4WHUA

Bromo domain of creb binding protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Direct photocapture of bromodomains using tropolone chemical probes
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 39
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4whuA00
5ENHA 4O7AA 5COIA 4QEUA 4O77A 4TT2A 2YEKA 5FDZA 5CUEA 2OSSA 4BHWA 4YYIA 5EPSA 4E96A 1JM4B 4O7BA 5K29A 4N4HA 5CUBA 4QC1A 5FE2A 5E7DA 4YYJA 2YEMA 5LJ1A 3DWYA 5IGNA 4O74A 5HLSA 2E3KA 4CFKA 2F6NA 5FE6A 4TQNA 5EA1A 4HXKA 4QYLA 5EWHA 5I7XA 4C66A 4CFLA 5F25A 5L98A 4Z6IA 3O34A 5HRVA 4NQNA 5CQ6A 5I40A 2WP2A 4LZRA 5KO4A 5IIDA 5FG4A 4TYLA 4MEQA 5IGKA 5A82A 4NR7A 4YYDA 5HM0A 4O7EA 3DAIA 3P1EA 5L8TA 3QZTA 5E0RA 5E9LA 5A5NA 5CGPA 5I86A 5II2A 3O36A 5E9YA 5TCMA 5KU3A 4CUUA 4A9MA 5L96A 4MR3A 5EPBA 1JSPB 5D3HA 5I7YA 3HMHA 4A9EA 3P1CA 5FB0A 2YELA 4IR5A 5BT3A 4PTBA 5EK9A 3TLPA 5CQ8A 5FE3A 4TZ8A 5JWMA 5L8UA 5KTWA 5DKCA 4UIZA 4NUEA 2OUOA 4IOOA 3U5KA 3GG3A 5A5SA 4UITA 5E9VA 5CQ3A 4TU4A 4PY6A 5HJCA 3JVKA 5EWVA 3UV4A 3IU5A 5A5RA 5F36A 5A7CA 5L97A 3UV5A 5F5ZA 2DVRA 4O76A 2DVSA 5DLZA 4A9FA 3K2JA 4GPJA 5C85A 5FE9A 4QSTA 3S91A 5ETBA 5LJ2A 5EWWA 5FFVA 5FH8A 4NQMA 5JI8A 4YABA 2RFJA 4UIXA 2R0YA 4LR6A 4QSUA 5CY9A 4CLBA 3U5LA 4QEVA 4QR3A 5CRMA 5DYCA 4CUQA 4HBXA 3JVLA 4NRCA 5EGUA 5I80A 5EWDA 4HBVA 3ZYUA 3U5NA 4J0RA 4QSRA 4C67A 5HQ6A 4YY6A 4ALGA 2R0SA 5CTLA 4CUSA 4KV4A 5DW1A 3JVJA 4O70A 4MR6A 5ENJA 2L5EA 4HXOA 4J3IA 4LDFA 4NUDA 4QSXA 4A9HA 5ENEA 4O72A 3P1DA 5E9MA 4NR8A 4UYEA 1WUGA 4O71A 3AQAA 4O7CA 5G4RA 4QSQA 5DX4A 4Q0OA 2DVQA 4XUBA 4AKNA 5CRZA 2RS9B 4QSWA 5LVQA 3S92A 5LKTA 4WIVA 5I29A 5EICA 2R10A 3P5OA 4UIUA 4ZQLA 4A9LA 4YH3A 5EISA 4QEWA 4WHUA 3O33A 3QZVA 4YBMA 1N72A 4O7FA 5DKDA 5ENFA 4O78A 5A5OA 3LQHA 4FLPA 4N4FA 4YC9A 4DONA 5ENIA 4CURA 5CQ7A 2RNYA 3QZSA 5IBNA 5D3RA 2E7NA 3SVHA 1F68A 4J0SA 5D3LA 5AMFA 5E73A 2DKWA 4UYHA 5LKXA 3IU6A 3ONIA 5DW2A 5IGLA 5I1QA 3U5PA 2L84A 4A9OA 2I7KA 5FE0A 4J1PA 4QB3A 2RO1A 5CUDA 5F63A 2FSAA 4N3WA 5D3TA 4KV1A 4UYFB 5FBXA 2DVVA 5LUUA 5FH7A 4A9KA 4CUPA 3Q2EA 4UIVA 5DY7A 4QSSA 4X2IA 5LKZA 5EP7A 5FE1A 5C87A 3FKMX 2G4AA 4QSVA 4YYMA 4QC3A 2N9GA 3RCWA 4BJXA 2YDWA 4HXRA 2DWWA 4YBSA 5BT5A 3U5MA 4NYVA 5E74A 5FH6A 3P1FA 4LZSA 4NR4A 4PCEA 3UVXA 5H1UA 5HELA 5ETDA 4LYWA 5F61A 3O35A 5ENBA 3UVYA 5DFDA 4MEPA 3G0JA 4BW3A 5I88A 5D26A 5H85A 4QY4A 4MEOA 5F3AA 3LXJA 5FE5A 3U5JA 4N4IA 2YQDA 5D3JA 5EQ1A 1X0JA 4IR3A 5HCLA 4BW1A 5IG6A 2D82A 2LSPB 4Z1SA 2GRCA 4YYGA 2YW5A 4LC2A 5EV9A 4BW4A 5D24A 5A5QA 4RVRA 4UYGA 4TT4A 5FG6A 4YH4A 4NR5A 4IOQA 5G4SA 5A5PA 4TU6A 4CL9A 2OO1A 4LYSA 5CS8A 5DBMA 3U5OA 3D7CA 4XYAA 4NXJA 4QYDA 4NR9A 5ENCA 2RNXA 5DKHA 5FFYA 5I89A 5BT4A 4NR6A 5DYAA 4Y03A 4F3IA 4CUTA 4MR4A 2F6JA 3AADA 5F62A 3LQJA 4PCIA 5II1A 4ALHA 5CUCA 4QSPA 5AD2A 5LKUA 5H1VA 2NXBA 4YBTA 5D3PA 5DLXA 5F2PA 4QBMA 5CU8A 5CQ4A 4O75A 4HBYA 5FB1A 5C89A 5I83A 4Z1QA 4TTEA 5E9IA 4UYDA 3JVMA 3UVWA 5C7NA 3SVGA 2DATA 2L85A 3G0LA 4LZ2A 3SVFA 4XY8A 3MXFA 5CP5A 1E6IA 5C8GA 5H1TA 5F1LA 4HBWA 3Q2FA 3MUKA 5E3DA 3UVDA 5EU1A 4QUUA 1ZS5A 5J0DA 5HQ5A 4UIYA 5HFQA 3I3JA 4LYIA 5EWCA 3MB3A 5FFWA 4NYXA 4KCXA 5LVRA 5D25A 3MQMA 4YYHA 5DFCA 5IGMA 4A9JA 5FG5A 4YYKA 4ZW1A 4UIWA 4PKLA 5DFBA 4HXSA 5KTUA 4WHWA 4PS5A 4IR6A 1EQFA 5CQAA 4YAXA 5D3SA 4BW2A 5CUGA 5AD3A 2R0VA 4HXLA 4NYWA 5DYXA 5HFRA 5EPRA 4OGJA 5FE4A 4LRGA 5F1HA 4TS8A 2I8NA 4UYFA 5HRXA 1WUMA 5CQ5A 5F60A 4YY4A 5AMEA 4QR5A 5CQTA 3HMEA 5EM3A 5E9KA 3O37A 4TT6A 4QZSA 5ACYA 4XY9A 5LJ0A 4Z6HA 5DYUA 4YADA 4A9NA 3UV2A 5CFWA 5D7XA 4A9IA 5ENGA 5D0CA 2RNWA 5EVAA 4XUAA 5C4QA 5CPEA 5A83A 4YK0A 2RI7A 4OGIA 2H60A 3LQIA 5CZGA 4HXMA 5TB6A 5KTXA 4OUFA 2D9EA 4YATA 2KTBB 2E7OA 5CUAA 3HMFA 5KHMA 5L99A 3NXBA 2MJVB 4NS5A 5FE7A 4HXNA 5FE8A 3LJWA 2YYNA 4IR4A 4QUTA 4MR5A 4Q0NA 3MB4A 4HXPA 4IORA 5A85A 4N4GA 5HEMA 5EI4A 3MULA 5HENA 4NRAA 5HRWA 4NRBA 4QR4A 4TZ2A 5E3GA 4ZC9A 5A81A 4NUCA 5D3NA 4Z93A 5HQ7A 4MENA 4QNSA 3UW9A 4YYNA 2WP1A
