4WHUA

Bromo domain of creb binding protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords CREB-binding protein
publication title Direct photocapture of bromodomains using tropolone chemical probes
rcsb
source organism Homo sapiens
total genus 39
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4whuA00
4NYVA 1WUGA 4QSQA 4TT4A 2DVRA 3AQAA 5IBNA 5EA1A 5CQ7A 5A82A 4N3WA 5CUAA 4IR4A 4KV4A 4PKLA 4UYEA 4N4HA 2OSSA 2DATA 5FE7A 1EQFA 4YY6A 5IGLA 3NXBA 3QZTA 5EWCA 4OGIA 4NR6A 5ENCA 4HBVA 5D3JA 4QBMA 3IU6A 4IR5A 5CPEA 4MR5A 5L99A 4XYAA 2RS9B 5ENBA 4Z6HA 5I1QA 5AMEA 5I7YA 3K2JA 5AD2A 2F6NA 4MR4A 2G4AA 5C7NA 5CS8A 4LRGA 4C66A 4O78A 5EISA 4PS5A 5CY9A 4NUCA 5DLXA 5II2A 4UYFA 4A9HA 4XY9A 5FDZA 5LKUA 5CFWA 4HXSA 5EM3A 5KHMA 4MEPA 2RFJA 5I83A 4QR4A 5HRXA 5I80A 5E73A 5LJ1A 1WUMA 4NYXA 3LQHA 4YYDA 5FE9A 4BW1A 2I7KA 3LJWA 5F25A 4YK0A 5DYAA 5G4RA 2YW5A 3FKMX 2OUOA 5DY7A 5E9VA 5EU1A 2D82A 4XUAA 3O36A 4QC3A 5EGUA 5JWMA 5HRWA 4A9LA 5FB0A 5KU3A 4CLBA 4QSPA 5EPRA 4UITA 3UW9A 5D25A 2RNYA 2OO1A 4A9KA 3ONIA 3I3JA 4QEWA 4A9IA 3MB3A 5AD3A 4WHUA 2L85A 4NS5A 3O34A 4TU4A 5D3LA 3HMHA 3IU5A 4X2IA 3JVMA 3RCWA 3MUKA 2DVQA 5I7XA 5EQ1A 3U5LA 5A85A 5D0CA 4GPJA 4O7FA 4YBMA 5C85A 5FFYA 3GG3A 4CUTA 4N4FA 2YEKA 5LKXA 4NR8A 2F6JA 2FSAA 5E9LA 3S92A 4QSUA 5EWVA 5DX4A 4E96A 5C8GA 4MEQA 3P1FA 3P1EA 4LC2A 4A9EA 5L96A 5A5OA 4QUTA 5E9KA 3LXJA 4IR6A 5CUEA 4A9JA 2DVSA 4TU6A 2MJVB 5CUDA 4YYGA 4HBYA 2YQDA 5ENEA 5F2PA 4Z93A 5FFVA 2L84A 5E3GA 5CQTA 5E9MA 4YYJA 5LJ2A 4PTBA 4NRAA 4AKNA 3Q2EA 5FE8A 2DKWA 4NRBA 5E7DA 4CUUA 5IGMA 5D3TA 3MQMA 2YEMA 4OUFA 3U5MA 5DFBA 5HQ7A 5LKZA 5ENJA 5FE4A 4BW2A 5DW1A 2WP2A 3UVXA 5DYXA 2I8NA 5CTLA 4NUEA 4XY8A 4TQNA 2YDWA 4TZ2A 5ENIA 4HXPA 4MEOA 3G0LA 5HJCA 4UIVA 5CRMA 4UYFB 2RNWA 4MENA 4HXKA 4QNSA 4TT2A 2YYNA 3TLPA 3MULA 2H60A 5F62A 5L98A 5E0RA 5HEMA 5H1VA 4O71A 4TYLA 1JSPB 4O72A 5A81A 4UIYA 1N72A 4J3IA 5I29A 5E9YA 4BW4A 4CFKA 5FE5A 4IOOA 4BJXA 5D3HA 5KTWA 4O7CA 5D3SA 3DAIA 5FBXA 3U5NA 2D9EA 4O70A 4QSSA 3SVHA 4O7EA 4FLPA 3UVYA 5FH8A 5L8UA 4ALGA 4CUPA 1X0JA 5CP5A 5IIDA 3QZSA 2E3KA 5ENHA 2RNXA 3O35A 4YH4A 4KV1A 5DFCA 3O33A 4O74A 4CURA 5CUBA 5DYUA 5E3DA 5A7CA 2R0VA 4Y03A 4OGJA 5CQ5A 3JVKA 5D24A 4LDFA 1ZS5A 5HQ5A 5LVQA 5D7XA 4UYHA 5DKDA 2L5EA 5DYCA 5A5QA 5FFWA 5ETBA 4TT6A 5ENGA 4YYMA 5D3RA 5KO4A 4NYWA 5COIA 5F1HA 4WIVA 5IG6A 3LQIA 3P1DA 5FG5A 4PY6A 4A9FA 4QSTA 4XUBA 5D3NA 4MR3A 5E74A 4QEUA 4J0RA 4UYDA 5A5PA 2DWWA 4QY4A 5DLZA 5HQ6A 4MR6A 4NQMA 4YBTA 5DKCA 5EICA 5F1LA 5LVRA 4NQNA 4QYDA 4YC9A 3UVWA 2N9GA 5HELA 5C87A 4LZRA 5F60A 4NRCA 4QR5A 3HMEA 4TZ8A 4A9OA 5HFQA 4YYKA 4O7AA 5FB1A 5CUCA 5CQ4A 5EI4A 5TB6A 3U5OA 4HBXA 5KTXA 4YBSA 5CQ8A 2RI7A 4QSRA 5CQ3A 4YYNA 5I86A 3UV4A 5D26A 5HM0A 3QZVA 5EK9A 5EWHA 4HXNA 5F5ZA 5K29A 5J0DA 5G4SA 5L8TA 5C89A 4QEVA 4NR9A 2RO1A 5CZGA 5A83A 4N4GA 4CL9A 4IOQA 2GRCA 3MXFA 4LYWA 3O37A 5FE3A 4Z6IA 3P5OA 5EWWA 2YELA 4C67A 5FE0A 5IGKA 5HFRA 4QUUA 4QR3A 5EPSA 4ALHA 5EVAA 3MB4A 5FH6A 5BT5A 3JVLA 4A9NA 3DWYA 4O75A 5CGPA 4UIXA 5I88A 5EWDA 4HBWA 5H85A 3LQJA 3UV2A 2WP1A 2R0YA 5AMFA 3S91A 2KTBB 3G0JA 4HXOA 5F36A 3ZYUA 5F3AA 5II1A 5CRZA 4UIWA 4HXMA 5CU8A 5FE6A 4TTEA 4J1PA 4CUSA 5HRVA 4YABA 5ETDA 5A5RA 5H1UA 4QSWA 5BT3A 5DKHA 5F63A 5I40A 4A9MA 5ACYA 3UVDA 4LZ2A 4QYLA 4IR3A 4ZQLA 3Q2FA 4NUDA 4YY4A 2R0SA 4Z1SA 4O76A 5DFDA 3SVFA 4LYSA 5EP7A 2E7NA 4Z1QA 5HLSA 5IGNA 1JM4B 5JI8A 5CQ6A 5HENA 4Q0NA 4DONA 2DVVA 5FG6A 5L97A 4NR5A 4QSXA 4YADA 5E9IA 4O77A 3U5KA 4YATA 4CUQA 5C4QA 3U5JA 5EV9A 4LR6A 4YH3A 4IORA 5A5NA 4PCEA 5F61A 3UV5A 4KCXA 5LKTA 4LZSA 2R10A 4O7BA 3D7CA 4WHWA 3SVGA 4UYGA 1E6IA 4UIZA 3JVJA 5D3PA 5KTUA 4BHWA 4BW3A 5HCLA 5I89A 4QSVA 4ZC9A 4QZSA 4UIUA 2LSPB 2E7OA 5H1TA 5CUGA 4NXJA 5LJ0A 5ENFA 5DBMA 4YYIA 4NR7A 4ZW1A 5FE2A 2NXBA 4Q0OA 4YAXA 4QC1A 5FH7A 1F68A 4HXLA 5A5SA 4NR4A 4CFLA 4PCIA 4F3IA 4YYHA 3U5PA 4HXRA 4RVRA 5DW2A 5TCMA 5FG4A 5BT4A 4TS8A 5FE1A 4N4IA 5LUUA 4LYIA 3AADA 3HMFA 4J0SA 5EPBA 4QB3A 3P1CA 5CQAA
