  4YYG A;  4O72 A;  2E7O A;  3JVJ A;  3LQJ A;  3S91 A;  5HM0 A;  4NR8 A;  2R0S A;  4QZS A;  4IR6 A;  4BW4 A;  4TZ2 A;  4LYI A;  4PTB A;  4UIU A;  4YAB A;  5L99 A;  4QR3 A;  5FG5 A;  3HME A;  2YEL A;  5IG6 A;  5CQ4 A;  4IR5 A;  4DON A;  5FFV A;  5D3P A;  5I7X A;  5KTW A;  4C67 A;  5HQ7 A;  4PY6 A;  4Q0O A;  5K29 A;  3JVL A;  5ETD A;  3UVY A;  2RFJ A;  5E0R A;  5LJ1 A;  5EVA A;  3P1E A;  5AD3 A;  4Z93 A;  3SVH A;  5HQ5 A;  4NRB A;  4NR9 A;  2I7K A;  5II1 A;  4LDF A;  4YYM A;  2KTB B;  1JM4 B;  4QEU A;  5CZG A;  5ENH A;  3IU6 A;  2YDW A;  4LC2 A;  5E73 A;  5EPB A;  5H1V A;  4WHW A;  5A83 A;  5LJ2 A;  5LUU A;  5FFW A;  4O7A A;  5CQT A;  5HJC A;  5FH8 A;  4HXL A;  4J0R A;  2OUO A;  3QZS A;  4QYL A;  5HCL A;  3S92 A;  2D9E A;  5CUC A;  5ENF A;  2DVV A;  5FG4 A;  5IID A;  3UV5 A;  5HRW A;  2L85 A;  5FE5 A;  4NQM A;  1X0J A;  5FE0 A;  2LSP B;  4QSS A;  4KV4 A;  5ENC A;  4MR4 A;  4TQN A;  1ZS5 A;  4N4I A;  4NUD A;  4BHW A;  2WP1 A;  4NYX A;  5ENB A;  4HBY A;  5D3T A;  4YYN A;  5A5S A;  4TT4 A;  5D3N A;  5DY7 A;  4LZR A;  4NXJ A;  5KTU A;  4J1P A;  4O70 A;  4QB3 A;  5HEL A;  5EA1 A;  3O33 A;  5ENG A;  4IOR A;  4KCX A;  4UYG A;  2RNX A;  4OGJ A;  4MEN A;  2OSS A;  5E74 A;  4XUB A;  4HXN A;  5EV9 A;  5EU1 A;  3MB3 A;  4CLB A;  5ACY A;  4XY9 A;  5EI4 A;  4J0S A;  4Q0N A;  3FKM X;  4YY6 A;  4O74 A;  3SVF A;  5COI A;  5KHM A;  4TYL A;  5D0C A;  4YYI A;  5D3R A;  3SVG A;  5L8U A;  5HLS A;  4XYA A;  4A9F A;  4LYW A;  4TTE A;  4Z6I A;  5DYX A;  4NR4 A;  3UV2 A;  4C66 A;  4QSU A;  3U5N A;  4NYW A;  3Q2E A;  4PCI A;  5ENE A;  5EIS A;  4IOQ A;  5FE9 A;  4ZQL A;  4MEQ A;  2R10 A;  5IGN A;  5LKU A;  4FLP A;  5FFY A;  4X2I A;  1WUG A;  5FE7 A;  4HBX A;  4CFK A;  5D3J A;  5FH6 A;  5J0D A;  4NR7 A;  1E6I A;  5FH7 A;  5BT4 A;  4CUR A;  5H1T A;  4UIT A;  4CUQ A;  5C87 A;  3IU5 A;  5LKZ A;  4UIY A;  4A9I A;  5I7Y A;  5DYA A;  4HBW A;  2DWW A;  5CS8 A;  4A9H A;  5CQ5 A;  4YBS A;  3P1D A;  3RCW A;  5D7X A;  5DKH A;  4HXK A;  4NR6 A;  4QSX A;  2DVS A;  4O71 A;  4LZ2 A;  3MQM A;  5I88 A;  1WUM A;  4WHU A;  3U5K A;  5C4Q A;  5ENI A;  5D24 A;  3QZT A;  4QC3 A;  5ETB A;  5EWH A;  5E3G A;  5F5Z A;  5E9Y A;  5CRZ A;  5E9L A;  5EWD A;  3AAD A;  5IGL A;  3MB4 A;  3U5P A;  4CUT A;  4YH3 A;  4QSW A;  2DVR A;  4XY8 A;  4CUP A;  5IGK A;  5HEM A;  5CTL A;  5HFR A;  5FE4 A;  5A5P A;  4HXO A;  2OO1 A;  4QR5 A;  5D3L A;  3O35 A;  5EWW A;  3HMF A;  5A81 A;  5L97 A;  5EWV A;  3K2J A;  3HMH A;  3U5M A;  5LKX A;  5G4S A;  2MJV B;  4YAX A;  3LXJ A;  3UVD A;  4F3I A;  5DFD A;  5EQ1 A;  5FE1 A;  5EP7 A;  5FE2 A;  2GRC A;  5LJ0 A;  4NR5 A;  5EPS A;  5E7D A;  1N72 A;  5KO4 A;  5F62 A;  5F61 A;  5FB0 A;  4UIV A;  4PCE A;  5DBM A;  4WIV A;  2DAT A;  3P1C A;  5F3A A;  5F36 A;  3AQA A;  5F1H A;  3O36 A;  1EQF A;  5A5O A;  4BW3 A;  5I29 A;  3Q2F A;  4QUT A;  4TU6 A;  3LQI A;  5FE8 A;  1F68 A;  5CQ8 A;  4HBV A;  2H60 A;  4MR5 A;  2DKW A;  5DFC A;  4NUC A;  5DKC A;  4RVR A;  3LQH A;  5D26 A;  4O7B A;  5A7C A;  4QBM A;  2I8N A;  4UYD A;  5A82 A;  4LRG A;  4Z1Q A;  3U5J A;  5DLZ A;  5CUA A;  3DWY A;  5CPE A;  4ZW1 A;  5CUB A;  4NUE A;  5L8T A;  5AMF A;  5HRV A;  5IBN A;  5EPR A;  5D25 A;  2F6J A;  4UIZ A;  5CQ7 A;  4LZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...