3S91A

Crystal structure of the first bromodomain of human brd3 in complex with the inhibitor jq1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
TNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 3
publication title Crystal Structure of the first bromodomain of human BRD3 in complex with the inhibitor JQ1
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3s91A01
4MR4A 4LDFA 1EQFA 4QSTA 4O7FA 5F1LA 2L84A 4YYNA 4IR5A 5BT3A 5D3JA 5C7NA 4ALHA 5H1TA 1JSPB 4QEUA 5DFBA 5E9MA 4IR4A 4NR4A 5E9VA 4YYKA 4MENA 3U5NA 3P1DA 5E7DA 4MEOA 2DVRA 4TYLA 5LKTA 4NRAA 4J1PA 3NXBA 5FE3A 3G0LA 4QNSA 5E74A 4NR8A 4OUFA 5EICA 4O72A 3DWYA 5KO4A 5CTLA 4NQMA 5FH7A 4NXJA 4QZSA 3UV5A 5ACYA 4HBVA 4YK0A 4N4HA 5IGKA 5F1HA 5FE4A 3RCWA 4CFLA 5C87A 4MR5A 4C66A 5JWMA 2YYNA 5II2A 2R0YA 5ENBA 4BHWA 3UVWA 4YYHA 5EVAA 4LYIA 4O7EA 5ENJA 5F3AA 5E9YA 5H1UA 5F60A 5CQ8A 5E0RA 3LQHA 2WP2A 5HM0A 5D3PA 3U5MA 5CRZA 4PS5A 5EWWA 4LR6A 4BW3A 2L85A 5C4QA 4A9LA 3G0JA 5CPEA 5AMEA 3LQIA 3QZVA 5KTXA 5DLZA 5FFVA 2YELA 2RO1A 4A9OA 3MQMA 4ALGA 5I80A 4UIYA 4O7BA 4IOOA 2E7NA 4TQNA 3O33A 4UIWA 4Y03A 4UITA 5ENFA 4HBWA 2YDWA 5D24A 4YC9A 5A85A 4A9HA 4QSWA 2RNWA 4TZ2A 5DFCA 2RNXA 2I8NA 4UYEA 5CUGA 2OUOA 3JVJA 5ETBA 5DKCA 5CZGA 5LKXA 5FG6A 3P1CA 4O70A 5DY7A 5I29A 4CUPA 4GPJA 3TLPA 4RVRA 5I89A 5FFYA 4A9NA 4O75A 5DW1A 5CGPA 1WUMA 5CFWA 5EWCA 5DLXA 4HXMA 5CP5A 4QSUA 4NUDA 2MJVB 5FB1A 4MEQA 5FE9A 4TT4A 5CRMA 5A5NA 4TT6A 4LZ2A 5CUAA 5HELA 5DYCA 5A83A 5D3NA 4HXSA 4KV4A 4O77A 5FG4A 5FE6A 3Q2EA 4F3IA 3I3JA 5F62A 5J0DA 5D26A 4XUAA 5HCLA 4HXLA 4BW2A 3HMFA 2E7OA 5TCMA 5IGMA 5JI8A 3LQJA 2F6JA 4QYDA 5A5SA 5CUDA 5F5ZA 3SVHA 3FKMX 4YY4A 2NXBA 5TB6A 4BJXA 2RI7A 5EGUA 3HMEA 4BW4A 5L99A 4CUQA 4HBXA 5CQ7A 2G4AA 5CQAA 5CQ6A 5EPRA 5EA1A 2YEMA 5H85A 1N72A 5L98A 4HXPA 4NYWA 4NR9A 4QYLA 2D9EA 5CQTA 5EP7A 4QC3A 1WUGA 3LXJA 4MEPA 5A5OA 5DYAA 5I40A 3UVYA 4O7AA 5BT5A 5EQ1A 4O78A 5CQ5A 5AD3A 4YYGA 5ENHA 3JVKA 5I1QA 5ENGA 4QSVA 4CURA 5FH6A 3GG3A 5FE7A 4A9MA 5HEMA 5D25A 3U5LA 3UVXA 5I7YA 4LRGA 5D3SA 4Q0NA 4NRCA 4OGIA 5EWHA 4Z6IA 5HQ5A 4YH3A 4WHWA 5D3RA 4HBYA 2YQDA 5DYXA 4YBMA 3LJWA 4QR4A 4NYVA 5HJCA 4J3IA 3S92A 4LZSA 2WP1A 5EWVA 4QUUA 4O76A 4LYWA 4YADA 2DVQA 5A5PA 5D0CA 5E9IA 5K29A 2DWWA 5I83A 3JVLA 2DATA 2F6NA 4TU6A 5G4SA 3U5OA 4NRBA 3O34A 5DKHA 5A81A 4N3WA 4TT2A 3ZYUA 5IIDA 5LVRA 4O71A 4Q0OA 5EPBA 4YYJA 3D7CA 4QUTA 4Z6HA 5C85A 5L96A 4IR6A 4J0RA 3DAIA 4A9IA 5CS8A 5AD2A 2LSPB 3MXFA 5HFRA 5A7CA 4QSXA 5FFWA 4N4FA 4WIVA 4LC2A 5E3DA 4KV1A 5AMFA 4XYAA 3QZTA 5D3HA 5F25A 4QSRA 1X0JA 3Q2FA 4TTEA 2RFJA 2DVSA 2KTBB 4NUCA 5HFQA 4CLBA 5I88A 4HXNA 4QC1A 5DKDA 5E9LA 4NR5A 5KTWA 5E9KA 3U5KA 5DFDA 4CL9A 2DKWA 4HXOA 4QEVA 5KTUA 3O35A 4OGJA 1JM4B 5LJ2A 4YY6A 4WHUA 4QY4A 4UIVA 4KCXA 4QSPA 5EPSA 4QBMA 4XY8A 5F2PA 5COIA 5D3LA 5FDZA 4UYFB 3S91A 4YYIA 4A9JA 4PTBA 5CUEA 2L5EA 5FB0A 4YABA 5C8GA 4UYDA 4ZW1A 5CQ4A 5LKZA 4FLPA 5H1VA 4UIZA 4HXKA 4LZRA 5DW2A 4ZQLA 5F63A 4YATA 4LYSA 3HMHA 5IGNA 5F36A 2N9GA 5FE2A 5ENEA 4YAXA 3O37A 5C89A 4IORA 3ONIA 5EISA 2R0VA 5CU8A 4CUSA 4HXRA 4X2IA 3AQAA 5HLSA 5D3TA 4UYFA 5D7XA 4QSQA 5HRWA 5A5RA 4UYHA 4IOQA 4QEWA 4TU4A 2OSSA 4QB3A 5CQ3A 2R10A 5FE8A 4TS8A 4CUTA 2YW5A 5DX4A 5CUCA 2H60A 4J0SA 4QR3A 5EWDA 5HQ7A 5FE5A 2YEKA 5L8UA 5II1A 2DVVA 4NYXA 5FE1A 5A82A 5L8TA 2RS9B 4NR6A 3U5JA 5IBNA 3JVMA 4PCIA 5DYUA 3SVGA 4PKLA 1E6IA 4XUBA 5EU1A 4Z1SA 5L97A 3MB4A 4YYMA 4N4IA 4DONA 4QSSA 5EV9A 5KU3A 4UYGA 2E3KA 4E96A 5LJ1A 5KHMA 5DBMA 4UIUA 4MR6A 4NUEA 5E3GA 5F61A 2GRCA 4NR7A 4UIXA 4BW1A 4YBSA 4N4GA 4A9EA 4TZ8A 5HQ6A 4PCEA 4A9FA 4PY6A 2RNYA 3UV2A 5IG6A 5FG5A 5A5QA 4Z1QA 5FE0A 5FBXA 5I86A 5BT4A 4YBTA 4YYDA 5CUBA 5ENIA 3K2JA 4C67A 5EM3A 3AADA 3U5PA 3MB3A 3QZSA 1ZS5A 3MUKA 3SVFA 5E73A 5G4RA 3UVDA 5IGLA 5LJ0A 3P1FA 4YH4A 2FSAA 2I7KA 3P5OA 4O7CA 4A9KA 3O36A 3UV4A 5I7XA 3UW9A 4MR3A 2OO1A 5HENA 3IU6A 4IR3A 5HRVA 4NQNA 4QR5A 5EI4A 5HRXA 5LVQA 5FH8A 5LUUA 2R0SA 4NS5A 5LKUA 4CUUA 4CFKA 4O74A 2D82A 3P1EA 3MULA 4XY9A 1F68A 5CY9A 4Z93A 4ZC9A 5ENCA 5ETDA 5EK9A 4AKNA 3IU5A