chains in the Genus database with same CATH superfamily
4NYVA 1ZKRA 1WUGA 4QSQA 4TT4A 2DVRA 3AQAA 5IBNA 5EA1A 5CQ7A 5A82A 4N3WA 5CUAA 4IR4A 4KV4A 4PKLA 4UYEA 4N4HA 2OSSA 2DATA 5FE7A 1EQFA 4YY6A 5IGLA 3NXBA 3QZTA 5EWCA 4OGIA 4NR6A 5ENCA 4HBVA 5D3JA 4QBMA 3IU6A 4IR5A 5CPEA 4MR5A 5L99A 4XYAA 2RS9B 5ENBA 4Z6HA 5I1QA 5AMEA 5I7YA 3K2JA 5AD2A 2F6NA 4MR4A 2G4AA 5C7NA 5CS8A 4LRGA 4C66A 4O78A 5EISA 4PS5A 5CY9A 4NUCA 5DLXA 5II2A 4UYFA 4A9HA 4XY9A 5FDZA 5LKUA 5CFWA 4HXSA 5EM3A 5KHMA 4MEPA 2RFJA 5I83A 4QR4A 5HRXA 5I80A 5E73A 5LJ1A 1WUMA 4NYXA 3LQHA 4YYDA 5FE9A 4BW1A 2I7KA 3LJWA 5F25A 4YK0A 5DYAA 5G4RA 2YW5A 3FKMX 2OUOA 5DY7A 5E9VA 5EU1A 2D82A 4XUAA 3O36A 4QC3A 5EGUA 5JWMA 5HRWA 4A9LA 5FB0A 5KU3A 4CLBA 4QSPA 5EPRA 4UITA 3UW9A 5D25A 2RNYA 2OO1A 4A9KA 3ONIA 3I3JA 4QEWA 4A9IA 3MB3A 5AD3A 4WHUA 2L85A 4NS5A 3O34A 4TU4A 5D3LA 3HMHA 3IU5A 4X2IA 3JVMA 3RCWA 3MUKA 2DVQA 5I7XA 5EQ1A 3U5LA 5A85A 5D0CA 4GPJA 4O7FA 3D1DA 4YBMA 5C85A 5FFYA 3GG3A 4CUTA 4N4FA 2YEKA 5LKXA 4NR8A 2F6JA 2FSAA 5E9LA 3S92A 4QSUA 5EWVA 5DX4A 4E96A 5C8GA 4MEQA 3P1FA 3VKGA 3P1EA 4LC2A 4A9EA 5L96A 5A5OA 4QUTA 5E9KA 3LXJA 4IR6A 5CUEA 4A9JA 2DVSA 4AKGA 4TU6A 2MJVB 5CUDA 4YYGA 4HBYA 2YQDA 5ENEA 5F2PA 4Z93A 5FFVA 2L84A 5E3GA 5CQTA 5E9MA 4YYJA 5LJ2A 4PTBA 4NRAA 4AKNA 3Q2EA 5FE8A 2DKWA 4NRBA 5E7DA 4CUUA 5IGMA 5D3TA 3MQMA 2YEMA 4OUFA 3U5MA 5DFBA 5HQ7A 5LKZA 5ENJA 5FE4A 4BW2A 5DW1A 2WP2A 3UVXA 5DYXA 2I8NA 5CTLA 4NUEA 4XY8A 3VKHA 4TQNA 2YDWA 4TZ2A 5ENIA 4HXPA 4MEOA 3G0LA 5HJCA 4UIVA 5CRMA 4UYFB 2RNWA 4MENA 4HXKA 4QNSA 4TT2A 2YYNA 3TLPA 3MULA 2H60A 5F62A 5L98A 5E0RA 5HEMA 5H1VA 4O71A 2EJNA 4TYLA 1JSPB 4O72A 5A81A 4UIYA 1N72A 4J3IA 1PUOA 5I29A 5E9YA 4BW4A 4CFKA 5FE5A 4IOOA 4BJXA 5D3HA 5KTWA 4O7CA 5D3SA 3DAIA 5FBXA 3U5NA 2D9EA 4O70A 4QSSA 3SVHA 4O7EA 4FLPA 3UVYA 5FH8A 5L8UA 4ALGA 4CUPA 1X0JA 5CP5A 5IIDA 3QZSA 2E3KA 5ENHA 2RNXA 3O35A 4YH4A 4KV1A 5DFCA 3O33A 4O74A 4CURA 5CUBA 5DYUA 5E3DA 5A7CA 4AI6A 2R0VA 4Y03A 4OGJA 5CQ5A 3JVKA 5D24A 4LDFA 1ZS5A 5HQ5A 5LVQA 5D7XA 4UYHA 5DKDA 2L5EA 5DYCA 5A5QA 5FFWA 5ETBA 4TT6A 5ENGA 4YYMA 5D3RA 5KO4A 4NYWA 5COIA 5F1HA 4WIVA 5IG6A 3LQIA 3P1DA 5FG5A 4PY6A 4A9FA 4QSTA 4XUBA 5D3NA 4AKIA 4MR3A 5E74A 4QEUA 4J0RA 4UYDA 5A5PA 2DWWA 4QY4A 5DLZA 5HQ6A 4MR6A 4NQMA 4YBTA 5DKCA 5EICA 5F1LA 5LVRA 4NQNA 4QYDA 4YC9A 3UVWA 2N9GA 5HELA 5C87A 4LZRA 5F60A 4NRCA 4QR5A 3HMEA 4TZ8A 4A9OA 5HFQA 4YYKA 4O7AA 5FB1A 5CUCA 5CQ4A 5EI4A 5TB6A 3U5OA 4HBXA 5KTXA 4YBSA 5CQ8A 2RI7A 4QSRA 5CQ3A 4YYNA 5I86A 3UV4A 5D26A 5HM0A 3QZVA 5EK9A 5EWHA 4HXNA 5F5ZA 5K29A 5J0DA 5G4SA 5L8TA 5C89A 4QEVA 4NR9A 2RO1A 5CZGA 5A83A 4N4GA 4CL9A 4IOQA 2GRCA 3MXFA 4LYWA 3O37A 5FE3A 4Z6IA 3P5OA 5EWWA 2YELA 4C67A 5FE0A 5IGKA 5HFRA 4QUUA 4QR3A 5EPSA 4ALHA 5EVAA 3MB4A 5FH6A 5BT5A 3JVLA 4A9NA 3DWYA 4O75A 5CGPA 4UIXA 5I88A 5EWDA 4HBWA 5H85A 3LQJA 3UV2A 2WP1A 2R0YA 5AMFA 3S91A 2KTBB 3G0JA 4HXOA 5F36A 3ZYUA 5F3AA 5II1A 5CRZA 4UIWA 4HXMA 5CU8A 5FE6A 4TTEA 4J1PA 4CUSA 5HRVA 4YABA 5ETDA 5A5RA 5H1UA 4QSWA 5BT3A 5DKHA 5F63A 5I40A 4A9MA 5ACYA 3UVDA 4LZ2A 4QYLA 