chains in the Genus database with same CATH superfamily
5ENHA 4O7AA 5COIA 4QEUA 4O77A 4TT2A 2YEKA 5FDZA 5CUEA 2OSSA 4BHWA 4YYIA 5EPSA 4E96A 1JM4B 4O7BA 5K29A 4N4HA 5CUBA 4QC1A 5FE2A 5E7DA 4YYJA 2YEMA 5LJ1A 3DWYA 5IGNA 4O74A 5HLSA 2E3KA 4CFKA 2F6NA 5FE6A 4TQNA 5EA1A 4HXKA 4QYLA 5EWHA 5I7XA 4C66A 4CFLA 5F25A 5L98A 4Z6IA 3O34A 5HRVA 4NQNA 5CQ6A 5I40A 2WP2A 4LZRA 4AKIA 5KO4A 5IIDA 5FG4A 4TYLA 4MEQA 5IGKA 5A82A 4NR7A 4YYDA 5HM0A 4O7EA 3DAIA 3P1EA 5L8TA 3QZTA 5E0RA 5E9LA 5A5NA 5CGPA 5I86A 5II2A 3O36A 5E9YA 5TCMA 5KU3A 4CUUA 4A9MA 5L96A 4MR3A 5EPBA 1JSPB 5D3HA 5I7YA 3HMHA 4AI6A 4A9EA 3P1CA 5FB0A 2YELA 4IR5A 5BT3A 4PTBA 5EK9A 3TLPA 5CQ8A 5FE3A 4TZ8A 5JWMA 5L8UA 5KTWA 5DKCA 4UIZA 4NUEA 2OUOA 4IOOA 3U5KA 3GG3A 5A5SA 4UITA 5E9VA 5CQ3A 4TU4A 4PY6A 5HJCA 3JVKA 5EWVA 3UV4A 3IU5A 5A5RA 5F36A 5A7CA 5L97A 3UV5A 5F5ZA 2DVRA 4O76A 2DVSA 5DLZA 4A9FA 3K2JA 4GPJA 5C85A 5FE9A 4QSTA 3S91A 5ETBA 5LJ2A 5EWWA 5FFVA 5FH8A 4NQMA 5JI8A 4YABA 2RFJA 4UIXA 2R0YA 4LR6A 4QSUA 5CY9A 4CLBA 3U5LA 4QEVA 4QR3A 5CRMA 5DYCA 4CUQA 4HBXA 3JVLA 4NRCA 5EGUA 5I80A 5EWDA 4HBVA 3ZYUA 3U5NA 4J0RA 4QSRA 4C67A 3D1BA 5HQ6A 4YY6A 4ALGA 2R0SA 5CTLA 4CUSA 4KV4A 5DW1A 3JVJA 4O70A 4MR6A 1PUOA 5ENJA 2L5EA 4HXOA 4J3IA 4LDFA 4NUDA 4QSXA 4A9HA 5ENEA 4O72A 3P1DA 5E9MA 4NR8A 4UYEA 1WUGA 4O71A 3AQAA 4O7CA 5G4RA 4QSQA 5DX4A 4Q0OA 2DVQA 4XUBA 4AKNA 5CRZA 2RS9B 4QSWA 5LVQA 3S92A 5LKTA 4WIVA 5I29A 5EICA 2R10A 3P5OA 4UIUA 4ZQLA 4A9LA 4YH3A 5EISA 4QEWA 4WHUA 3O33A 3QZVA 4YBMA 1N72A 4O7FA 5DKDA 5ENFA 4O78A 5A5OA 3LQHA 4AKGA 4FLPA 4N4FA 4YC9A 4DONA 5ENIA 4CURA 5CQ7A 1ZKRA 2RNYA 3QZSA 5IBNA 5D3RA 2E7NA 3SVHA 1F68A 4J0SA 5D3LA 5AMFA 3VKGA 5E73A 2DKWA 4UYHA 5LKXA 3IU6A 3ONIA 5DW2A 5IGLA 5I1QA 3U5PA 2L84A 4A9OA 2I7KA 5FE0A 4J1PA 4QB3A 2RO1A 5CUDA 5F63A 2FSAA 4N3WA 5D3TA 4KV1A 4UYFB 5FBXA 2DVVA 5LUUA 5FH7A 4A9KA 4CUPA 3Q2EA 4UIVA 5DY7A 4QSSA 4X2IA 5LKZA 5EP7A 5FE1A 5C87A 3FKMX 2G4AA 4QSVA 4YYMA 4QC3A 2N9GA 3RCWA 4BJXA 2YDWA 4HXRA 2DWWA 4YBSA 5BT5A 3U5MA 4NYVA 5E74A 5FH6A 3P1FA 4LZSA 4NR4A 4PCEA 3UVXA 5H1UA 5HELA 4AKHA 5ETDA 4LYWA 5F61A 3O35A 5ENBA 3UVYA 5DFDA 4MEPA 3G0JA 4BW3A 5I88A 5D26A 5H85A 4QY4A 4MEOA 5F3AA 3LXJA 5FE5A 3U5JA 4N4IA 2YQDA 5D3JA 5EQ1A 1X0JA 4IR3A 5HCLA 4BW1A 5IG6A 2D82A 2LSPB 4Z1SA 2GRCA 4YYGA 2YW5A 4LC2A 5EV9A 3D1DA 4BW4A 5D24A 5A5QA 4RVRA 4UYGA 4TT4A 5FG6A 4YH4A 4NR5A 4IOQA 5G4SA 5A5PA 4TU6A 4CL9A 2OO1A 4LYSA 5CS8A 5DBMA 3U5OA 3D7CA 4XYAA 4NXJA 4QYDA 4NR9A 5ENCA 2RNXA 5DKHA 5FFYA 5I89A 5BT4A 4NR6A 5DYAA 4Y03A 4F3IA 4CUTA 4MR4A 2F6JA 3AADA 5F62A 3LQJA 4PCIA 5II1A 4ALHA 5CUCA 4QSPA 5AD2A 5LKUA 5H1VA 2NXBA 4YBTA 5D3PA 5DLXA 5F2PA 4QBMA 5CU8A 5CQ4A 4O75A 4HBYA 5FB1A 5C89A 5I83A 4Z1QA 4TTEA 5E9IA 4UYDA 3JVMA 3UVWA 2EJNA 5C7NA 3SVGA 2DATA 2L85A 3G0LA 4LZ2A 3ERRA 3SVFA 4XY8A 3MXFA 5CP5A 1E6IA 5C8GA 5H1TA 5F1LA 4HBWA 3Q2FA 3MUKA 5E3DA 3UVDA 5EU1A 4QUUA 1ZS5A 5J0DA 5HQ5A 4UIYA 5HFQA 3I3JA 4LYIA 5EWCA 3MB3A 3VKHA 5FFWA 4NYXA 4KCXA 5LVRA 5D25A 3MQMA 4YYHA 5DFCA 5IGMA 4A9JA 5FG5A 4YYKA 4ZW1A 4UIWA 4PKLA 5DFBA 4HXSA 5KTUA 4WHWA 4PS5A 4IR6A 1EQFA 5CQAA 