chains in the Genus database with same CATH superfamily
4MR4A 4LDFA 1EQFA 4QSTA 4O7FA 5F1LA 2L84A 4YYNA 4IR5A 5BT3A 5D3JA 5C7NA 4ALHA 5H1TA 1JSPB 4QEUA 5DFBA 5E9MA 4IR4A 4NR4A 5E9VA 4YYKA 4MENA 3U5NA 3P1DA 5E7DA 4MEOA 2DVRA 4TYLA 2EJNA 5LKTA 4NRAA 4J1PA 3NXBA 5FE3A 3G0LA 4QNSA 5E74A 4NR8A 4OUFA 5EICA 4O72A 3DWYA 5KO4A 5CTLA 4NQMA 5FH7A 4NXJA 4QZSA 3UV5A 5ACYA 4HBVA 4YK0A 4N4HA 5IGKA 5F1HA 5FE4A 3RCWA 4CFLA 5C87A 4MR5A 4C66A 3VKGA 5JWMA 2YYNA 5II2A 3VKHA 2R0YA 5ENBA 4BHWA 3UVWA 4YYHA 5EVAA 4LYIA 4O7EA 5ENJA 5F3AA 5E9YA 5H1UA 5F60A 5CQ8A 5E0RA 3LQHA 3D1DA 2WP2A 5HM0A 5D3PA 3U5MA 5CRZA 4PS5A 5EWWA 4LR6A 4BW3A 2L85A 5C4QA 4A9LA 3G0JA 5CPEA 5AMEA 3LQIA 3QZVA 5KTXA 5DLZA 5FFVA 2YELA 2RO1A 4A9OA 3MQMA 4ALGA 5I80A 4UIYA 4O7BA 4IOOA 2E7NA 4TQNA 3O33A 4UIWA 4Y03A 4UITA 5ENFA 4HBWA 2YDWA 5D24A 4YC9A 5A85A 4A9HA 4QSWA 2RNWA 4TZ2A 5DFCA 2RNXA 2I8NA 4UYEA 5CUGA 2OUOA 3JVJA 5ETBA 5DKCA 5CZGA 5LKXA 5FG6A 3P1CA 4O70A 5DY7A 5I29A 4CUPA 4GPJA 3TLPA 4RVRA 5I89A 5FFYA 4A9NA 4O75A 5DW1A 5CGPA 1WUMA 5CFWA 5EWCA 5DLXA 4HXMA 5CP5A 4QSUA 4NUDA 2MJVB 5FB1A 4MEQA 5FE9A 4TT4A 5CRMA 5A5NA 4TT6A 4LZ2A 5CUAA 5HELA 5DYCA 5A83A 5D3NA 4HXSA 4KV4A 4O77A 5FG4A 5FE6A 3Q2EA 4F3IA 3I3JA 5F62A 5J0DA 5D26A 4XUAA 5HCLA 4HXLA 4BW2A 3HMFA 2E7OA 5TCMA 5IGMA 5JI8A 3LQJA 2F6JA 4QYDA 5A5SA 5CUDA 5F5ZA 3SVHA 3FKMX 4YY4A 2NXBA 5TB6A 4BJXA 2RI7A 5EGUA 3HMEA 4BW4A 5L99A 4CUQA 4HBXA 5CQ7A 2G4AA 5CQAA 5CQ6A 5EPRA 5EA1A 2YEMA 5H85A 1N72A 5L98A 4HXPA 4NYWA 4NR9A 4QYLA 2D9EA 5CQTA 5EP7A 4QC3A 1WUGA 3LXJA 4MEPA 5A5OA 5DYAA 5I40A 3UVYA 4O7AA 5BT5A 5EQ1A 4O78A 5CQ5A 5AD3A 4YYGA 5ENHA 3JVKA 5I1QA 5ENGA 4QSVA 4CURA 5FH6A 3GG3A 5FE7A 4A9MA 4AKHA 5HEMA 5D25A 3U5LA 3UVXA 5I7YA 4LRGA 5D3SA 4Q0NA 4NRCA 4OGIA 5EWHA 4Z6IA 5HQ5A 4YH3A 4WHWA 5D3RA 4HBYA 2YQDA 5DYXA 4YBMA 3LJWA 4QR4A 4NYVA 5HJCA 4J3IA 3S92A 4LZSA 2WP1A 5EWVA 4QUUA 4O76A 4LYWA 4YADA 2DVQA 5A5PA 5D0CA 5E9IA 5K29A 2DWWA 5I83A 1PUOA 3JVLA 2DATA 2F6NA 4TU6A 5G4SA 3U5OA 4NRBA 3O34A 5DKHA 5A81A 4N3WA 4TT2A 3ZYUA 5IIDA 5LVRA 4O71A 4Q0OA 5EPBA 4YYJA 3D7CA 4QUTA 4Z6HA 5C85A 3D1BA 5L96A 4IR6A 4J0RA 4AKGA 4AI6A 3DAIA 4A9IA 5CS8A 5AD2A 2LSPB 3MXFA 5HFRA 5A7CA 4QSXA 5FFWA 4N4FA 4WIVA 4LC2A 5E3DA 4KV1A 5AMFA 4XYAA 3QZTA 5D3HA 5F25A 4QSRA 1X0JA 3Q2FA 4TTEA 2RFJA 2DVSA 2KTBB 4NUCA 5HFQA 4CLBA 5I88A 4HXNA 4QC1A 5DKDA 5E9LA 4NR5A 5KTWA 5E9KA 3U5KA 5DFDA 4CL9A 2DKWA 4HXOA 4QEVA 5KTUA 3O35A 4OGJA 1JM4B 5LJ2A 1ZKRA 4YY6A 4WHUA 4QY4A 4UIVA 4KCXA 4QSPA 5EPSA 4QBMA 4XY8A 5F2PA 5COIA 5D3LA 5FDZA 4UYFB 3S91A 4YYIA 4A9JA 4PTBA 5CUEA 2L5EA 5FB0A 4YABA 5C8GA 4UYDA 4ZW1A 5CQ4A 5LKZA 4FLPA 5H1VA 4UIZA 4HXKA 4LZRA 5DW2A 4ZQLA 5F63A 4YATA 4LYSA 3HMHA 5IGNA 5F36A 2N9GA 5FE2A 5ENEA 4YAXA 3O37A 5C89A 4IORA 3ONIA 5EISA 2R0VA 5CU8A 4CUSA 4HXRA 4X2IA 3AQAA 5HLSA 5D3TA 4UYFA 5D7XA 4QSQA 5HRWA 5A5RA 4UYHA 4IOQA 4QEWA 4TU4A 2OSSA 4QB3A 5CQ3A 2R10A 5FE8A 4TS8A 4CUTA 2YW5A 5DX4A 5CUCA 2H60A 4J0SA 4QR3A 5EWDA 5HQ7A 5FE5A 2YEKA 5L8UA 5II1A 2DVVA 4NYXA 5FE1A 