4IR3A 4ZQLA 3Q2FA 4NUDA 4YY4A 2R0SA 4Z1SA 4O76A 5DFDA 3SVFA 4LYSA 5EP7A 2E7NA 4Z1QA 5HLSA 5IGNA 1JM4B 5JI8A 5CQ6A 5HENA 3D1BA 4Q0NA 4AKHA 4DONA 2DVVA 5FG6A 5L97A 4NR5A 4QSXA 4YADA 5E9IA 4O77A 3U5KA 4YATA 4CUQA 5C4QA 3U5JA 5EV9A 4LR6A 4YH3A 4IORA 5A5NA 4PCEA 5F61A 3UV5A 4KCXA 5LKTA 4LZSA 2R10A 4O7BA 3D7CA 4WHWA 3SVGA 4UYGA 1E6IA 4UIZA 3JVJA 5D3PA 5KTUA 4BHWA 4BW3A 5HCLA 5I89A 4QSVA 4ZC9A 3ERRA 4QZSA 4UIUA 2LSPB 2E7OA 5H1TA 5CUGA 4NXJA 5LJ0A 5ENFA 5DBMA 4YYIA 4NR7A 4ZW1A 5FE2A 2NXBA 4Q0OA 4YAXA 4QC1A 5FH7A 1F68A 4HXLA 5A5SA 4NR4A 4CFLA 4PCIA 4F3IA 4YYHA 3U5PA 4HXRA 4RVRA 5DW2A 5TCMA 5FG4A 5BT4A 4TS8A 5FE1A 4N4IA 5LUUA 4LYIA 3HMFA 3AADA 4J0SA 5EPBA 4QB3A 3P1CA 5CQAA
chains in the Genus database with same CATH topology
4NYVA 1WUGA 4QSQA 4TT4A 2DVRA 3AQAA 5IBNA 5EA1A 5CQ7A 5A82A 4N3WA 5CUAA 4IR4A 4KV4A 4PKLA 4UYEA 4N4HA 2OSSA 2DATA 5FE7A 1EQFA 4YY6A 5IGLA 3NXBA 3QZTA 5EWCA 4OGIA 4NR6A 5ENCA 4HBVA 5D3JA 4QBMA 3IU6A 4IR5A 5CPEA 4MR5A 5L99A 4XYAA 2RS9B 5ENBA 4Z6HA 5I1QA 5AMEA 5I7YA 3K2JA 5AD2A 2F6NA 4MR4A 2G4AA 5C7NA 5CS8A 4LRGA 4C66A 4O78A 5EISA 4PS5A 5CY9A 4NUCA 5DLXA 5II2A 4UYFA 4A9HA 4XY9A 5FDZA 5LKUA 5CFWA 4HXSA 5EM3A 5KHMA 4MEPA 2RFJA 5I83A 4QR4A 5HRXA 5I80A 5E73A 5LJ1A 1WUMA 4NYXA 3LQHA 4YYDA 5FE9A 4BW1A 2I7KA 3LJWA 5F25A 4YK0A 5DYAA 5G4RA 2YW5A 3FKMX 2OUOA 5DY7A 5E9VA 5EU1A 2D82A 4XUAA 3O36A 4QC3A 5EGUA 5JWMA 5HRWA 4A9LA 5FB0A 5KU3A 4CLBA 4QSPA 5EPRA 4UITA 3UW9A 5D25A 2RNYA 2OO1A 4A9KA 3ONIA 3I3JA 4QEWA 4A9IA 3MB3A 5AD3A 4WHUA 2L85A 4NS5A 3O34A 4TU4A 5D3LA 3HMHA 3IU5A 4X2IA 3JVMA 3RCWA 3MUKA 2DVQA 5I7XA 5EQ1A 3U5LA 5A85A 5D0CA 4GPJA 4O7FA 4YBMA 5C85A 5FFYA 3GG3A 4CUTA 4N4FA 2YEKA 5LKXA 4NR8A 2F6JA 2FSAA 5E9LA 3S92A 4QSUA 5EWVA 5DX4A 4E96A 5C8GA 4MEQA 3P1FA 3P1EA 4LC2A 4A9EA 5L96A 5A5OA 4QUTA 5E9KA 3LXJA 4IR6A 5CUEA 4A9JA 2DVSA 4TU6A 2MJVB 5CUDA 4YYGA 4HBYA 2YQDA 5ENEA 5F2PA 4Z93A 5FFVA 2L84A 5E3GA 5CQTA 5E9MA 4YYJA 5LJ2A 4PTBA 4NRAA 4AKNA 3Q2EA 5FE8A 2DKWA 4NRBA 5E7DA 4CUUA 5IGMA 5D3TA 3MQMA 2YEMA 4OUFA 3U5MA 5DFBA 5HQ7A 5LKZA 5ENJA 5FE4A 4BW2A 5DW1A 2WP2A 3UVXA 5DYXA 2I8NA 5CTLA 4NUEA 4XY8A 4TQNA 2YDWA 4TZ2A 5ENIA 4HXPA 4MEOA 3G0LA 5HJCA 4UIVA 5CRMA 4UYFB 2RNWA 4MENA 4HXKA 4QNSA 4TT2A 2YYNA 3TLPA 3MULA 2H60A 5F62A 5L98A 5E0RA 5HEMA 5H1VA 4O71A 4TYLA 1JSPB 4O72A 5A81A 4UIYA 1N72A 4J3IA 5I29A 5E9YA 4BW4A 4CFKA 5FE5A 4IOOA 4BJXA 5D3HA 5KTWA 4O7CA 5D3SA 3DAIA 5FBXA 3U5NA 2D9EA 4O70A 4QSSA 3SVHA 4O7EA 4FLPA 3UVYA 5FH8A 5L8UA 4ALGA 4CUPA 1X0JA 5CP5A 5IIDA 3QZSA 2E3KA 5ENHA 2RNXA 3O35A 4YH4A 4KV1A 5DFCA 3O33A 4O74A 4CURA 5CUBA 5DYUA 5E3DA 5A7CA 2R0VA 4Y03A 4OGJA 5CQ5A 3JVKA 5D24A 4LDFA 1ZS5A 5HQ5A 5LVQA 5D7XA 4UYHA 5DKDA 2L5EA 5DYCA 5A5QA 5FFWA 5ETBA 4TT6A 5ENGA 4YYMA 5D3RA 5KO4A 4NYWA 5COIA 5F1HA 4WIVA 5IG6A 3LQIA 3P1DA 5FG5A 4PY6A 4A9FA 4QSTA 4XUBA 5D3NA 4MR3A 5E74A 4QEUA 4J0RA 4UYDA 5A5PA 2DWWA 4QY4A 5DLZA 5HQ6A 4MR6A 4NQMA 4YBTA 5DKCA 5EICA 5F1LA 5LVRA 4NQNA 4QYDA 4YC9A 3UVWA 2N9GA 5HELA 5C87A 4LZRA 5F60A 4NRCA 4QR5A 3HMEA 4TZ8A 4A9OA 5HFQA 4YYKA 4O7AA 5FB1A 5CUCA 5CQ4A 5EI4A 5TB6A 3U5OA 4HBXA 5KTXA 4YBSA 5CQ8A 2RI7A 4QSRA 5CQ3A 4YYNA 5I86A 3UV4A 5D26A 5HM0A 3QZVA 5EK9A 5EWHA 4HXNA 5F5ZA 5K29A 5J0DA 5G4SA 5L8TA 5C89A 4QEVA 4NR9A 2RO1A 5CZGA 5A83A 4N4GA 4CL9A 4IOQA 2GRCA 3MXFA 4LYWA 3O37A 5FE3A 4Z6IA 3P5OA 5EWWA 2YELA 4C67A 5FE0A 5IGKA 5HFRA 4QUUA 4QR3A 5EPSA 4ALHA 5EVAA 3MB4A 5FH6A 5BT5A 3JVLA 4A9NA 3DWYA 4O75A 5CGPA 4UIXA 5I88A 5EWDA 4HBWA 5H85A 3LQJA 3UV2A 2WP1A 2R0YA 5AMFA 