4YAXA 5D3SA 4BW2A 5CUGA 5AD3A 2R0VA 4HXLA 4NYWA 5DYXA 5HFRA 5EPRA 4OGJA 5FE4A 4LRGA 5F1HA 4TS8A 2I8NA 4UYFA 5HRXA 1WUMA 5CQ5A 5F60A 4YY4A 5AMEA 4QR5A 5CQTA 3HMEA 5EM3A 5E9KA 3O37A 4TT6A 4QZSA 5ACYA 4XY9A 5LJ0A 4Z6HA 5DYUA 4YADA 4A9NA 3UV2A 5CFWA 5D7XA 4A9IA 5ENGA 5D0CA 2RNWA 5EVAA 4XUAA 5C4QA 5CPEA 5A83A 4YK0A 2RI7A 4OGIA 2H60A 3LQIA 5CZGA 4HXMA 5TB6A 5KTXA 4OUFA 2D9EA 4YATA 2KTBB 2E7OA 5CUAA 3HMFA 5KHMA 5L99A 3NXBA 2MJVB 4NS5A 5FE7A 4HXNA 5FE8A 3LJWA 2YYNA 4IR4A 4QUTA 4MR5A 4Q0NA 3MB4A 4HXPA 4IORA 5A85A 4N4GA 5HEMA 5EI4A 3MULA 5HENA 4NRAA 5HRWA 4NRBA 4QR4A 4TZ2A 5E3GA 4ZC9A 5A81A 4NUCA 5D3NA 4Z93A 5HQ7A 4MENA 4QNSA 3UW9A 4YYNA 2WP1A
chains in the Genus database with same CATH topology
5ENHA 4O7AA 5COIA 4QEUA 4O77A 4TT2A 2YEKA 5FDZA 5CUEA 2OSSA 4BHWA 4YYIA 5EPSA 4E96A 1JM4B 4O7BA 5K29A 4N4HA 5CUBA 4QC1A 5FE2A 5E7DA 4YYJA 2YEMA 5LJ1A 3DWYA 5IGNA 4O74A 5HLSA 2E3KA 4CFKA 2F6NA 5FE6A 4TQNA 5EA1A 4HXKA 4QYLA 5EWHA 5I7XA 4C66A 4CFLA 5F25A 5L98A 4Z6IA 3O34A 5HRVA 4NQNA 5CQ6A 5I40A 2WP2A 4LZRA 5KO4A 5IIDA 5FG4A 4TYLA 4MEQA 5IGKA 5A82A 4NR7A 4YYDA 5HM0A 4O7EA 3DAIA 3P1EA 5L8TA 3QZTA 5E0RA 5E9LA 5A5NA 5CGPA 5I86A 5II2A 3O36A 5E9YA 5TCMA 5KU3A 4CUUA 4A9MA 5L96A 4MR3A 5EPBA 1JSPB 5D3HA 5I7YA 3HMHA 4A9EA 3P1CA 5FB0A 2YELA 4IR5A 5BT3A 4PTBA 5EK9A 3TLPA 5CQ8A 5FE3A 4TZ8A 5JWMA 5L8UA 5KTWA 5DKCA 4UIZA 4NUEA 2OUOA 4IOOA 3U5KA 3GG3A 5A5SA 4UITA 5E9VA 5CQ3A 4TU4A 4PY6A 5HJCA 3JVKA 5EWVA 3UV4A 3IU5A 5A5RA 5F36A 5A7CA 5L97A 3UV5A 5F5ZA 2DVRA 4O76A 2DVSA 5DLZA 4A9FA 3K2JA 4GPJA 5C85A 5FE9A 4QSTA 3S91A 5ETBA 5LJ2A 5EWWA 5FFVA 5FH8A 4NQMA 5JI8A 4YABA 2RFJA 4UIXA 2R0YA 4LR6A 4QSUA 5CY9A 4CLBA 3U5LA 4QEVA 4QR3A 5CRMA 5DYCA 4CUQA 4HBXA 3JVLA 4NRCA 5EGUA 5I80A 5EWDA 4HBVA 3ZYUA 3U5NA 4J0RA 4QSRA 4C67A 5HQ6A 4YY6A 4ALGA 2R0SA 5CTLA 4CUSA 4KV4A 5DW1A 3JVJA 4O70A 4MR6A 5ENJA 2L5EA 4HXOA 4J3IA 4LDFA 4NUDA 4QSXA 4A9HA 5ENEA 4O72A 3P1DA 5E9MA 4NR8A 4UYEA 1WUGA 4O71A 3AQAA 4O7CA 5G4RA 4QSQA 5DX4A 4Q0OA 2DVQA 4XUBA 4AKNA 5CRZA 2RS9B 4QSWA 5LVQA 3S92A 5LKTA 4WIVA 5I29A 5EICA 2R10A 3P5OA 4UIUA 4ZQLA 4A9LA 4YH3A 5EISA 4QEWA 4WHUA 3O33A 3QZVA 4YBMA 1N72A 4O7FA 5DKDA 5ENFA 4O78A 5A5OA 3LQHA 4FLPA 4N4FA 4YC9A 4DONA 5ENIA 4CURA 5CQ7A 2RNYA 3QZSA 5IBNA 5D3RA 2E7NA 3SVHA 1F68A 4J0SA 5D3LA 5AMFA 5E73A 2DKWA 4UYHA 5LKXA 3IU6A 3ONIA 5DW2A 5IGLA 5I1QA 3U5PA 2L84A 4A9OA 2I7KA 5FE0A 4J1PA 4QB3A 2RO1A 5CUDA 5F63A 2FSAA 4N3WA 5D3TA 4KV1A 4UYFB 5FBXA 2DVVA 5LUUA 5FH7A 4A9KA 4CUPA 3Q2EA 4UIVA 5DY7A 4QSSA 4X2IA 5LKZA 5EP7A 5FE1A 5C87A 3FKMX 2G4AA 4QSVA 4YYMA 4QC3A 2N9GA 3RCWA 4BJXA 2YDWA 4HXRA 2DWWA 4YBSA 5BT5A 3U5MA 4NYVA 5E74A 5FH6A 3P1FA 4LZSA 4NR4A 4PCEA 3UVXA 5H1UA 5HELA 5ETDA 4LYWA 5F61A 3O35A 5ENBA 3UVYA 5DFDA 4MEPA 3G0JA 4BW3A 5I88A 5D26A 5H85A 4QY4A 4MEOA 5F3AA 3LXJA 5FE5A 3U5JA 4N4IA 2YQDA 5D3JA 5EQ1A 1X0JA 4IR3A 5HCLA 4BW1A 5IG6A 2D82A 2LSPB 4Z1SA 2GRCA 4YYGA 2YW5A 4LC2A 5EV9A 4BW4A 5D24A 5A5QA 4RVRA 4UYGA 4TT4A 5FG6A 4YH4A 4NR5A 4IOQA 5G4SA 5A5PA 4TU6A 4CL9A 2OO1A 4LYSA 5CS8A 5DBMA 3U5OA 3D7CA 4XYAA 4NXJA 4QYDA 4NR9A 5ENCA 2RNXA 5DKHA 5FFYA 5I89A 5BT4A 4NR6A 5DYAA 4Y03A 4F3IA 4CUTA 4MR4A 2F6JA 3AADA 5F62A 3LQJA 4PCIA 5II1A 4ALHA 5CUCA 4QSPA 5AD2A 5LKUA 5H1VA 2NXBA 4YBTA 5D3PA 5DLXA 5F2PA 4QBMA 5CU8A 5CQ4A 4O75A 4HBYA 5FB1A 5C89A 5I83A 4Z1QA 4TTEA 5E9IA 4UYDA 3JVMA 3UVWA 5C7NA 3SVGA 2DATA 2L85A 3G0LA 4LZ2A 3SVFA 4XY8A 3MXFA 5CP5A 1E6IA 5C8GA 5H1TA 5F1LA 4HBWA 3Q2FA 3MUKA 5E3DA 3UVDA 5EU1A 4QUUA 1ZS5A 5J0DA 5HQ5A 