5A82A 5L8TA 2RS9B 4NR6A 3U5JA 5IBNA 3JVMA 4PCIA 5DYUA 3SVGA 4PKLA 1E6IA 4XUBA 5EU1A 4Z1SA 5L97A 3MB4A 4YYMA 4N4IA 4DONA 4QSSA 5EV9A 5KU3A 4UYGA 2E3KA 4E96A 5LJ1A 5KHMA 5DBMA 4UIUA 4MR6A 4NUEA 5E3GA 5F61A 2GRCA 4NR7A 4UIXA 4BW1A 4YBSA 4N4GA 4A9EA 4TZ8A 5HQ6A 4PCEA 4A9FA 4PY6A 2RNYA 3UV2A 5IG6A 5FG5A 5A5QA 4Z1QA 5FE0A 5FBXA 5I86A 5BT4A 4YBTA 4YYDA 5CUBA 5ENIA 3K2JA 4C67A 5EM3A 3AADA 3U5PA 3MB3A 3QZSA 1ZS5A 3MUKA 3SVFA 5E73A 5G4RA 3UVDA 5IGLA 5LJ0A 3P1FA 4YH4A 2FSAA 2I7KA 3P5OA 4O7CA 4A9KA 3O36A 3UV4A 5I7XA 3UW9A 4MR3A 2OO1A 5HENA 3ERRA 3IU6A 4IR3A 5HRVA 4NQNA 4QR5A 5EI4A 5HRXA 5LVQA 5FH8A 5LUUA 2R0SA 4NS5A 5LKUA 4CUUA 4CFKA 4O74A 2D82A 3P1EA 3MULA 4XY9A 1F68A 5CY9A 4Z93A 4ZC9A 4AKIA 5ENCA 5ETDA 5EK9A 4AKNA 3IU5A
chains in the Genus database with same CATH topology
4MR4A 4LDFA 1EQFA 4QSTA 4O7FA 5F1LA 2L84A 4YYNA 4IR5A 5BT3A 5D3JA 5C7NA 4ALHA 5H1TA 1JSPB 4QEUA 5DFBA 5E9MA 4IR4A 4NR4A 5E9VA 4YYKA 4MENA 3U5NA 3P1DA 5E7DA 4MEOA 2DVRA 4TYLA 5LKTA 4NRAA 4J1PA 3NXBA 5FE3A 3G0LA 4QNSA 5E74A 4NR8A 4OUFA 5EICA 4O72A 3DWYA 5KO4A 5CTLA 4NQMA 5FH7A 4NXJA 4QZSA 3UV5A 5ACYA 4HBVA 4YK0A 4N4HA 5IGKA 5F1HA 5FE4A 3RCWA 4CFLA 5C87A 4MR5A 4C66A 5JWMA 2YYNA 5II2A 2R0YA 5ENBA 4BHWA 3UVWA 4YYHA 5EVAA 4LYIA 4O7EA 5ENJA 5F3AA 5E9YA 5H1UA 5F60A 5CQ8A 5E0RA 3LQHA 2WP2A 5HM0A 5D3PA 3U5MA 5CRZA 4PS5A 5EWWA 4LR6A 4BW3A 2L85A 5C4QA 4A9LA 3G0JA 5CPEA 5AMEA 3LQIA 3QZVA 5KTXA 5DLZA 5FFVA 2YELA 2RO1A 4A9OA 3MQMA 4ALGA 5I80A 4UIYA 4O7BA 4IOOA 2E7NA 4TQNA 3O33A 4UIWA 4Y03A 4UITA 5ENFA 4HBWA 2YDWA 5D24A 4YC9A 5A85A 4A9HA 4QSWA 2RNWA 4TZ2A 5DFCA 2RNXA 2I8NA 4UYEA 5CUGA 2OUOA 3JVJA 5ETBA 5DKCA 5CZGA 5LKXA 5FG6A 3P1CA 4O70A 5DY7A 5I29A 4CUPA 4GPJA 3TLPA 4RVRA 5I89A 5FFYA 4A9NA 4O75A 5DW1A 5CGPA 1WUMA 5CFWA 5EWCA 5DLXA 4HXMA 5CP5A 4QSUA 4NUDA 2MJVB 5FB1A 4MEQA 5FE9A 4TT4A 5CRMA 5A5NA 4TT6A 4LZ2A 5CUAA 5HELA 5DYCA 5A83A 5D3NA 4HXSA 4KV4A 4O77A 5FG4A 5FE6A 3Q2EA 4F3IA 3I3JA 5F62A 5J0DA 5D26A 4XUAA 5HCLA 4HXLA 4BW2A 3HMFA 2E7OA 5TCMA 5IGMA 5JI8A 3LQJA 2F6JA 4QYDA 5A5SA 5CUDA 5F5ZA 3SVHA 3FKMX 4YY4A 2NXBA 5TB6A 4BJXA 2RI7A 5EGUA 3HMEA 4BW4A 5L99A 4CUQA 4HBXA 5CQ7A 2G4AA 5CQAA 5CQ6A 5EPRA 5EA1A 2YEMA 5H85A 1N72A 5L98A 4HXPA 4NYWA 4NR9A 4QYLA 2D9EA 5CQTA 5EP7A 4QC3A 1WUGA 3LXJA 4MEPA 5A5OA 5DYAA 5I40A 3UVYA 4O7AA 5BT5A 5EQ1A 4O78A 5CQ5A 5AD3A 4YYGA 5ENHA 3JVKA 5I1QA 5ENGA 4QSVA 4CURA 5FH6A 3GG3A 5FE7A 4A9MA 5HEMA 5D25A 3U5LA 3UVXA 5I7YA 4LRGA 5D3SA 4Q0NA 4NRCA 4OGIA 5EWHA 4Z6IA 5HQ5A 4YH3A 4WHWA 5D3RA 4HBYA 2YQDA 5DYXA 4YBMA 3LJWA 4QR4A 4NYVA 5HJCA 4J3IA 3S92A 4LZSA 2WP1A 5EWVA 4QUUA 4O76A 4LYWA 4YADA 2DVQA 5A5PA 5D0CA 5E9IA 5K29A 2DWWA 5I83A 3JVLA 2DATA 2F6NA 4TU6A 5G4SA 3U5OA 4NRBA 3O34A 5DKHA 5A81A 4N3WA 4TT2A 3ZYUA 5IIDA 5LVRA 4O71A 4Q0OA 5EPBA 4YYJA 3D7CA 4QUTA 4Z6HA 5C85A 5L96A 4IR6A 4J0RA 3DAIA 4A9IA 5CS8A 5AD2A 2LSPB 3MXFA 5HFRA 5A7CA 4QSXA 5FFWA 4N4FA 4WIVA 4LC2A 5E3DA 4KV1A 5AMFA 4XYAA 3QZTA 5D3HA 5F25A 4QSRA 1X0JA 3Q2FA 4TTEA 2RFJA 2DVSA 2KTBB 4NUCA 5HFQA 4CLBA 5I88A 4HXNA 4QC1A 5DKDA 5E9LA 4NR5A 5KTWA 5E9KA 3U5KA 5DFDA 4CL9A 2DKWA 4HXOA 4QEVA 5KTUA 3O35A 4OGJA 1JM4B 5LJ2A 4YY6A 4WHUA 4QY4A 4UIVA 4KCXA 4QSPA 5EPSA 4QBMA 4XY8A 5F2PA 5COIA 5D3LA 5FDZA 4UYFB 3S91A 4YYIA 4A9JA 4PTBA 5CUEA 2L5EA 5FB0A 4YABA 5C8GA 4UYDA 4ZW1A 5CQ4A 5LKZA 4FLPA 5H1VA 4UIZA 4HXKA 4LZRA 5DW2A 4ZQLA 5F63A 4YATA 4LYSA 3HMHA 5IGNA 5F36A 2N9GA 5FE2A 5ENEA 4YAXA 3O37A 5C89A 4IORA 3ONIA 5EISA 2R0VA 5CU8A 4CUSA 4HXRA 4X2IA 3AQAA 5HLSA 5D3TA 4UYFA 5D7XA 