3S91A 2KTBB 3G0JA 4HXOA 5F36A 3ZYUA 5F3AA 5II1A 5CRZA 4UIWA 4HXMA 5CU8A 5FE6A 4TTEA 4J1PA 4CUSA 5HRVA 4YABA 5ETDA 5A5RA 5H1UA 4QSWA 5BT3A 5DKHA 5F63A 5I40A 4A9MA 5ACYA 3UVDA 4LZ2A 4QYLA 4IR3A 4ZQLA 3Q2FA 4NUDA 4YY4A 2R0SA 4Z1SA 4O76A 5DFDA 3SVFA 4LYSA 5EP7A 2E7NA 4Z1QA 5HLSA 5IGNA 1JM4B 5JI8A 5CQ6A 5HENA 4Q0NA 4DONA 2DVVA 5FG6A 5L97A 4NR5A 4QSXA 4YADA 5E9IA 4O77A 3U5KA 4YATA 4CUQA 5C4QA 3U5JA 5EV9A 4LR6A 4YH3A 4IORA 5A5NA 4PCEA 5F61A 3UV5A 4KCXA 5LKTA 4LZSA 2R10A 4O7BA 3D7CA 4WHWA 3SVGA 4UYGA 1E6IA 4UIZA 3JVJA 5D3PA 5KTUA 4BHWA 4BW3A 5HCLA 5I89A 4QSVA 4ZC9A 4QZSA 4UIUA 2LSPB 2E7OA 5H1TA 5CUGA 4NXJA 5LJ0A 5ENFA 5DBMA 4YYIA 4NR7A 4ZW1A 5FE2A 2NXBA 4Q0OA 4YAXA 4QC1A 5FH7A 1F68A 4HXLA 5A5SA 4NR4A 4CFLA 4PCIA 4F3IA 4YYHA 3U5PA 4HXRA 4RVRA 5DW2A 5TCMA 5FG4A 5BT4A 4TS8A 5FE1A 4N4IA 5LUUA 4LYIA 3AADA 3HMFA 4J0SA 5EPBA 4QB3A 3P1CA 5CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYV A;  1WUG A;  4QSQ A;  4TT4 A;  2DVR A;  3AQA A;  5IBN A;  5EA1 A;  5CQ7 A;  5A82 A;  4N3W A;  5CUA A;  4IR4 A;  4KV4 A;  4PKL A;  4UYE A;  4N4H A;  2OSS A;  2DAT A;  5FE7 A;  1EQF A;  4YY6 A;  5IGL A;  3NXB A;  3QZT A;  5EWC A;  4OGI A;  4NR6 A;  5ENC A;  4HBV A;  5D3J A;  4QBM A;  3IU6 A;  4IR5 A;  5CPE A;  4MR5 A;  5L99 A;  4XYA A;  2RS9 B;  5ENB A;  4Z6H A;  5I1Q A;  5AME A;  5I7Y A;  3K2J A;  5AD2 A;  2F6N A;  4MR4 A;  2G4A A;  5C7N A;  5CS8 A;  4LRG A;  4C66 A;  4O78 A;  5EIS A;  4PS5 A;  5CY9 A;  4NUC A;  5DLX A;  5II2 A;  4UYF A;  4A9H A;  4XY9 A;  5FDZ A;  5LKU A;  5CFW A;  4HXS A;  5EM3 A;  5KHM A;  4MEP A;  2RFJ A;  5I83 A;  4QR4 A;  5HRX A;  5I80 A;  5E73 A;  5LJ1 A;  1WUM A;  4NYX A;  3LQH A;  4YYD A;  5FE9 A;  4BW1 A;  2I7K A;  3LJW A;  5F25 A;  4YK0 A;  5DYA A;  5G4R A;  2YW5 A;  3FKM X;  2OUO A;  5DY7 A;  5E9V A;  5EU1 A;  2D82 A;  4XUA A;  3O36 A;  4QC3 A;  5EGU A;  5JWM A;  5HRW A;  4A9L A;  5FB0 A;  5KU3 A;  4CLB A;  4QSP A;  5EPR A;  4UIT A;  3UW9 A;  5D25 A;  2RNY A;  2OO1 A;  4A9K A;  3ONI A;  3I3J A;  4QEW A;  4A9I A;  3MB3 A;  5AD3 A;  4WHU A;  2L85 A;  4NS5 A;  3O34 A;  4TU4 A;  5D3L A;  3HMH A;  3IU5 A;  4X2I A;  3JVM A;  3RCW A;  3MUK A;  2DVQ A;  5I7X A;  5EQ1 A;  3U5L A;  5A85 A;  5D0C A;  4GPJ A;  4O7F A;  4YBM A;  5C85 A;  5FFY A;  3GG3 A;  4CUT A;  4N4F A;  2YEK A;  5LKX A;  4NR8 A;  2F6J A;  2FSA A;  5E9L A;  3S92 A;  4QSU A;  5EWV A;  5DX4 A;  4E96 A;  5C8G A;  4MEQ A;  3P1F A;  3P1E A;  4LC2 A;  4A9E A;  5L96 A;  5A5O A;  4QUT A;  5E9K A;  3LXJ A;  4IR6 A;  5CUE A;  4A9J A;  2DVS A;  4TU6 A;  2MJV B;  5CUD A;  4YYG A;  4HBY A;  2YQD A;  5ENE A;  5F2P A;  4Z93 A;  5FFV A;  2L84 A;  5E3G A;  5CQT A;  5E9M A;  4YYJ A;  5LJ2 A;  4PTB A;  4NRA A;  4AKN A;  3Q2E A;  5FE8 A;  2DKW A;  4NRB A;  5E7D A;  4CUU A;  5IGM A;  5D3T A;  3MQM A;  2YEM A;  4OUF A;  3U5M A;  5DFB A;  5HQ7 A;  5LKZ A;  5ENJ A;  5FE4 A;  4BW2 A;  5DW1 A;  2WP2 A;  3UVX A;  5DYX A;  2I8N A;  5CTL A;  4NUE A;  4XY8 A;  4TQN A;  2YDW A;  4TZ2 A;  5ENI A;  4HXP A;  4MEO A;  3G0L A;  5HJC A;  4UIV A;  5CRM A;  4UYF B;  2RNW A;  4MEN A;  4HXK A;  4QNS A;  4TT2 A;  2YYN A;  3TLP A;  3MUL A;  2H60 A;  5F62 A;  5L98 A;  5E0R A;  5HEM A;  5H1V A;  4O71 A;  4TYL A;  1JSP B;  4O72 A;  5A81 A;  4UIY A;  1N72 A;  4J3I A;  5I29 A;  5E9Y A;  4BW4 A;  4CFK A;  5FE5 A;  4IOO A;  4BJX A;  5D3H A;  5KTW A;  4O7C A;  5D3S A;  3DAI A;  5FBX A;  3U5N A;  2D9E A;  4O70 A;  4QSS A;  3SVH A;  4O7E A;  4FLP A;  3UVY A;  5FH8 A;  