4UIYA 5HFQA 3I3JA 4LYIA 5EWCA 3MB3A 5FFWA 4NYXA 4KCXA 5LVRA 5D25A 3MQMA 4YYHA 5DFCA 5IGMA 4A9JA 5FG5A 4YYKA 4ZW1A 4UIWA 4PKLA 5DFBA 4HXSA 5KTUA 4WHWA 4PS5A 4IR6A 1EQFA 5CQAA 4YAXA 5D3SA 4BW2A 5CUGA 5AD3A 2R0VA 4HXLA 4NYWA 5DYXA 5HFRA 5EPRA 4OGJA 5FE4A 4LRGA 5F1HA 4TS8A 2I8NA 4UYFA 5HRXA 1WUMA 5CQ5A 5F60A 4YY4A 5AMEA 4QR5A 5CQTA 3HMEA 5EM3A 5E9KA 3O37A 4TT6A 4QZSA 5ACYA 4XY9A 5LJ0A 4Z6HA 5DYUA 4YADA 4A9NA 3UV2A 5CFWA 5D7XA 4A9IA 5ENGA 5D0CA 2RNWA 5EVAA 4XUAA 5C4QA 5CPEA 5A83A 4YK0A 2RI7A 4OGIA 2H60A 3LQIA 5CZGA 4HXMA 5TB6A 5KTXA 4OUFA 2D9EA 4YATA 2KTBB 2E7OA 5CUAA 3HMFA 5KHMA 5L99A 3NXBA 2MJVB 4NS5A 5FE7A 4HXNA 5FE8A 3LJWA 2YYNA 4IR4A 4QUTA 4MR5A 4Q0NA 3MB4A 4HXPA 4IORA 5A85A 4N4GA 5HEMA 5EI4A 3MULA 5HENA 4NRAA 5HRWA 4NRBA 4QR4A 4TZ2A 5E3GA 4ZC9A 5A81A 4NUCA 5D3NA 4Z93A 5HQ7A 4MENA 4QNSA 3UW9A 4YYNA 2WP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENH A;  4O7A A;  5COI A;  4QEU A;  4O77 A;  4TT2 A;  2YEK A;  5FDZ A;  5CUE A;  2OSS A;  4BHW A;  4YYI A;  5EPS A;  4E96 A;  1JM4 B;  4O7B A;  5K29 A;  4N4H A;  5CUB A;  4QC1 A;  5FE2 A;  5E7D A;  4YYJ A;  2YEM A;  5LJ1 A;  3DWY A;  5IGN A;  4O74 A;  5HLS A;  2E3K A;  4CFK A;  2F6N A;  5FE6 A;  4TQN A;  5EA1 A;  4HXK A;  4QYL A;  5EWH A;  5I7X A;  4C66 A;  4CFL A;  5F25 A;  5L98 A;  4Z6I A;  3O34 A;  5HRV A;  4NQN A;  5CQ6 A;  5I40 A;  2WP2 A;  4LZR A;  5KO4 A;  5IID A;  5FG4 A;  4TYL A;  4MEQ A;  5IGK A;  5A82 A;  4NR7 A;  4YYD A;  5HM0 A;  4O7E A;  3DAI A;  3P1E A;  5L8T A;  3QZT A;  5E0R A;  5E9L A;  5A5N A;  5CGP A;  5I86 A;  5II2 A;  3O36 A;  5E9Y A;  5TCM A;  5KU3 A;  4CUU A;  4A9M A;  5L96 A;  4MR3 A;  5EPB A;  1JSP B;  5D3H A;  5I7Y A;  3HMH A;  4A9E A;  3P1C A;  5FB0 A;  2YEL A;  4IR5 A;  5BT3 A;  4PTB A;  5EK9 A;  3TLP A;  5CQ8 A;  5FE3 A;  4TZ8 A;  5JWM A;  5L8U A;  5KTW A;  5DKC A;  4UIZ A;  4NUE A;  2OUO A;  4IOO A;  3U5K A;  3GG3 A;  5A5S A;  4UIT A;  5E9V A;  5CQ3 A;  4TU4 A;  4PY6 A;  5HJC A;  3JVK A;  5EWV A;  3UV4 A;  3IU5 A;  5A5R A;  5F36 A;  5A7C A;  5L97 A;  3UV5 A;  5F5Z A;  2DVR A;  4O76 A;  2DVS A;  5DLZ A;  4A9F A;  3K2J A;  4GPJ A;  5C85 A;  5FE9 A;  4QST A;  3S91 A;  5ETB A;  5LJ2 A;  5EWW A;  5FFV A;  5FH8 A;  4NQM A;  5JI8 A;  4YAB A;  2RFJ A;  4UIX A;  2R0Y A;  4LR6 A;  4QSU A;  5CY9 A;  4CLB A;  3U5L A;  4QEV A;  4QR3 A;  5CRM A;  5DYC A;  4CUQ A;  4HBX A;  3JVL A;  4NRC A;  5EGU A;  5I80 A;  5EWD A;  4HBV A;  3ZYU A;  3U5N A;  4J0R A;  4QSR A;  4C67 A;  5HQ6 A;  4YY6 A;  4ALG A;  2R0S A;  5CTL A;  4CUS A;  4KV4 A;  5DW1 A;  3JVJ A;  4O70 A;  4MR6 A;  5ENJ A;  2L5E A;  4HXO A;  4J3I A;  4LDF A;  4NUD A;  4QSX A;  4A9H A;  5ENE A;  4O72 A;  3P1D A;  5E9M A;  4NR8 A;  4UYE A;  1WUG A;  4O71 A;  3AQA A;  4O7C A;  5G4R A;  4QSQ A;  5DX4 A;  4Q0O A;  2DVQ A;  4XUB A;  4AKN A;  5CRZ A;  2RS9 B;  4QSW A;  5LVQ A;  3S92 A;  5LKT A;  4WIV A;  5I29 A;  5EIC A;  2R10 A;  3P5O A;  4UIU A;  4ZQL A;  4A9L A;  4YH3 A;  5EIS A;  4QEW A;  4WHU A;  3O33 A;  3QZV A;  4YBM A;  1N72 A;  4O7F A;  5DKD A;  5ENF A;  4O78 A;  5A5O A;  3LQH A;  4FLP A;  4N4F A;  4YC9 A;  4DON A;  5ENI A;  4CUR A;  5CQ7 A;  2RNY A;  3QZS A;  5IBN A;  5D3R A;  2E7N A;  3SVH A;  1F68 A;  4J0S A;  5D3L A;  5AMF A;  5E73 A;  2DKW A;  4UYH A;  5LKX A;  3IU6 A;  3ONI A;  5DW2 A;  5IGL A;  5I1Q A;  3U5P A;  2L84 A;  4A9O A;  2I7K A;  5FE0 A;  4J1P A;  4QB3 A;  2RO1 A;  5CUD A;  5F63 A;  2FSA A;  4N3W A;  5D3T A;  4KV1 A;  4UYF B;  5FBX A;  