4QSQA 5HRWA 5A5RA 4UYHA 4IOQA 4QEWA 4TU4A 2OSSA 4QB3A 5CQ3A 2R10A 5FE8A 4TS8A 4CUTA 2YW5A 5DX4A 5CUCA 2H60A 4J0SA 4QR3A 5EWDA 5HQ7A 5FE5A 2YEKA 5L8UA 5II1A 2DVVA 4NYXA 5FE1A 5A82A 5L8TA 2RS9B 4NR6A 3U5JA 5IBNA 3JVMA 4PCIA 5DYUA 3SVGA 4PKLA 1E6IA 4XUBA 5EU1A 4Z1SA 5L97A 3MB4A 4YYMA 4N4IA 4DONA 4QSSA 5EV9A 5KU3A 4UYGA 2E3KA 4E96A 5LJ1A 5KHMA 5DBMA 4UIUA 4MR6A 4NUEA 5E3GA 5F61A 2GRCA 4NR7A 4UIXA 4BW1A 4YBSA 4N4GA 4A9EA 4TZ8A 5HQ6A 4PCEA 4A9FA 4PY6A 2RNYA 3UV2A 5IG6A 5FG5A 5A5QA 4Z1QA 5FE0A 5FBXA 5I86A 5BT4A 4YBTA 4YYDA 5CUBA 5ENIA 3K2JA 4C67A 5EM3A 3AADA 3U5PA 3MB3A 3QZSA 1ZS5A 3MUKA 3SVFA 5E73A 5G4RA 3UVDA 5IGLA 5LJ0A 3P1FA 4YH4A 2FSAA 2I7KA 3P5OA 4O7CA 4A9KA 3O36A 3UV4A 5I7XA 3UW9A 4MR3A 2OO1A 5HENA 3IU6A 4IR3A 5HRVA 4NQNA 4QR5A 5EI4A 5HRXA 5LVQA 5FH8A 5LUUA 2R0SA 4NS5A 5LKUA 4CUUA 4CFKA 4O74A 2D82A 3P1EA 3MULA 4XY9A 1F68A 5CY9A 4Z93A 4ZC9A 5ENCA 5ETDA 5EK9A 4AKNA 3IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR4 A;  4LDF A;  1EQF A;  4QST A;  4O7F A;  5F1L A;  2L84 A;  4YYN A;  4IR5 A;  5BT3 A;  5D3J A;  5C7N A;  4ALH A;  5H1T A;  1JSP B;  4QEU A;  5DFB A;  5E9M A;  4IR4 A;  4NR4 A;  5E9V A;  4YYK A;  4MEN A;  3U5N A;  3P1D A;  5E7D A;  4MEO A;  2DVR A;  4TYL A;  5LKT A;  4NRA A;  4J1P A;  3NXB A;  5FE3 A;  3G0L A;  4QNS A;  5E74 A;  4NR8 A;  4OUF A;  5EIC A;  4O72 A;  3DWY A;  5KO4 A;  5CTL A;  4NQM A;  5FH7 A;  4NXJ A;  4QZS A;  3UV5 A;  5ACY A;  4HBV A;  4YK0 A;  4N4H A;  5IGK A;  5F1H A;  5FE4 A;  3RCW A;  4CFL A;  5C87 A;  4MR5 A;  4C66 A;  5JWM A;  2YYN A;  5II2 A;  2R0Y A;  5ENB A;  4BHW A;  3UVW A;  4YYH A;  5EVA A;  4LYI A;  4O7E A;  5ENJ A;  5F3A A;  5E9Y A;  5H1U A;  5F60 A;  5CQ8 A;  5E0R A;  3LQH A;  2WP2 A;  5HM0 A;  5D3P A;  3U5M A;  5CRZ A;  4PS5 A;  5EWW A;  4LR6 A;  4BW3 A;  2L85 A;  5C4Q A;  4A9L A;  3G0J A;  5CPE A;  5AME A;  3LQI A;  3QZV A;  5KTX A;  5DLZ A;  5FFV A;  2YEL A;  2RO1 A;  4A9O A;  3MQM A;  4ALG A;  5I80 A;  4UIY A;  4O7B A;  4IOO A;  2E7N A;  4TQN A;  3O33 A;  4UIW A;  4Y03 A;  4UIT A;  5ENF A;  4HBW A;  2YDW A;  5D24 A;  4YC9 A;  5A85 A;  4A9H A;  4QSW A;  2RNW A;  4TZ2 A;  5DFC A;  2RNX A;  2I8N A;  4UYE A;  5CUG A;  2OUO A;  3JVJ A;  5ETB A;  5DKC A;  5CZG A;  5LKX A;  5FG6 A;  3P1C A;  4O70 A;  5DY7 A;  5I29 A;  4CUP A;  4GPJ A;  3TLP A;  4RVR A;  5I89 A;  5FFY A;  4A9N A;  4O75 A;  5DW1 A;  5CGP A;  1WUM A;  5CFW A;  5EWC A;  5DLX A;  4HXM A;  5CP5 A;  4QSU A;  4NUD A;  2MJV B;  5FB1 A;  4MEQ A;  5FE9 A;  4TT4 A;  5CRM A;  5A5N A;  4TT6 A;  4LZ2 A;  5CUA A;  5HEL A;  5DYC A;  5A83 A;  5D3N A;  4HXS A;  4KV4 A;  4O77 A;  5FG4 A;  5FE6 A;  3Q2E A;  4F3I A;  3I3J A;  5F62 A;  5J0D A;  5D26 A;  4XUA A;  5HCL A;  4HXL A;  4BW2 A;  3HMF A;  2E7O A;  5TCM A;  5IGM A;  5JI8 A;  3LQJ A;  2F6J A;  4QYD A;  5A5S A;  5CUD A;  5F5Z A;  3SVH A;  3FKM X;  4YY4 A;  2NXB A;  5TB6 A;  4BJX A;  2RI7 A;  5EGU A;  3HME A;  4BW4 A;  5L99 A;  4CUQ A;  4HBX A;  5CQ7 A;  2G4A A;  5CQA A;  5CQ6 A;  5EPR A;  5EA1 A;  2YEM A;  5H85 A;  1N72 A;  5L98 A;  4HXP A;  4NYW A;  4NR9 A;  4QYL A;  2D9E A;  5CQT A;  5EP7 A;  4QC3 A;  1WUG A;  3LXJ A;  4MEP A;  5A5O A;  5DYA A;  5I40 A;  3UVY A;  4O7A A;  5BT5 A;  5EQ1 A;  4O78 A;  5CQ5 A;  5AD3 A;  4YYG A;  5ENH A;  3JVK A;  5I1Q A;  5ENG A;  4QSV A;  4CUR A;  5FH6 A;  3GG3 A;  5FE7 A;  4A9M A;  5HEM A;  5D25 A;  3U5L A;  3UVX A;  5I7Y A;  4LRG A;  5D3S A;  4Q0N A;  4NRC A;  4OGI A;  5EWH A;  4Z6I A;  5HQ5 A;  4YH3 A;  4WHW