5L8U A;  4ALG A;  4CUP A;  1X0J A;  5CP5 A;  5IID A;  3QZS A;  2E3K A;  5ENH A;  2RNX A;  3O35 A;  4YH4 A;  4KV1 A;  5DFC A;  3O33 A;  4O74 A;  4CUR A;  5CUB A;  5DYU A;  5E3D A;  5A7C A;  2R0V A;  4Y03 A;  4OGJ A;  5CQ5 A;  3JVK A;  5D24 A;  4LDF A;  1ZS5 A;  5HQ5 A;  5LVQ A;  5D7X A;  4UYH A;  5DKD A;  2L5E A;  5DYC A;  5A5Q A;  5FFW A;  5ETB A;  4TT6 A;  5ENG A;  4YYM A;  5D3R A;  5KO4 A;  4NYW A;  5COI A;  5F1H A;  4WIV A;  5IG6 A;  3LQI A;  3P1D A;  5FG5 A;  4PY6 A;  4A9F A;  4QST A;  4XUB A;  5D3N A;  4MR3 A;  5E74 A;  4QEU A;  4J0R A;  4UYD A;  5A5P A;  2DWW A;  4QY4 A;  5DLZ A;  5HQ6 A;  4MR6 A;  4NQM A;  4YBT A;  5DKC A;  5EIC A;  5F1L A;  5LVR A;  4NQN A;  4QYD A;  4YC9 A;  3UVW A;  2N9G A;  5HEL A;  5C87 A;  4LZR A;  5F60 A;  4NRC A;  4QR5 A;  3HME A;  4TZ8 A;  4A9O A;  5HFQ A;  4YYK A;  4O7A A;  5FB1 A;  5CUC A;  5CQ4 A;  5EI4 A;  5TB6 A;  3U5O A;  4HBX A;  5KTX A;  4YBS A;  5CQ8 A;  2RI7 A;  4QSR A;  5CQ3 A;  4YYN A;  5I86 A;  3UV4 A;  5D26 A;  5HM0 A;  3QZV A;  5EK9 A;  5EWH A;  4HXN A;  5F5Z A;  5K29 A;  5J0D A;  5G4S A;  5L8T A;  5C89 A;  4QEV A;  4NR9 A;  2RO1 A;  5CZG A;  5A83 A;  4N4G A;  4CL9 A;  4IOQ A;  2GRC A;  3MXF A;  4LYW A;  3O37 A;  5FE3 A;  4Z6I A;  3P5O A;  5EWW A;  2YEL A;  4C67 A;  5FE0 A;  5IGK A;  5HFR A;  4QUU A;  4QR3 A;  5EPS A;  4ALH A;  5EVA A;  3MB4 A;  5FH6 A;  5BT5 A;  3JVL A;  4A9N A;  3DWY A;  4O75 A;  5CGP A;  4UIX A;  5I88 A;  5EWD A;  4HBW A;  5H85 A;  3LQJ A;  3UV2 A;  2WP1 A;  2R0Y A;  5AMF A;  3S91 A;  2KTB B;  3G0J A;  4HXO A;  5F36 A;  3ZYU A;  5F3A A;  5II1 A;  5CRZ A;  4UIW A;  4HXM A;  5CU8 A;  5FE6 A;  4TTE A;  4J1P A;  4CUS A;  5HRV A;  4YAB A;  5ETD A;  5A5R A;  5H1U A;  4QSW A;  5BT3 A;  5DKH A;  5F63 A;  5I40 A;  4A9M A;  5ACY A;  3UVD A;  4LZ2 A;  4QYL A;  4IR3 A;  4ZQL A;  3Q2F A;  4NUD A;  4YY4 A;  2R0S A;  4Z1S A;  4O76 A;  5DFD A;  3SVF A;  4LYS A;  5EP7 A;  2E7N A;  4Z1Q A;  5HLS A;  5IGN A;  1JM4 B;  5JI8 A;  5CQ6 A;  5HEN A;  4Q0N A;  4DON A;  2DVV A;  5FG6 A;  5L97 A;  4NR5 A;  4QSX A;  4YAD A;  5E9I A;  4O77 A;  3U5K A;  4YAT A;  4CUQ A;  5C4Q A;  3U5J A;  5EV9 A;  4LR6 A;  4YH3 A;  4IOR A;  5A5N A;  4PCE A;  5F61 A;  3UV5 A;  4KCX A;  5LKT A;  4LZS A;  2R10 A;  4O7B A;  3D7C A;  4WHW A;  3SVG A;  4UYG A;  1E6I A;  4UIZ A;  3JVJ A;  5D3P A;  5KTU A;  4BHW A;  4BW3 A;  5HCL A;  5I89 A;  4QSV A;  4ZC9 A;  4QZS A;  4UIU A;  2LSP B;  2E7O A;  5H1T A;  5CUG A;  4NXJ A;  5LJ0 A;  5ENF A;  5DBM A;  4YYI A;  4NR7 A;  4ZW1 A;  5FE2 A;  2NXB A;  4Q0O A;  4YAX A;  4QC1 A;  5FH7 A;  1F68 A;  4HXL A;  5A5S A;  4NR4 A;  4CFL A;  4PCI A;  4F3I A;  4YYH A;  3U5P A;  4HXR A;  4RVR A;  5DW2 A;  5TCM A;  5FG4 A;  5BT4 A;  4TS8 A;  5FE1 A;  4N4I A;  5LUU A;  4LYI A;  3AAD A;  3HMF A;  4J0S A;  5EPB A;  4QB3 A;  3P1C A;  5CQA A; 
#chains in the Genus database with same CATH topology
 4NYV A;  1ZKR A;  1WUG A;  4QSQ A;  4TT4 A;  2DVR A;  3AQA A;  5IBN A;  5EA1 A;  5CQ7 A;  5A82 A;  4N3W A;  5CUA A;  4IR4 A;  4KV4 A;  4PKL A;  4UYE A;  4N4H A;  2OSS A;  2DAT A;  5FE7 A;  1EQF A;  4YY6 A;  5IGL A;  3NXB A;  3QZT A;  5EWC A;  4OGI A;  4NR6 A;  5ENC A;  4HBV A;  5D3J A;  4QBM A;  3IU6 A;  4IR5 A;  5CPE A;  4MR5 A;  5L99 A;  4XYA A;  2RS9 B;  5ENB A;  4Z6H A;  5I1Q A;  5AME A;  5I7Y A;  3K2J A;  5AD2 A;  2F6N A;  4MR4 A;  2G4A A;  5C7N A;  5CS8 A;  4LRG A;  4C66 A;  4O78 A;  5EIS A;  4PS5 A;  5CY9 A;  4NUC A;  5DLX A;  5II2 A;  4UYF