2DVV A;  5LUU A;  5FH7 A;  4A9K A;  4CUP A;  3Q2E A;  4UIV A;  5DY7 A;  4QSS A;  4X2I A;  5LKZ A;  5EP7 A;  5FE1 A;  5C87 A;  3FKM X;  2G4A A;  4QSV A;  4YYM A;  4QC3 A;  2N9G A;  3RCW A;  4BJX A;  2YDW A;  4HXR A;  2DWW A;  4YBS A;  5BT5 A;  3U5M A;  4NYV A;  5E74 A;  5FH6 A;  3P1F A;  4LZS A;  4NR4 A;  4PCE A;  3UVX A;  5H1U A;  5HEL A;  5ETD A;  4LYW A;  5F61 A;  3O35 A;  5ENB A;  3UVY A;  5DFD A;  4MEP A;  3G0J A;  4BW3 A;  5I88 A;  5D26 A;  5H85 A;  4QY4 A;  4MEO A;  5F3A A;  3LXJ A;  5FE5 A;  3U5J A;  4N4I A;  2YQD A;  5D3J A;  5EQ1 A;  1X0J A;  4IR3 A;  5HCL A;  4BW1 A;  5IG6 A;  2D82 A;  2LSP B;  4Z1S A;  2GRC A;  4YYG A;  2YW5 A;  4LC2 A;  5EV9 A;  4BW4 A;  5D24 A;  5A5Q A;  4RVR A;  4UYG A;  4TT4 A;  5FG6 A;  4YH4 A;  4NR5 A;  4IOQ A;  5G4S A;  5A5P A;  4TU6 A;  4CL9 A;  2OO1 A;  4LYS A;  5CS8 A;  5DBM A;  3U5O A;  3D7C A;  4XYA A;  4NXJ A;  4QYD A;  4NR9 A;  5ENC A;  2RNX A;  5DKH A;  5FFY A;  5I89 A;  5BT4 A;  4NR6 A;  5DYA A;  4Y03 A;  4F3I A;  4CUT A;  4MR4 A;  2F6J A;  3AAD A;  5F62 A;  3LQJ A;  4PCI A;  5II1 A;  4ALH A;  5CUC A;  4QSP A;  5AD2 A;  5LKU A;  5H1V A;  2NXB A;  4YBT A;  5D3P A;  5DLX A;  5F2P A;  4QBM A;  5CU8 A;  5CQ4 A;  4O75 A;  4HBY A;  5FB1 A;  5C89 A;  5I83 A;  4Z1Q A;  4TTE A;  5E9I A;  4UYD A;  3JVM A;  3UVW A;  5C7N A;  3SVG A;  2DAT A;  2L85 A;  3G0L A;  4LZ2 A;  3SVF A;  4XY8 A;  3MXF A;  5CP5 A;  1E6I A;  5C8G A;  5H1T A;  5F1L A;  4HBW A;  3Q2F A;  3MUK A;  5E3D A;  3UVD A;  5EU1 A;  4QUU A;  1ZS5 A;  5J0D A;  5HQ5 A;  4UIY A;  5HFQ A;  3I3J A;  4LYI A;  5EWC A;  3MB3 A;  5FFW A;  4NYX A;  4KCX A;  5LVR A;  5D25 A;  3MQM A;  4YYH A;  5DFC A;  5IGM A;  4A9J A;  5FG5 A;  4YYK A;  4ZW1 A;  4UIW A;  4PKL A;  5DFB A;  4HXS A;  5KTU A;  4WHW A;  4PS5 A;  4IR6 A;  1EQF A;  5CQA A;  4YAX A;  5D3S A;  4BW2 A;  5CUG A;  5AD3 A;  2R0V A;  4HXL A;  4NYW A;  5DYX A;  5HFR A;  5EPR A;  4OGJ A;  5FE4 A;  4LRG A;  5F1H A;  4TS8 A;  2I8N A;  4UYF A;  5HRX A;  1WUM A;  5CQ5 A;  5F60 A;  4YY4 A;  5AME A;  4QR5 A;  5CQT A;  3HME A;  5EM3 A;  5E9K A;  3O37 A;  4TT6 A;  4QZS A;  5ACY A;  4XY9 A;  5LJ0 A;  4Z6H A;  5DYU A;  4YAD A;  4A9N A;  3UV2 A;  5CFW A;  5D7X A;  4A9I A;  5ENG A;  5D0C A;  2RNW A;  5EVA A;  4XUA A;  5C4Q A;  5CPE A;  5A83 A;  4YK0 A;  2RI7 A;  4OGI A;  2H60 A;  3LQI A;  5CZG A;  4HXM A;  5TB6 A;  5KTX A;  4OUF A;  2D9E A;  4YAT A;  2KTB B;  2E7O A;  5CUA A;  3HMF A;  5KHM A;  5L99 A;  3NXB A;  2MJV B;  4NS5 A;  5FE7 A;  4HXN A;  5FE8 A;  3LJW A;  2YYN A;  4IR4 A;  4QUT A;  4MR5 A;  4Q0N A;  3MB4 A;  4HXP A;  4IOR A;  5A85 A;  4N4G A;  5HEM A;  5EI4 A;  3MUL A;  5HEN A;  4NRA A;  5HRW A;  4NRB A;  4QR4 A;  4TZ2 A;  5E3G A;  4ZC9 A;  5A81 A;  4NUC A;  5D3N A;  4Z93 A;  5HQ7 A;  4MEN A;  4QNS A;  3UW9 A;  4YYN A;  2WP1 A; 
#chains in the Genus database with same CATH topology
 5ENH A;  4O7A A;  5COI A;  4QEU A;  4O77 A;  4TT2 A;  2YEK A;  5FDZ A;  5CUE A;  2OSS A;  4BHW A;  4YYI A;  5EPS A;  4E96 A;  1JM4 B;  4O7B A;  5K29 A;  4N4H A;  5CUB A;  4QC1 A;  5FE2 A;  5E7D A;  4YYJ A;  2YEM A;  5LJ1 A;  3DWY A;  5IGN A;  4O74 A;  5HLS A;  2E3K A;  4CFK A;  2F6N A;  5FE6 A;  4TQN A;  5EA1 A;  4HXK A;  4QYL A;  5EWH A;  5I7X A;  4C66 A;  4CFL A;  5F25 A;  5L98 A;  4Z6I A;  3O34 A;  5HRV A;  4NQN A;  5CQ6 A;  5I40 A;  2WP2 A;  4LZR A;  4AKI A;  5KO4 A;  5IID A;  5FG4 A;  4TYL A;  4MEQ A;  5IGK A;  5A82 A;  4NR7 A;  4YYD A;  5HM0 A;  4O7E A;  