A;  5D3R A;  4HBY A;  2YQD A;  5DYX A;  4YBM A;  3LJW A;  4QR4 A;  4NYV A;  5HJC A;  4J3I A;  3S92 A;  4LZS A;  2WP1 A;  5EWV A;  4QUU A;  4O76 A;  4LYW A;  4YAD A;  2DVQ A;  5A5P A;  5D0C A;  5E9I A;  5K29 A;  2DWW A;  5I83 A;  3JVL A;  2DAT A;  2F6N A;  4TU6 A;  5G4S A;  3U5O A;  4NRB A;  3O34 A;  5DKH A;  5A81 A;  4N3W A;  4TT2 A;  3ZYU A;  5IID A;  5LVR A;  4O71 A;  4Q0O A;  5EPB A;  4YYJ A;  3D7C A;  4QUT A;  4Z6H A;  5C85 A;  5L96 A;  4IR6 A;  4J0R A;  3DAI A;  4A9I A;  5CS8 A;  5AD2 A;  2LSP B;  3MXF A;  5HFR A;  5A7C A;  4QSX A;  5FFW A;  4N4F A;  4WIV A;  4LC2 A;  5E3D A;  4KV1 A;  5AMF A;  4XYA A;  3QZT A;  5D3H A;  5F25 A;  4QSR A;  1X0J A;  3Q2F A;  4TTE A;  2RFJ A;  2DVS A;  2KTB B;  4NUC A;  5HFQ A;  4CLB A;  5I88 A;  4HXN A;  4QC1 A;  5DKD A;  5E9L A;  4NR5 A;  5KTW A;  5E9K A;  3U5K A;  5DFD A;  4CL9 A;  2DKW A;  4HXO A;  4QEV A;  5KTU A;  3O35 A;  4OGJ A;  1JM4 B;  5LJ2 A;  4YY6 A;  4WHU A;  4QY4 A;  4UIV A;  4KCX A;  4QSP A;  5EPS A;  4QBM A;  4XY8 A;  5F2P A;  5COI A;  5D3L A;  5FDZ A;  4UYF B;  3S91 A;  4YYI A;  4A9J A;  4PTB A;  5CUE A;  2L5E A;  5FB0 A;  4YAB A;  5C8G A;  4UYD A;  4ZW1 A;  5CQ4 A;  5LKZ A;  4FLP A;  5H1V A;  4UIZ A;  4HXK A;  4LZR A;  5DW2 A;  4ZQL A;  5F63 A;  4YAT A;  4LYS A;  3HMH A;  5IGN A;  5F36 A;  2N9G A;  5FE2 A;  5ENE A;  4YAX A;  3O37 A;  5C89 A;  4IOR A;  3ONI A;  5EIS A;  2R0V A;  5CU8 A;  4CUS A;  4HXR A;  4X2I A;  3AQA A;  5HLS A;  5D3T A;  4UYF A;  5D7X A;  4QSQ A;  5HRW A;  5A5R A;  4UYH A;  4IOQ A;  4QEW A;  4TU4 A;  2OSS A;  4QB3 A;  5CQ3 A;  2R10 A;  5FE8 A;  4TS8 A;  4CUT A;  2YW5 A;  5DX4 A;  5CUC A;  2H60 A;  4J0S A;  4QR3 A;  5EWD A;  5HQ7 A;  5FE5 A;  2YEK A;  5L8U A;  5II1 A;  2DVV A;  4NYX A;  5FE1 A;  5A82 A;  5L8T A;  2RS9 B;  4NR6 A;  3U5J A;  5IBN A;  3JVM A;  4PCI A;  5DYU A;  3SVG A;  4PKL A;  1E6I A;  4XUB A;  5EU1 A;  4Z1S A;  5L97 A;  3MB4 A;  4YYM A;  4N4I A;  4DON A;  4QSS A;  5EV9 A;  5KU3 A;  4UYG A;  2E3K A;  4E96 A;  5LJ1 A;  5KHM A;  5DBM A;  4UIU A;  4MR6 A;  4NUE A;  5E3G A;  5F61 A;  2GRC A;  4NR7 A;  4UIX A;  4BW1 A;  4YBS A;  4N4G A;  4A9E A;  4TZ8 A;  5HQ6 A;  4PCE A;  4A9F A;  4PY6 A;  2RNY A;  3UV2 A;  5IG6 A;  5FG5 A;  5A5Q A;  4Z1Q A;  5FE0 A;  5FBX A;  5I86 A;  5BT4 A;  4YBT A;  4YYD A;  5CUB A;  5ENI A;  3K2J A;  4C67 A;  5EM3 A;  3AAD A;  3U5P A;  3MB3 A;  3QZS A;  1ZS5 A;  3MUK A;  3SVF A;  5E73 A;  5G4R A;  3UVD A;  5IGL A;  5LJ0 A;  3P1F A;  4YH4 A;  2FSA A;  2I7K A;  3P5O A;  4O7C A;  4A9K A;  3O36 A;  3UV4 A;  5I7X A;  3UW9 A;  4MR3 A;  2OO1 A;  5HEN A;  3IU6 A;  4IR3 A;  5HRV A;  4NQN A;  4QR5 A;  5EI4 A;  5HRX A;  5LVQ A;  5FH8 A;  5LUU A;  2R0S A;  4NS5 A;  5LKU A;  4CUU A;  4CFK A;  4O74 A;  2D82 A;  3P1E A;  3MUL A;  4XY9 A;  1F68 A;  5CY9 A;  4Z93 A;  4ZC9 A;  5ENC A;  5ETD A;  5EK9 A;  4AKN A;  3IU5 A; 
#chains in the Genus database with same CATH topology
 4MR4 A;  4LDF A;  1EQF A;  4QST A;  4O7F A;  5F1L A;  2L84 A;  4YYN A;  4IR5 A;  5BT3 A;  5D3J A;  5C7N A;  4ALH A;  5H1T A;  1JSP B;  4QEU A;  5DFB A;  5E9M A;  4IR4 A;  4NR4 A;  5E9V A;  4YYK A;  4MEN A;  3U5N A;  3P1D A;  5E7D A;  4MEO A;  2DVR A;  4TYL A;  2EJN A;  5LKT A;  4NRA A;  4J1P A;  3NXB A;  5FE3 A;  3G0L A;  4QNS A;  5E74 A;  4NR8 A;  4OUF A;  5EIC A;  4O72 A;  3DWY A;  5KO4 A;  5CTL A;  4NQM A;  5FH7 A;  4NXJ A;  4QZS A;  3UV5 A;  5ACY A;  4HBV A;  4YK0 A;  4N4H A;  5IGK A;  5F1H A;  5FE4 A;  3RCW A;  4CFL A;  