A;  4A9H A;  4XY9 A;  5FDZ A;  5LKU A;  5CFW A;  4HXS A;  5EM3 A;  5KHM A;  4MEP A;  2RFJ A;  5I83 A;  4QR4 A;  5HRX A;  5I80 A;  5E73 A;  5LJ1 A;  1WUM A;  4NYX A;  3LQH A;  4YYD A;  5FE9 A;  4BW1 A;  2I7K A;  3LJW A;  5F25 A;  4YK0 A;  5DYA A;  5G4R A;  2YW5 A;  3FKM X;  2OUO A;  5DY7 A;  5E9V A;  5EU1 A;  2D82 A;  4XUA A;  3O36 A;  4QC3 A;  5EGU A;  5JWM A;  5HRW A;  4A9L A;  5FB0 A;  5KU3 A;  4CLB A;  4QSP A;  5EPR A;  4UIT A;  3UW9 A;  5D25 A;  2RNY A;  2OO1 A;  4A9K A;  3ONI A;  3I3J A;  4QEW A;  4A9I A;  3MB3 A;  5AD3 A;  4WHU A;  2L85 A;  4NS5 A;  3O34 A;  4TU4 A;  5D3L A;  3HMH A;  3IU5 A;  4X2I A;  3JVM A;  3RCW A;  3MUK A;  2DVQ A;  5I7X A;  5EQ1 A;  3U5L A;  5A85 A;  5D0C A;  4GPJ A;  4O7F A;  3D1D A;  4YBM A;  5C85 A;  5FFY A;  3GG3 A;  4CUT A;  4N4F A;  2YEK A;  5LKX A;  4NR8 A;  2F6J A;  2FSA A;  5E9L A;  3S92 A;  4QSU A;  5EWV A;  5DX4 A;  4E96 A;  5C8G A;  4MEQ A;  3P1F A;  3VKG A;  3P1E A;  4LC2 A;  4A9E A;  5L96 A;  5A5O A;  4QUT A;  5E9K A;  3LXJ A;  4IR6 A;  5CUE A;  4A9J A;  2DVS A;  4AKG A;  4TU6 A;  2MJV B;  5CUD A;  4YYG A;  4HBY A;  2YQD A;  5ENE A;  5F2P A;  4Z93 A;  5FFV A;  2L84 A;  5E3G A;  5CQT A;  5E9M A;  4YYJ A;  5LJ2 A;  4PTB A;  4NRA A;  4AKN A;  3Q2E A;  5FE8 A;  2DKW A;  4NRB A;  5E7D A;  4CUU A;  5IGM A;  5D3T A;  3MQM A;  2YEM A;  4OUF A;  3U5M A;  5DFB A;  5HQ7 A;  5LKZ A;  5ENJ A;  5FE4 A;  4BW2 A;  5DW1 A;  2WP2 A;  3UVX A;  5DYX A;  2I8N A;  5CTL A;  4NUE A;  4XY8 A;  3VKH A;  4TQN A;  2YDW A;  4TZ2 A;  5ENI A;  4HXP A;  4MEO A;  3G0L A;  5HJC A;  4UIV A;  5CRM A;  4UYF B;  2RNW A;  4MEN A;  4HXK A;  4QNS A;  4TT2 A;  2YYN A;  3TLP A;  3MUL A;  2H60 A;  5F62 A;  5L98 A;  5E0R A;  5HEM A;  5H1V A;  4O71 A;  2EJN A;  4TYL A;  1JSP B;  4O72 A;  5A81 A;  4UIY A;  1N72 A;  4J3I A;  1PUO A;  5I29 A;  5E9Y A;  4BW4 A;  4CFK A;  5FE5 A;  4IOO A;  4BJX A;  5D3H A;  5KTW A;  4O7C A;  5D3S A;  3DAI A;  5FBX A;  3U5N A;  2D9E A;  4O70 A;  4QSS A;  3SVH A;  4O7E A;  4FLP A;  3UVY A;  5FH8 A;  5L8U A;  4ALG A;  4CUP A;  1X0J A;  5CP5 A;  5IID A;  3QZS A;  2E3K A;  5ENH A;  2RNX A;  3O35 A;  4YH4 A;  4KV1 A;  5DFC A;  3O33 A;  4O74 A;  4CUR A;  5CUB A;  5DYU A;  5E3D A;  5A7C A;  4AI6 A;  2R0V A;  4Y03 A;  4OGJ A;  5CQ5 A;  3JVK A;  5D24 A;  4LDF A;  1ZS5 A;  5HQ5 A;  5LVQ A;  5D7X A;  4UYH A;  5DKD A;  2L5E A;  5DYC A;  5A5Q A;  5FFW A;  5ETB A;  4TT6 A;  5ENG A;  4YYM A;  5D3R A;  5KO4 A;  4NYW A;  5COI A;  5F1H A;  4WIV A;  5IG6 A;  3LQI A;  3P1D A;  5FG5 A;  4PY6 A;  4A9F A;  4QST A;  4XUB A;  5D3N A;  4AKI A;  4MR3 A;  5E74 A;  4QEU A;  4J0R A;  4UYD A;  5A5P A;  2DWW A;  4QY4 A;  5DLZ A;  5HQ6 A;  4MR6 A;  4NQM A;  4YBT A;  5DKC A;  5EIC A;  5F1L A;  5LVR A;  4NQN A;  4QYD A;  4YC9 A;  3UVW A;  2N9G A;  5HEL A;  5C87 A;  4LZR A;  5F60 A;  4NRC A;  4QR5 A;  3HME A;  4TZ8 A;  4A9O A;  5HFQ A;  4YYK A;  4O7A A;  5FB1 A;  5CUC A;  5CQ4 A;  5EI4 A;  5TB6 A;  3U5O A;  4HBX A;  5KTX A;  4YBS A;  5CQ8 A;  2RI7 A;  4QSR A;  5CQ3 A;  4YYN A;  5I86 A;  3UV4 A;  5D26 A;  5HM0 A;  3QZV A;  5EK9 A;  5EWH A;  4HXN A;  5F5Z A;  5K29 A;  5J0D A;  5G4S A;  5L8T A;  5C89 A;  4QEV A;  4NR9 A;  2RO1 A;  5CZG A;  5A83 A;  4N4G A;  4CL9 A;  4IOQ A;  2GRC A;  3MXF A;  4LYW A;  3O37 A;  5FE3 A;  4Z6I A;  3P5O A;  5EWW A;  2YEL A;  4C67 A;  5FE0 A;  5IGK A;  5HFR A;  4QUU A;  4QR3 A;  5EPS A;  4ALH A;  5EVA A;  3MB4 A;  5FH6 A;  5BT5 A;  3JVL A;  4A9N A;  3DWY A;  4O75 