3DAI A;  3P1E A;  5L8T A;  3QZT A;  5E0R A;  5E9L A;  5A5N A;  5CGP A;  5I86 A;  5II2 A;  3O36 A;  5E9Y A;  5TCM A;  5KU3 A;  4CUU A;  4A9M A;  5L96 A;  4MR3 A;  5EPB A;  1JSP B;  5D3H A;  5I7Y A;  3HMH A;  4AI6 A;  4A9E A;  3P1C A;  5FB0 A;  2YEL A;  4IR5 A;  5BT3 A;  4PTB A;  5EK9 A;  3TLP A;  5CQ8 A;  5FE3 A;  4TZ8 A;  5JWM A;  5L8U A;  5KTW A;  5DKC A;  4UIZ A;  4NUE A;  2OUO A;  4IOO A;  3U5K A;  3GG3 A;  5A5S A;  4UIT A;  5E9V A;  5CQ3 A;  4TU4 A;  4PY6 A;  5HJC A;  3JVK A;  5EWV A;  3UV4 A;  3IU5 A;  5A5R A;  5F36 A;  5A7C A;  5L97 A;  3UV5 A;  5F5Z A;  2DVR A;  4O76 A;  2DVS A;  5DLZ A;  4A9F A;  3K2J A;  4GPJ A;  5C85 A;  5FE9 A;  4QST A;  3S91 A;  5ETB A;  5LJ2 A;  5EWW A;  5FFV A;  5FH8 A;  4NQM A;  5JI8 A;  4YAB A;  2RFJ A;  4UIX A;  2R0Y A;  4LR6 A;  4QSU A;  5CY9 A;  4CLB A;  3U5L A;  4QEV A;  4QR3 A;  5CRM A;  5DYC A;  4CUQ A;  4HBX A;  3JVL A;  4NRC A;  5EGU A;  5I80 A;  5EWD A;  4HBV A;  3ZYU A;  3U5N A;  4J0R A;  4QSR A;  4C67 A;  3D1B A;  5HQ6 A;  4YY6 A;  4ALG A;  2R0S A;  5CTL A;  4CUS A;  4KV4 A;  5DW1 A;  3JVJ A;  4O70 A;  4MR6 A;  1PUO A;  5ENJ A;  2L5E A;  4HXO A;  4J3I A;  4LDF A;  4NUD A;  4QSX A;  4A9H A;  5ENE A;  4O72 A;  3P1D A;  5E9M A;  4NR8 A;  4UYE A;  1WUG A;  4O71 A;  3AQA A;  4O7C A;  5G4R A;  4QSQ A;  5DX4 A;  4Q0O A;  2DVQ A;  4XUB A;  4AKN A;  5CRZ A;  2RS9 B;  4QSW A;  5LVQ A;  3S92 A;  5LKT A;  4WIV A;  5I29 A;  5EIC A;  2R10 A;  3P5O A;  4UIU A;  4ZQL A;  4A9L A;  4YH3 A;  5EIS A;  4QEW A;  4WHU A;  3O33 A;  3QZV A;  4YBM A;  1N72 A;  4O7F A;  5DKD A;  5ENF A;  4O78 A;  5A5O A;  3LQH A;  4AKG A;  4FLP A;  4N4F A;  4YC9 A;  4DON A;  5ENI A;  4CUR A;  5CQ7 A;  1ZKR A;  2RNY A;  3QZS A;  5IBN A;  5D3R A;  2E7N A;  3SVH A;  1F68 A;  4J0S A;  5D3L A;  5AMF A;  3VKG A;  5E73 A;  2DKW A;  4UYH A;  5LKX A;  3IU6 A;  3ONI A;  5DW2 A;  5IGL A;  5I1Q A;  3U5P A;  2L84 A;  4A9O A;  2I7K A;  5FE0 A;  4J1P A;  4QB3 A;  2RO1 A;  5CUD A;  5F63 A;  2FSA A;  4N3W A;  5D3T A;  4KV1 A;  4UYF B;  5FBX A;  2DVV A;  5LUU A;  5FH7 A;  4A9K A;  4CUP A;  3Q2E A;  4UIV A;  5DY7 A;  4QSS A;  4X2I A;  5LKZ A;  5EP7 A;  5FE1 A;  5C87 A;  3FKM X;  2G4A A;  4QSV A;  4YYM A;  4QC3 A;  2N9G A;  3RCW A;  4BJX A;  2YDW A;  4HXR A;  2DWW A;  4YBS A;  5BT5 A;  3U5M A;  4NYV A;  5E74 A;  5FH6 A;  3P1F A;  4LZS A;  4NR4 A;  4PCE A;  3UVX A;  5H1U A;  5HEL A;  4AKH A;  5ETD A;  4LYW A;  5F61 A;  3O35 A;  5ENB A;  3UVY A;  5DFD A;  4MEP A;  3G0J A;  4BW3 A;  5I88 A;  5D26 A;  5H85 A;  4QY4 A;  4MEO A;  5F3A A;  3LXJ A;  5FE5 A;  3U5J A;  4N4I A;  2YQD A;  5D3J A;  5EQ1 A;  1X0J A;  4IR3 A;  5HCL A;  4BW1 A;  5IG6 A;  2D82 A;  2LSP B;  4Z1S A;  2GRC A;  4YYG A;  2YW5 A;  4LC2 A;  5EV9 A;  3D1D A;  4BW4 A;  5D24 A;  5A5Q A;  4RVR A;  4UYG A;  4TT4 A;  5FG6 A;  4YH4 A;  4NR5 A;  4IOQ A;  5G4S A;  5A5P A;  4TU6 A;  4CL9 A;  2OO1 A;  4LYS A;  5CS8 A;  5DBM A;  3U5O A;  3D7C A;  4XYA A;  4NXJ A;  4QYD A;  4NR9 A;  5ENC A;  2RNX A;  5DKH A;  5FFY A;  5I89 A;  5BT4 A;  4NR6 A;  5DYA A;  4Y03 A;  4F3I A;  4CUT A;  4MR4 A;  2F6J A;  3AAD A;  5F62 A;  3LQJ A;  4PCI A;  5II1 A;  4ALH A;  5CUC A;  4QSP A;  5AD2 A;  5LKU A;  5H1V A;  2NXB A;  4YBT A;  5D3P A;  5DLX A;  5F2P A;  4QBM A;  5CU8 A;  5CQ4 A;  4O75 A;  4HBY A;  5FB1 A;  5C89 A;  5I83 A;  4Z1Q A;  4TTE A;  5E9I A;  4UYD A;  3JVM A;  3UVW A;  2EJN A;  5C7N A;  3SVG A;  2DAT A;  2L85 A;  3G0L A;  4LZ2 A;  3ERR A;  3SVF A;  4XY8 