5C87 A;  4MR5 A;  4C66 A;  3VKG A;  5JWM A;  2YYN A;  5II2 A;  3VKH A;  2R0Y A;  5ENB A;  4BHW A;  3UVW A;  4YYH A;  5EVA A;  4LYI A;  4O7E A;  5ENJ A;  5F3A A;  5E9Y A;  5H1U A;  5F60 A;  5CQ8 A;  5E0R A;  3LQH A;  3D1D A;  2WP2 A;  5HM0 A;  5D3P A;  3U5M A;  5CRZ A;  4PS5 A;  5EWW A;  4LR6 A;  4BW3 A;  2L85 A;  5C4Q A;  4A9L A;  3G0J A;  5CPE A;  5AME A;  3LQI A;  3QZV A;  5KTX A;  5DLZ A;  5FFV A;  2YEL A;  2RO1 A;  4A9O A;  3MQM A;  4ALG A;  5I80 A;  4UIY A;  4O7B A;  4IOO A;  2E7N A;  4TQN A;  3O33 A;  4UIW A;  4Y03 A;  4UIT A;  5ENF A;  4HBW A;  2YDW A;  5D24 A;  4YC9 A;  5A85 A;  4A9H A;  4QSW A;  2RNW A;  4TZ2 A;  5DFC A;  2RNX A;  2I8N A;  4UYE A;  5CUG A;  2OUO A;  3JVJ A;  5ETB A;  5DKC A;  5CZG A;  5LKX A;  5FG6 A;  3P1C A;  4O70 A;  5DY7 A;  5I29 A;  4CUP A;  4GPJ A;  3TLP A;  4RVR A;  5I89 A;  5FFY A;  4A9N A;  4O75 A;  5DW1 A;  5CGP A;  1WUM A;  5CFW A;  5EWC A;  5DLX A;  4HXM A;  5CP5 A;  4QSU A;  4NUD A;  2MJV B;  5FB1 A;  4MEQ A;  5FE9 A;  4TT4 A;  5CRM A;  5A5N A;  4TT6 A;  4LZ2 A;  5CUA A;  5HEL A;  5DYC A;  5A83 A;  5D3N A;  4HXS A;  4KV4 A;  4O77 A;  5FG4 A;  5FE6 A;  3Q2E A;  4F3I A;  3I3J A;  5F62 A;  5J0D A;  5D26 A;  4XUA A;  5HCL A;  4HXL A;  4BW2 A;  3HMF A;  2E7O A;  5TCM A;  5IGM A;  5JI8 A;  3LQJ A;  2F6J A;  4QYD A;  5A5S A;  5CUD A;  5F5Z A;  3SVH A;  3FKM X;  4YY4 A;  2NXB A;  5TB6 A;  4BJX A;  2RI7 A;  5EGU A;  3HME A;  4BW4 A;  5L99 A;  4CUQ A;  4HBX A;  5CQ7 A;  2G4A A;  5CQA A;  5CQ6 A;  5EPR A;  5EA1 A;  2YEM A;  5H85 A;  1N72 A;  5L98 A;  4HXP A;  4NYW A;  4NR9 A;  4QYL A;  2D9E A;  5CQT A;  5EP7 A;  4QC3 A;  1WUG A;  3LXJ A;  4MEP A;  5A5O A;  5DYA A;  5I40 A;  3UVY A;  4O7A A;  5BT5 A;  5EQ1 A;  4O78 A;  5CQ5 A;  5AD3 A;  4YYG A;  5ENH A;  3JVK A;  5I1Q A;  5ENG A;  4QSV A;  4CUR A;  5FH6 A;  3GG3 A;  5FE7 A;  4A9M A;  4AKH A;  5HEM A;  5D25 A;  3U5L A;  3UVX A;  5I7Y A;  4LRG A;  5D3S A;  4Q0N A;  4NRC A;  4OGI A;  5EWH A;  4Z6I A;  5HQ5 A;  4YH3 A;  4WHW A;  5D3R A;  4HBY A;  2YQD A;  5DYX A;  4YBM A;  3LJW A;  4QR4 A;  4NYV A;  5HJC A;  4J3I A;  3S92 A;  4LZS A;  2WP1 A;  5EWV A;  4QUU A;  4O76 A;  4LYW A;  4YAD A;  2DVQ A;  5A5P A;  5D0C A;  5E9I A;  5K29 A;  2DWW A;  5I83 A;  1PUO A;  3JVL A;  2DAT A;  2F6N A;  4TU6 A;  5G4S A;  3U5O A;  4NRB A;  3O34 A;  5DKH A;  5A81 A;  4N3W A;  4TT2 A;  3ZYU A;  5IID A;  5LVR A;  4O71 A;  4Q0O A;  5EPB A;  4YYJ A;  3D7C A;  4QUT A;  4Z6H A;  5C85 A;  3D1B A;  5L96 A;  4IR6 A;  4J0R A;  4AKG A;  4AI6 A;  3DAI A;  4A9I A;  5CS8 A;  5AD2 A;  2LSP B;  3MXF A;  5HFR A;  5A7C A;  4QSX A;  5FFW A;  4N4F A;  4WIV A;  4LC2 A;  5E3D A;  4KV1 A;  5AMF A;  4XYA A;  3QZT A;  5D3H A;  5F25 A;  4QSR A;  1X0J A;  3Q2F A;  4TTE A;  2RFJ A;  2DVS A;  2KTB B;  4NUC A;  5HFQ A;  4CLB A;  5I88 A;  4HXN A;  4QC1 A;  5DKD A;  5E9L A;  4NR5 A;  5KTW A;  5E9K A;  3U5K A;  5DFD A;  4CL9 A;  2DKW A;  4HXO A;  4QEV A;  5KTU A;  3O35 A;  4OGJ A;  1JM4 B;  5LJ2 A;  1ZKR A;  4YY6 A;  4WHU A;  4QY4 A;  4UIV A;  4KCX A;  4QSP A;  5EPS A;  4QBM A;  4XY8 A;  5F2P A;  5COI A;  5D3L A;  5FDZ A;  4UYF B;  3S91 A;  4YYI A;  4A9J A;  4PTB A;  5CUE A;  2L5E A;  5FB0 A;  4YAB A;  5C8G A;  4UYD A;  4ZW1 A;  5CQ4 A;  5LKZ A;  4FLP A;  5H1V A;  4UIZ A;  4HXK A;  4LZR A;  5DW2 A;  4ZQL A;  5F63 A;  4YAT A;  4LYS A;  3HMH A;  5IGN A;  5F36 A;  2N9G A;  5FE2 A;  5ENE A;  4YAX A;  3O37 A;  5C89 A;  4IOR A;  3ONI A;  5EIS A;  2R0V A;  5CU8 A;  4CUS