A;  5CGP A;  4UIX A;  5I88 A;  5EWD A;  4HBW A;  5H85 A;  3LQJ A;  3UV2 A;  2WP1 A;  2R0Y A;  5AMF A;  3S91 A;  2KTB B;  3G0J A;  4HXO A;  5F36 A;  3ZYU A;  5F3A A;  5II1 A;  5CRZ A;  4UIW A;  4HXM A;  5CU8 A;  5FE6 A;  4TTE A;  4J1P A;  4CUS A;  5HRV A;  4YAB A;  5ETD A;  5A5R A;  5H1U A;  4QSW A;  5BT3 A;  5DKH A;  5F63 A;  5I40 A;  4A9M A;  5ACY A;  3UVD A;  4LZ2 A;  4QYL A;  4IR3 A;  4ZQL A;  3Q2F A;  4NUD A;  4YY4 A;  2R0S A;  4Z1S A;  4O76 A;  5DFD A;  3SVF A;  4LYS A;  5EP7 A;  2E7N A;  4Z1Q A;  5HLS A;  5IGN A;  1JM4 B;  5JI8 A;  5CQ6 A;  5HEN A;  3D1B A;  4Q0N A;  4AKH A;  4DON A;  2DVV A;  5FG6 A;  5L97 A;  4NR5 A;  4QSX A;  4YAD A;  5E9I A;  4O77 A;  3U5K A;  4YAT A;  4CUQ A;  5C4Q A;  3U5J A;  5EV9 A;  4LR6 A;  4YH3 A;  4IOR A;  5A5N A;  4PCE A;  5F61 A;  3UV5 A;  4KCX A;  5LKT A;  4LZS A;  2R10 A;  4O7B A;  3D7C A;  4WHW A;  3SVG A;  4UYG A;  1E6I A;  4UIZ A;  3JVJ A;  5D3P A;  5KTU A;  4BHW A;  4BW3 A;  5HCL A;  5I89 A;  4QSV A;  4ZC9 A;  3ERR A;  4QZS A;  4UIU A;  2LSP B;  2E7O A;  5H1T A;  5CUG A;  4NXJ A;  5LJ0 A;  5ENF A;  5DBM A;  4YYI A;  4NR7 A;  4ZW1 A;  5FE2 A;  2NXB A;  4Q0O A;  4YAX A;  4QC1 A;  5FH7 A;  1F68 A;  4HXL A;  5A5S A;  4NR4 A;  4CFL A;  4PCI A;  4F3I A;  4YYH A;  3U5P A;  4HXR A;  4RVR A;  5DW2 A;  5TCM A;  5FG4 A;  5BT4 A;  4TS8 A;  5FE1 A;  4N4I A;  5LUU A;  4LYI A;  3HMF A;  3AAD A;  4J0S A;  5EPB A;  4QB3 A;  3P1C A;  5CQA A; 
#chains in the Genus database with same CATH homology
 4NYV A;  1WUG A;  4QSQ A;  4TT4 A;  2DVR A;  3AQA A;  5IBN A;  5EA1 A;  5CQ7 A;  5A82 A;  4N3W A;  5CUA A;  4IR4 A;  4KV4 A;  4PKL A;  4UYE A;  4N4H A;  2OSS A;  2DAT A;  5FE7 A;  1EQF A;  4YY6 A;  5IGL A;  3NXB A;  3QZT A;  5EWC A;  4OGI A;  4NR6 A;  5ENC A;  4HBV A;  5D3J A;  4QBM A;  3IU6 A;  4IR5 A;  5CPE A;  4MR5 A;  5L99 A;  4XYA A;  2RS9 B;  5ENB A;  4Z6H A;  5I1Q A;  5AME A;  5I7Y A;  3K2J A;  5AD2 A;  2F6N A;  4MR4 A;  2G4A A;  5C7N A;  5CS8 A;  4LRG A;  4C66 A;  4O78 A;  5EIS A;  4PS5 A;  5CY9 A;  4NUC A;  5DLX A;  5II2 A;  4UYF A;  4A9H A;  4XY9 A;  5FDZ A;  5LKU A;  5CFW A;  4HXS A;  5EM3 A;  5KHM A;  4MEP A;  2RFJ A;  5I83 A;  4QR4 A;  5HRX A;  5I80 A;  5E73 A;  5LJ1 A;  1WUM A;  4NYX A;  3LQH A;  4YYD A;  5FE9 A;  4BW1 A;  2I7K A;  3LJW A;  5F25 A;  4YK0 A;  5DYA A;  5G4R A;  2YW5 A;  3FKM X;  2OUO A;  5DY7 A;  5E9V A;  5EU1 A;  2D82 A;  4XUA A;  3O36 A;  4QC3 A;  5EGU A;  5JWM A;  5HRW A;  4A9L A;  5FB0 A;  5KU3 A;  4CLB A;  4QSP A;  5EPR A;  4UIT A;  3UW9 A;  5D25 A;  2RNY A;  2OO1 A;  4A9K A;  3ONI A;  3I3J A;  4QEW A;  4A9I A;  3MB3 A;  5AD3 A;  4WHU A;  2L85 A;  4NS5 A;  3O34 A;  4TU4 A;  5D3L A;  3HMH A;  3IU5 A;  4X2I A;  3JVM A;  3RCW A;  3MUK A;  2DVQ A;  5I7X A;  5EQ1 A;  3U5L A;  5A85 A;  5D0C A;  4GPJ A;  4O7F A;  4YBM A;  5C85 A;  5FFY A;  3GG3 A;  4CUT A;  4N4F A;  2YEK A;  5LKX A;  4NR8 A;  2F6J A;  2FSA A;  5E9L A;  3S92 A;  4QSU A;  5EWV A;  5DX4 A;  4E96 A;  5C8G A;  4MEQ A;  3P1F A;  3P1E A;  4LC2 A;  4A9E A;  5L96 A;  5A5O A;  4QUT A;  5E9K A;  3LXJ A;  4IR6 A;  5CUE A;  4A9J A;  2DVS A;  4TU6 A;  2MJV B;  5CUD A;  4YYG A;  4HBY A;  2YQD A;  5ENE A;  5F2P A;  4Z93 A;  5FFV A;  2L84 A;  5E3G A;  5CQT A;  5E9M A;  4YYJ A;  5LJ2 A;  4PTB A;  4NRA A;  4AKN A;  3Q2E A;  5FE8 A;  2DKW A;  4NRB A;  5E7D A;  4CUU A;  5IGM A;  5D3T A;  3MQM A;  2YEM A;  4OUF A;  3U5M A;  5DFB A;  5HQ7 A;  5LKZ A;  5ENJ A;  5FE4 A;  4BW2 A;  5DW1 A;  