A;  3MXF A;  5CP5 A;  1E6I A;  5C8G A;  5H1T A;  5F1L A;  4HBW A;  3Q2F A;  3MUK A;  5E3D A;  3UVD A;  5EU1 A;  4QUU A;  1ZS5 A;  5J0D A;  5HQ5 A;  4UIY A;  5HFQ A;  3I3J A;  4LYI A;  5EWC A;  3MB3 A;  3VKH A;  5FFW A;  4NYX A;  4KCX A;  5LVR A;  5D25 A;  3MQM A;  4YYH A;  5DFC A;  5IGM A;  4A9J A;  5FG5 A;  4YYK A;  4ZW1 A;  4UIW A;  4PKL A;  5DFB A;  4HXS A;  5KTU A;  4WHW A;  4PS5 A;  4IR6 A;  1EQF A;  5CQA A;  4YAX A;  5D3S A;  4BW2 A;  5CUG A;  5AD3 A;  2R0V A;  4HXL A;  4NYW A;  5DYX A;  5HFR A;  5EPR A;  4OGJ A;  5FE4 A;  4LRG A;  5F1H A;  4TS8 A;  2I8N A;  4UYF A;  5HRX A;  1WUM A;  5CQ5 A;  5F60 A;  4YY4 A;  5AME A;  4QR5 A;  5CQT A;  3HME A;  5EM3 A;  5E9K A;  3O37 A;  4TT6 A;  4QZS A;  5ACY A;  4XY9 A;  5LJ0 A;  4Z6H A;  5DYU A;  4YAD A;  4A9N A;  3UV2 A;  5CFW A;  5D7X A;  4A9I A;  5ENG A;  5D0C A;  2RNW A;  5EVA A;  4XUA A;  5C4Q A;  5CPE A;  5A83 A;  4YK0 A;  2RI7 A;  4OGI A;  2H60 A;  3LQI A;  5CZG A;  4HXM A;  5TB6 A;  5KTX A;  4OUF A;  2D9E A;  4YAT A;  2KTB B;  2E7O A;  5CUA A;  3HMF A;  5KHM A;  5L99 A;  3NXB A;  2MJV B;  4NS5 A;  5FE7 A;  4HXN A;  5FE8 A;  3LJW A;  2YYN A;  4IR4 A;  4QUT A;  4MR5 A;  4Q0N A;  3MB4 A;  4HXP A;  4IOR A;  5A85 A;  4N4G A;  5HEM A;  5EI4 A;  3MUL A;  5HEN A;  4NRA A;  5HRW A;  4NRB A;  4QR4 A;  4TZ2 A;  5E3G A;  4ZC9 A;  5A81 A;  4NUC A;  5D3N A;  4Z93 A;  5HQ7 A;  4MEN A;  4QNS A;  3UW9 A;  4YYN A;  2WP1 A; 
#chains in the Genus database with same CATH homology
 5ENH A;  4O7A A;  5COI A;  4QEU A;  4O77 A;  4TT2 A;  2YEK A;  5FDZ A;  5CUE A;  2OSS A;  4BHW A;  4YYI A;  5EPS A;  4E96 A;  1JM4 B;  4O7B A;  5K29 A;  4N4H A;  5CUB A;  4QC1 A;  5FE2 A;  5E7D A;  4YYJ A;  2YEM A;  5LJ1 A;  3DWY A;  5IGN A;  4O74 A;  5HLS A;  2E3K A;  4CFK A;  2F6N A;  5FE6 A;  4TQN A;  5EA1 A;  4HXK A;  4QYL A;  5EWH A;  5I7X A;  4C66 A;  4CFL A;  5F25 A;  5L98 A;  4Z6I A;  3O34 A;  5HRV A;  4NQN A;  5CQ6 A;  5I40 A;  2WP2 A;  4LZR A;  5KO4 A;  5IID A;  5FG4 A;  4TYL A;  4MEQ A;  5IGK A;  5A82 A;  4NR7 A;  4YYD A;  5HM0 A;  4O7E A;  3DAI A;  3P1E A;  5L8T A;  3QZT A;  5E0R A;  5E9L A;  5A5N A;  5CGP A;  5I86 A;  5II2 A;  3O36 A;  5E9Y A;  5TCM A;  5KU3 A;  4CUU A;  4A9M A;  5L96 A;  4MR3 A;  5EPB A;  1JSP B;  5D3H A;  5I7Y A;  3HMH A;  4A9E A;  3P1C A;  5FB0 A;  2YEL A;  4IR5 A;  5BT3 A;  4PTB A;  5EK9 A;  3TLP A;  5CQ8 A;  5FE3 A;  4TZ8 A;  5JWM A;  5L8U A;  5KTW A;  5DKC A;  4UIZ A;  4NUE A;  2OUO A;  4IOO A;  3U5K A;  3GG3 A;  5A5S A;  4UIT A;  5E9V A;  5CQ3 A;  4TU4 A;  4PY6 A;  5HJC A;  3JVK A;  5EWV A;  3UV4 A;  3IU5 A;  5A5R A;  5F36 A;  5A7C A;  5L97 A;  3UV5 A;  5F5Z A;  2DVR A;  4O76 A;  2DVS A;  5DLZ A;  4A9F A;  3K2J A;  4GPJ A;  5C85 A;  5FE9 A;  4QST A;  3S91 A;  5ETB A;  5LJ2 A;  5EWW A;  5FFV A;  5FH8 A;  4NQM A;  5JI8 A;  4YAB A;  2RFJ A;  4UIX A;  2R0Y A;  4LR6 A;  4QSU A;  5CY9 A;  4CLB A;  3U5L A;  4QEV A;  4QR3 A;  5CRM A;  5DYC A;  4CUQ A;  4HBX A;  3JVL A;  4NRC A;  5EGU A;  5I80 A;  5EWD A;  4HBV A;  3ZYU A;  3U5N A;  4J0R A;  4QSR A;  4C67 A;  5HQ6 A;  4YY6 A;  4ALG A;  2R0S A;  5CTL A;  4CUS A;  4KV4 A;  5DW1 A;  3JVJ A;  4O70 A;  4MR6 A;  5ENJ A;  2L5E A;  4HXO A;  4J3I A;  4LDF A;  4NUD A;  4QSX A;  4A9H A;  5ENE A;  4O72 A;  3P1D A;  5E9M A;  4NR8 A;  4UYE A;  1WUG A;  4O71 A;  3AQA A;  4O7C A;  5G4R A;  4QSQ A;  5DX4 A;  4Q0O A;  2DVQ A;  4XUB A;  4AKN A;  5CRZ A;  2RS9 B;  4QSW A;  5LVQ A;  3S92 A;  5LKT A;  4WIV