A;  4HXR A;  4X2I A;  3AQA A;  5HLS A;  5D3T A;  4UYF A;  5D7X A;  4QSQ A;  5HRW A;  5A5R A;  4UYH A;  4IOQ A;  4QEW A;  4TU4 A;  2OSS A;  4QB3 A;  5CQ3 A;  2R10 A;  5FE8 A;  4TS8 A;  4CUT A;  2YW5 A;  5DX4 A;  5CUC A;  2H60 A;  4J0S A;  4QR3 A;  5EWD A;  5HQ7 A;  5FE5 A;  2YEK A;  5L8U A;  5II1 A;  2DVV A;  4NYX A;  5FE1 A;  5A82 A;  5L8T A;  2RS9 B;  4NR6 A;  3U5J A;  5IBN A;  3JVM A;  4PCI A;  5DYU A;  3SVG A;  4PKL A;  1E6I A;  4XUB A;  5EU1 A;  4Z1S A;  5L97 A;  3MB4 A;  4YYM A;  4N4I A;  4DON A;  4QSS A;  5EV9 A;  5KU3 A;  4UYG A;  2E3K A;  4E96 A;  5LJ1 A;  5KHM A;  5DBM A;  4UIU A;  4MR6 A;  4NUE A;  5E3G A;  5F61 A;  2GRC A;  4NR7 A;  4UIX A;  4BW1 A;  4YBS A;  4N4G A;  4A9E A;  4TZ8 A;  5HQ6 A;  4PCE A;  4A9F A;  4PY6 A;  2RNY A;  3UV2 A;  5IG6 A;  5FG5 A;  5A5Q A;  4Z1Q A;  5FE0 A;  5FBX A;  5I86 A;  5BT4 A;  4YBT A;  4YYD A;  5CUB A;  5ENI A;  3K2J A;  4C67 A;  5EM3 A;  3AAD A;  3U5P A;  3MB3 A;  3QZS A;  1ZS5 A;  3MUK A;  3SVF A;  5E73 A;  5G4R A;  3UVD A;  5IGL A;  5LJ0 A;  3P1F A;  4YH4 A;  2FSA A;  2I7K A;  3P5O A;  4O7C A;  4A9K A;  3O36 A;  3UV4 A;  5I7X A;  3UW9 A;  4MR3 A;  2OO1 A;  5HEN A;  3ERR A;  3IU6 A;  4IR3 A;  5HRV A;  4NQN A;  4QR5 A;  5EI4 A;  5HRX A;  5LVQ A;  5FH8 A;  5LUU A;  2R0S A;  4NS5 A;  5LKU A;  4CUU A;  4CFK A;  4O74 A;  2D82 A;  3P1E A;  3MUL A;  4XY9 A;  1F68 A;  5CY9 A;  4Z93 A;  4ZC9 A;  4AKI A;  5ENC A;  5ETD A;  5EK9 A;  4AKN A;  3IU5 A; 
#chains in the Genus database with same CATH homology
 4MR4 A;  4LDF A;  1EQF A;  4QST A;  4O7F A;  5F1L A;  2L84 A;  4YYN A;  4IR5 A;  5BT3 A;  5D3J A;  5C7N A;  4ALH A;  5H1T A;  1JSP B;  4QEU A;  5DFB A;  5E9M A;  4IR4 A;  4NR4 A;  5E9V A;  4YYK A;  4MEN A;  3U5N A;  3P1D A;  5E7D A;  4MEO A;  2DVR A;  4TYL A;  5LKT A;  4NRA A;  4J1P A;  3NXB A;  5FE3 A;  3G0L A;  4QNS A;  5E74 A;  4NR8 A;  4OUF A;  5EIC A;  4O72 A;  3DWY A;  5KO4 A;  5CTL A;  4NQM A;  5FH7 A;  4NXJ A;  4QZS A;  3UV5 A;  5ACY A;  4HBV A;  4YK0 A;  4N4H A;  5IGK A;  5F1H A;  5FE4 A;  3RCW A;  4CFL A;  5C87 A;  4MR5 A;  4C66 A;  5JWM A;  2YYN A;  5II2 A;  2R0Y A;  5ENB A;  4BHW A;  3UVW A;  4YYH A;  5EVA A;  4LYI A;  4O7E A;  5ENJ A;  5F3A A;  5E9Y A;  5H1U A;  5F60 A;  5CQ8 A;  5E0R A;  3LQH A;  2WP2 A;  5HM0 A;  5D3P A;  3U5M A;  5CRZ A;  4PS5 A;  5EWW A;  4LR6 A;  4BW3 A;  2L85 A;  5C4Q A;  4A9L A;  3G0J A;  5CPE A;  5AME A;  3LQI A;  3QZV A;  5KTX A;  5DLZ A;  5FFV A;  2YEL A;  2RO1 A;  4A9O A;  3MQM A;  4ALG A;  5I80 A;  4UIY A;  4O7B A;  4IOO A;  2E7N A;  4TQN A;  3O33 A;  4UIW A;  4Y03 A;  4UIT A;  5ENF A;  4HBW A;  2YDW A;  5D24 A;  4YC9 A;  5A85 A;  4A9H A;  4QSW A;  2RNW A;  4TZ2 A;  5DFC A;  2RNX A;  2I8N A;  4UYE A;  5CUG A;  2OUO A;  3JVJ A;  5ETB A;  5DKC A;  5CZG A;  5LKX A;  5FG6 A;  3P1C A;  4O70 A;  5DY7 A;  5I29 A;  4CUP A;  4GPJ A;  3TLP A;  4RVR A;  5I89 A;  5FFY A;  4A9N A;  4O75 A;  5DW1 A;  5CGP A;  1WUM A;  5CFW A;  5EWC A;  5DLX A;  4HXM A;  5CP5 A;  4QSU A;  4NUD A;  2MJV B;  5FB1 A;  4MEQ A;  5FE9 A;  4TT4 A;  5CRM A;  5A5N A;  4TT6 A;  4LZ2 A;  5CUA A;  5HEL A;  5DYC A;  5A83 A;  5D3N A;  4HXS A;  4KV4 A;  4O77 A;  5FG4 A;  5FE6 A;  3Q2E A;  4F3I A;  3I3J A;  5F62 A;  5J0D A;  5D26 A;  4XUA A;  5HCL A;  4HXL A;  4BW2 A;  3HMF A;  2E7O A;  5TCM A;  5IGM A;  5JI8 A;  3LQJ A;  2F6J A;  4QYD A;  5A5S A;  5CUD A;  5F5Z A;  3SVH A;  3FKM X;  4YY4 A;  2NXB A;  5TB6 A;  4BJX A;  2RI7 A;  5EGU A;  3HME A;  4BW4 A;  