2WP2 A;  3UVX A;  5DYX A;  2I8N A;  5CTL A;  4NUE A;  4XY8 A;  4TQN A;  2YDW A;  4TZ2 A;  5ENI A;  4HXP A;  4MEO A;  3G0L A;  5HJC A;  4UIV A;  5CRM A;  4UYF B;  2RNW A;  4MEN A;  4HXK A;  4QNS A;  4TT2 A;  2YYN A;  3TLP A;  3MUL A;  2H60 A;  5F62 A;  5L98 A;  5E0R A;  5HEM A;  5H1V A;  4O71 A;  4TYL A;  1JSP B;  4O72 A;  5A81 A;  4UIY A;  1N72 A;  4J3I A;  5I29 A;  5E9Y A;  4BW4 A;  4CFK A;  5FE5 A;  4IOO A;  4BJX A;  5D3H A;  5KTW A;  4O7C A;  5D3S A;  3DAI A;  5FBX A;  3U5N A;  2D9E A;  4O70 A;  4QSS A;  3SVH A;  4O7E A;  4FLP A;  3UVY A;  5FH8 A;  5L8U A;  4ALG A;  4CUP A;  1X0J A;  5CP5 A;  5IID A;  3QZS A;  2E3K A;  5ENH A;  2RNX A;  3O35 A;  4YH4 A;  4KV1 A;  5DFC A;  3O33 A;  4O74 A;  4CUR A;  5CUB A;  5DYU A;  5E3D A;  5A7C A;  2R0V A;  4Y03 A;  4OGJ A;  5CQ5 A;  3JVK A;  5D24 A;  4LDF A;  1ZS5 A;  5HQ5 A;  5LVQ A;  5D7X A;  4UYH A;  5DKD A;  2L5E A;  5DYC A;  5A5Q A;  5FFW A;  5ETB A;  4TT6 A;  5ENG A;  4YYM A;  5D3R A;  5KO4 A;  4NYW A;  5COI A;  5F1H A;  4WIV A;  5IG6 A;  3LQI A;  3P1D A;  5FG5 A;  4PY6 A;  4A9F A;  4QST A;  4XUB A;  5D3N A;  4MR3 A;  5E74 A;  4QEU A;  4J0R A;  4UYD A;  5A5P A;  2DWW A;  4QY4 A;  5DLZ A;  5HQ6 A;  4MR6 A;  4NQM A;  4YBT A;  5DKC A;  5EIC A;  5F1L A;  5LVR A;  4NQN A;  4QYD A;  4YC9 A;  3UVW A;  2N9G A;  5HEL A;  5C87 A;  4LZR A;  5F60 A;  4NRC A;  4QR5 A;  3HME A;  4TZ8 A;  4A9O A;  5HFQ A;  4YYK A;  4O7A A;  5FB1 A;  5CUC A;  5CQ4 A;  5EI4 A;  5TB6 A;  3U5O A;  4HBX A;  5KTX A;  4YBS A;  5CQ8 A;  2RI7 A;  4QSR A;  5CQ3 A;  4YYN A;  5I86 A;  3UV4 A;  5D26 A;  5HM0 A;  3QZV A;  5EK9 A;  5EWH A;  4HXN A;  5F5Z A;  5K29 A;  5J0D A;  5G4S A;  5L8T A;  5C89 A;  4QEV A;  4NR9 A;  2RO1 A;  5CZG A;  5A83 A;  4N4G A;  4CL9 A;  4IOQ A;  2GRC A;  3MXF A;  4LYW A;  3O37 A;  5FE3 A;  4Z6I A;  3P5O A;  5EWW A;  2YEL A;  4C67 A;  5FE0 A;  5IGK A;  5HFR A;  4QUU A;  4QR3 A;  5EPS A;  4ALH A;  5EVA A;  3MB4 A;  5FH6 A;  5BT5 A;  3JVL A;  4A9N A;  3DWY A;  4O75 A;  5CGP A;  4UIX A;  5I88 A;  5EWD A;  4HBW A;  5H85 A;  3LQJ A;  3UV2 A;  2WP1 A;  2R0Y A;  5AMF A;  3S91 A;  2KTB B;  3G0J A;  4HXO A;  5F36 A;  3ZYU A;  5F3A A;  5II1 A;  5CRZ A;  4UIW A;  4HXM A;  5CU8 A;  5FE6 A;  4TTE A;  4J1P A;  4CUS A;  5HRV A;  4YAB A;  5ETD A;  5A5R A;  5H1U A;  4QSW A;  5BT3 A;  5DKH A;  5F63 A;  5I40 A;  4A9M A;  5ACY A;  3UVD A;  4LZ2 A;  4QYL A;  4IR3 A;  4ZQL A;  3Q2F A;  4NUD A;  4YY4 A;  2R0S A;  4Z1S A;  4O76 A;  5DFD A;  3SVF A;  4LYS A;  5EP7 A;  2E7N A;  4Z1Q A;  5HLS A;  5IGN A;  1JM4 B;  5JI8 A;  5CQ6 A;  5HEN A;  4Q0N A;  4DON A;  2DVV A;  5FG6 A;  5L97 A;  4NR5 A;  4QSX A;  4YAD A;  5E9I A;  4O77 A;  3U5K A;  4YAT A;  4CUQ A;  5C4Q A;  3U5J A;  5EV9 A;  4LR6 A;  4YH3 A;  4IOR A;  5A5N A;  4PCE A;  5F61 A;  3UV5 A;  4KCX A;  5LKT A;  4LZS A;  2R10 A;  4O7B A;  3D7C A;  4WHW A;  3SVG A;  4UYG A;  1E6I A;  4UIZ A;  3JVJ A;  5D3P A;  5KTU A;  4BHW A;  4BW3 A;  5HCL A;  5I89 A;  4QSV A;  4ZC9 A;  4QZS A;  4UIU A;  2LSP B;  2E7O A;  5H1T A;  5CUG A;  4NXJ A;  5LJ0 A;  5ENF A;  5DBM A;  4YYI A;  4NR7 A;  4ZW1 A;  5FE2 A;  2NXB A;  4Q0O A;  4YAX A;  4QC1 A;  5FH7 A;  1F68 A;  4HXL A;  5A5S A;  4NR4 A;  4CFL A;  4PCI A;  4F3I A;  4YYH A;  3U5P A;  4HXR A;  4RVR A;  5DW2 A;  5TCM A;  5FG4 A;  5BT4 A;  4TS8 A;  5FE1 A;  4N4I A;  5LUU A;  4LYI A;  3AAD A;  3HMF A;  4J0S A;  5EPB A;  4QB3 A;  3P1C A;  5CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...