A;  5I29 A;  5EIC A;  2R10 A;  3P5O A;  4UIU A;  4ZQL A;  4A9L A;  4YH3 A;  5EIS A;  4QEW A;  4WHU A;  3O33 A;  3QZV A;  4YBM A;  1N72 A;  4O7F A;  5DKD A;  5ENF A;  4O78 A;  5A5O A;  3LQH A;  4FLP A;  4N4F A;  4YC9 A;  4DON A;  5ENI A;  4CUR A;  5CQ7 A;  2RNY A;  3QZS A;  5IBN A;  5D3R A;  2E7N A;  3SVH A;  1F68 A;  4J0S A;  5D3L A;  5AMF A;  5E73 A;  2DKW A;  4UYH A;  5LKX A;  3IU6 A;  3ONI A;  5DW2 A;  5IGL A;  5I1Q A;  3U5P A;  2L84 A;  4A9O A;  2I7K A;  5FE0 A;  4J1P A;  4QB3 A;  2RO1 A;  5CUD A;  5F63 A;  2FSA A;  4N3W A;  5D3T A;  4KV1 A;  4UYF B;  5FBX A;  2DVV A;  5LUU A;  5FH7 A;  4A9K A;  4CUP A;  3Q2E A;  4UIV A;  5DY7 A;  4QSS A;  4X2I A;  5LKZ A;  5EP7 A;  5FE1 A;  5C87 A;  3FKM X;  2G4A A;  4QSV A;  4YYM A;  4QC3 A;  2N9G A;  3RCW A;  4BJX A;  2YDW A;  4HXR A;  2DWW A;  4YBS A;  5BT5 A;  3U5M A;  4NYV A;  5E74 A;  5FH6 A;  3P1F A;  4LZS A;  4NR4 A;  4PCE A;  3UVX A;  5H1U A;  5HEL A;  5ETD A;  4LYW A;  5F61 A;  3O35 A;  5ENB A;  3UVY A;  5DFD A;  4MEP A;  3G0J A;  4BW3 A;  5I88 A;  5D26 A;  5H85 A;  4QY4 A;  4MEO A;  5F3A A;  3LXJ A;  5FE5 A;  3U5J A;  4N4I A;  2YQD A;  5D3J A;  5EQ1 A;  1X0J A;  4IR3 A;  5HCL A;  4BW1 A;  5IG6 A;  2D82 A;  2LSP B;  4Z1S A;  2GRC A;  4YYG A;  2YW5 A;  4LC2 A;  5EV9 A;  4BW4 A;  5D24 A;  5A5Q A;  4RVR A;  4UYG A;  4TT4 A;  5FG6 A;  4YH4 A;  4NR5 A;  4IOQ A;  5G4S A;  5A5P A;  4TU6 A;  4CL9 A;  2OO1 A;  4LYS A;  5CS8 A;  5DBM A;  3U5O A;  3D7C A;  4XYA A;  4NXJ A;  4QYD A;  4NR9 A;  5ENC A;  2RNX A;  5DKH A;  5FFY A;  5I89 A;  5BT4 A;  4NR6 A;  5DYA A;  4Y03 A;  4F3I A;  4CUT A;  4MR4 A;  2F6J A;  3AAD A;  5F62 A;  3LQJ A;  4PCI A;  5II1 A;  4ALH A;  5CUC A;  4QSP A;  5AD2 A;  5LKU A;  5H1V A;  2NXB A;  4YBT A;  5D3P A;  5DLX A;  5F2P A;  4QBM A;  5CU8 A;  5CQ4 A;  4O75 A;  4HBY A;  5FB1 A;  5C89 A;  5I83 A;  4Z1Q A;  4TTE A;  5E9I A;  4UYD A;  3JVM A;  3UVW A;  5C7N A;  3SVG A;  2DAT A;  2L85 A;  3G0L A;  4LZ2 A;  3SVF A;  4XY8 A;  3MXF A;  5CP5 A;  1E6I A;  5C8G A;  5H1T A;  5F1L A;  4HBW A;  3Q2F A;  3MUK A;  5E3D A;  3UVD A;  5EU1 A;  4QUU A;  1ZS5 A;  5J0D A;  5HQ5 A;  4UIY A;  5HFQ A;  3I3J A;  4LYI A;  5EWC A;  3MB3 A;  5FFW A;  4NYX A;  4KCX A;  5LVR A;  5D25 A;  3MQM A;  4YYH A;  5DFC A;  5IGM A;  4A9J A;  5FG5 A;  4YYK A;  4ZW1 A;  4UIW A;  4PKL A;  5DFB A;  4HXS A;  5KTU A;  4WHW A;  4PS5 A;  4IR6 A;  1EQF A;  5CQA A;  4YAX A;  5D3S A;  4BW2 A;  5CUG A;  5AD3 A;  2R0V A;  4HXL A;  4NYW A;  5DYX A;  5HFR A;  5EPR A;  4OGJ A;  5FE4 A;  4LRG A;  5F1H A;  4TS8 A;  2I8N A;  4UYF A;  5HRX A;  1WUM A;  5CQ5 A;  5F60 A;  4YY4 A;  5AME A;  4QR5 A;  5CQT A;  3HME A;  5EM3 A;  5E9K A;  3O37 A;  4TT6 A;  4QZS A;  5ACY A;  4XY9 A;  5LJ0 A;  4Z6H A;  5DYU A;  4YAD A;  4A9N A;  3UV2 A;  5CFW A;  5D7X A;  4A9I A;  5ENG A;  5D0C A;  2RNW A;  5EVA A;  4XUA A;  5C4Q A;  5CPE A;  5A83 A;  4YK0 A;  2RI7 A;  4OGI A;  2H60 A;  3LQI A;  5CZG A;  4HXM A;  5TB6 A;  5KTX A;  4OUF A;  2D9E A;  4YAT A;  2KTB B;  2E7O A;  5CUA A;  3HMF A;  5KHM A;  5L99 A;  3NXB A;  2MJV B;  4NS5 A;  5FE7 A;  4HXN A;  5FE8 A;  3LJW A;  2YYN A;  4IR4 A;  4QUT A;  4MR5 A;  4Q0N A;  3MB4 A;  4HXP A;  4IOR A;  5A85 A;  4N4G A;  5HEM A;  5EI4 A;  3MUL A;  5HEN A;  4NRA A;  5HRW A;  4NRB A;  4QR4 A;  4TZ2 A;  5E3G A;  4ZC9 A;  5A81 A;  4NUC A;  5D3N A;  4Z93 A;  5HQ7 A;  4MEN A;  4QNS A;  3UW9 A;  4YYN A;  2WP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...