5L99 A;  4CUQ A;  4HBX A;  5CQ7 A;  2G4A A;  5CQA A;  5CQ6 A;  5EPR A;  5EA1 A;  2YEM A;  5H85 A;  1N72 A;  5L98 A;  4HXP A;  4NYW A;  4NR9 A;  4QYL A;  2D9E A;  5CQT A;  5EP7 A;  4QC3 A;  1WUG A;  3LXJ A;  4MEP A;  5A5O A;  5DYA A;  5I40 A;  3UVY A;  4O7A A;  5BT5 A;  5EQ1 A;  4O78 A;  5CQ5 A;  5AD3 A;  4YYG A;  5ENH A;  3JVK A;  5I1Q A;  5ENG A;  4QSV A;  4CUR A;  5FH6 A;  3GG3 A;  5FE7 A;  4A9M A;  5HEM A;  5D25 A;  3U5L A;  3UVX A;  5I7Y A;  4LRG A;  5D3S A;  4Q0N A;  4NRC A;  4OGI A;  5EWH A;  4Z6I A;  5HQ5 A;  4YH3 A;  4WHW A;  5D3R A;  4HBY A;  2YQD A;  5DYX A;  4YBM A;  3LJW A;  4QR4 A;  4NYV A;  5HJC A;  4J3I A;  3S92 A;  4LZS A;  2WP1 A;  5EWV A;  4QUU A;  4O76 A;  4LYW A;  4YAD A;  2DVQ A;  5A5P A;  5D0C A;  5E9I A;  5K29 A;  2DWW A;  5I83 A;  3JVL A;  2DAT A;  2F6N A;  4TU6 A;  5G4S A;  3U5O A;  4NRB A;  3O34 A;  5DKH A;  5A81 A;  4N3W A;  4TT2 A;  3ZYU A;  5IID A;  5LVR A;  4O71 A;  4Q0O A;  5EPB A;  4YYJ A;  3D7C A;  4QUT A;  4Z6H A;  5C85 A;  5L96 A;  4IR6 A;  4J0R A;  3DAI A;  4A9I A;  5CS8 A;  5AD2 A;  2LSP B;  3MXF A;  5HFR A;  5A7C A;  4QSX A;  5FFW A;  4N4F A;  4WIV A;  4LC2 A;  5E3D A;  4KV1 A;  5AMF A;  4XYA A;  3QZT A;  5D3H A;  5F25 A;  4QSR A;  1X0J A;  3Q2F A;  4TTE A;  2RFJ A;  2DVS A;  2KTB B;  4NUC A;  5HFQ A;  4CLB A;  5I88 A;  4HXN A;  4QC1 A;  5DKD A;  5E9L A;  4NR5 A;  5KTW A;  5E9K A;  3U5K A;  5DFD A;  4CL9 A;  2DKW A;  4HXO A;  4QEV A;  5KTU A;  3O35 A;  4OGJ A;  1JM4 B;  5LJ2 A;  4YY6 A;  4WHU A;  4QY4 A;  4UIV A;  4KCX A;  4QSP A;  5EPS A;  4QBM A;  4XY8 A;  5F2P A;  5COI A;  5D3L A;  5FDZ A;  4UYF B;  3S91 A;  4YYI A;  4A9J A;  4PTB A;  5CUE A;  2L5E A;  5FB0 A;  4YAB A;  5C8G A;  4UYD A;  4ZW1 A;  5CQ4 A;  5LKZ A;  4FLP A;  5H1V A;  4UIZ A;  4HXK A;  4LZR A;  5DW2 A;  4ZQL A;  5F63 A;  4YAT A;  4LYS A;  3HMH A;  5IGN A;  5F36 A;  2N9G A;  5FE2 A;  5ENE A;  4YAX A;  3O37 A;  5C89 A;  4IOR A;  3ONI A;  5EIS A;  2R0V A;  5CU8 A;  4CUS A;  4HXR A;  4X2I A;  3AQA A;  5HLS A;  5D3T A;  4UYF A;  5D7X A;  4QSQ A;  5HRW A;  5A5R A;  4UYH A;  4IOQ A;  4QEW A;  4TU4 A;  2OSS A;  4QB3 A;  5CQ3 A;  2R10 A;  5FE8 A;  4TS8 A;  4CUT A;  2YW5 A;  5DX4 A;  5CUC A;  2H60 A;  4J0S A;  4QR3 A;  5EWD A;  5HQ7 A;  5FE5 A;  2YEK A;  5L8U A;  5II1 A;  2DVV A;  4NYX A;  5FE1 A;  5A82 A;  5L8T A;  2RS9 B;  4NR6 A;  3U5J A;  5IBN A;  3JVM A;  4PCI A;  5DYU A;  3SVG A;  4PKL A;  1E6I A;  4XUB A;  5EU1 A;  4Z1S A;  5L97 A;  3MB4 A;  4YYM A;  4N4I A;  4DON A;  4QSS A;  5EV9 A;  5KU3 A;  4UYG A;  2E3K A;  4E96 A;  5LJ1 A;  5KHM A;  5DBM A;  4UIU A;  4MR6 A;  4NUE A;  5E3G A;  5F61 A;  2GRC A;  4NR7 A;  4UIX A;  4BW1 A;  4YBS A;  4N4G A;  4A9E A;  4TZ8 A;  5HQ6 A;  4PCE A;  4A9F A;  4PY6 A;  2RNY A;  3UV2 A;  5IG6 A;  5FG5 A;  5A5Q A;  4Z1Q A;  5FE0 A;  5FBX A;  5I86 A;  5BT4 A;  4YBT A;  4YYD A;  5CUB A;  5ENI A;  3K2J A;  4C67 A;  5EM3 A;  3AAD A;  3U5P A;  3MB3 A;  3QZS A;  1ZS5 A;  3MUK A;  3SVF A;  5E73 A;  5G4R A;  3UVD A;  5IGL A;  5LJ0 A;  3P1F A;  4YH4 A;  2FSA A;  2I7K A;  3P5O A;  4O7C A;  4A9K A;  3O36 A;  3UV4 A;  5I7X A;  3UW9 A;  4MR3 A;  2OO1 A;  5HEN A;  3IU6 A;  4IR3 A;  5HRV A;  4NQN A;  4QR5 A;  5EI4 A;  5HRX A;  5LVQ A;  5FH8 A;  5LUU A;  2R0S A;  4NS5 A;  5LKU A;  4CUU A;  4CFK A;  4O74 A;  2D82 A;  3P1E A;  3MUL A;  4XY9 A;  1F68 A;  5CY9 A;  4Z93 A;  4ZC9 A;  5ENC A;  5ETD A;  5EK9 A;  4AKN A;  3IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...