3GG3A

Crystal structure of the bromodomain of human pcaf
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
PDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase PCAF
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3gg3A00
4Z1QA 5EPSA 4UYFB 5EU1A 2YEMA 2OO1A 4QY4A 5CU8A 4OGIA 5ENFA 5E9VA 5HRXA 5C87A 2KTBB 5HQ6A 3SVGA 4WHWA 4ZQLA 5FE8A 5ENJA 4O7CA 4TT6A 5HQ5A 5D24A 4MENA 4CUUA 5LUUA 4UYFA 5D26A 5II1A 4FLPA 4QSXA 4PS5A 2RFJA 2F6JA 5A5OA 4NRAA 4O78A 4LYIA 4IR4A 2I8NA 5D3SA 5L99A 4IOOA 5A5NA 5E73A 5E0RA 5FE7A 4CFKA 3LQIA 5ENCA 2YEKA 5CUDA 5H1UA 5COIA 4GPJA 5ETBA 4QSWA 5DYXA 2OUOA 2G4AA 1N72A 2WP2A 5FE3A 3Q2FA 4HXKA 5H85A 4UIWA 5EWDA 3MXFA 5DFBA 5E3GA 3HMFA 4BW1A 3DWYA 5HCLA 4J0SA 4BHWA 2DWWA 4ZW1A 5FB0A 4UIVA 4LZSA 5ENGA 2DVSA 4QEVA 4UYDA 2R0YA 4XYAA 4TQNA 5FG4A 5EWVA 5L97A 5CQ3A 2YQDA 3UV5A 5IG6A 1WUMA 4CUQA 5CGPA 4YY4A 4O76A 4UIXA 4YYKA 5K29A 5IGNA 3O33A 1ZS5A 3O34A 4F3IA 4YYMA 4A9HA 5ENIA 3P5OA 2DVQA 5DKCA 5EGUA 5C4QA 3SVFA 5CQTA 4OUFA 3FKMX 5FG5A 4Z1SA 4QBMA 5EPBA 2DVRA 4NR4A 5A83A 4LZRA 3S91A 4MR5A 4XY8A 4NR9A 3MB4A 5FE6A 2R10A 5FE2A 5F61A 5CFWA 4QSVA 4HXRA 5DBMA 4XY9A 5D3PA 2E3KA 4IOQA 5EV9A 4NS5A 4UYHA 4YATA 5CQ5A 5I29A 4CUPA 4LDFA 3UVXA 4HBXA 5G4RA 4QSQA 5F62A 5LKUA 4HXLA 5F5ZA 3U5LA 4TU4A 5A5QA 3JVKA 5C89A 4O7AA 5FE0A 4LYSA 3K2JA 5I89A 5EISA 4LYWA 4QR4A 5E9IA 2RNXA 3AADA 5DKHA 4HBYA 3O35A 4TTEA 5LJ0A 5CS8A 5CTLA 5LVQA 3MB3A 5F60A 5EM3A 1X0JA 5JI8A 4TZ2A 4NR5A 5HFQA 2FSAA 5KHMA 5CY9A 4BW3A 5E3DA 4HXPA 2H60A 1E6IA 5HENA 4E96A 4Z93A 4HXOA 4NRCA 3AQAA 5A5RA 4A9EA 3O36A 2LSPB 4KV4A 5FH7A 3JVJA 4QB3A 4N3WA 3S92A 3O37A 3UVYA 4YABA 5CQ6A 5D3RA 3MULA 4MEOA 5II2A 5LKXA 5H1TA 5A85A 3U5MA 4YH4A 5CQAA 5CZGA 4YYNA 4O72A 5L8TA 2RI7A 4NR6A 5ENBA 2L84A 2RS9B 4Z6HA 4J0RA 4NRBA 3GG3A 4PY6A 4A9JA 5D0CA 4N4FA 4PCEA 4J1PA 5CPEA 4CL9A 5I7YA 5TCMA 4QYLA 5FE1A 5F1HA 4NYWA 5LKTA 2R0VA 2RNWA 5E9KA 4QZSA 4NXJA 5I88A 5FE9A 4X2IA 3P1CA 4TT4A 5EWHA 5I1QA 5FDZA 5A82A 5D3LA 3JVMA 3U5OA 2NXBA 5EVAA 1EQFA 3UVDA 4CUSA 4QEUA 5A7CA 4IR5A 5LJ2A 5CUBA 4RVRA 3DAIA 4QEWA 2D9EA 2WP1A 4TYLA 2DATA 5F3AA 5BT5A 5DYUA 3UV2A 4CUTA 3QZVA 4TT2A 5ACYA 4O7BA 5FG6A 4MEPA 5HELA 4TS8A 5TB6A 4A9IA 2YELA 4Q0NA 4A9NA 5BT3A 4LZ2A 4UIYA 2DKWA 5KU3A 2R0SA 3U5KA 4PTBA 5HM0A 4HBVA 5EI4A 5EA1A 4A9MA 5I86A 5DFCA 4O7EA 5HEMA 3NXBA 2DVVA 2YDWA 2RNYA 4NQMA 5HJCA 4Q0OA 5A5SA 4QUTA 4QSSA 5E9YA 4AKNA 5F63A 4UYEA 4UIZA 5F25A 4QC1A 4N4IA 5CQ7A 5HRWA 4ALHA 5D25A 5DLXA 5KTXA 4HXSA 2GRCA 3LQJA 3IU6A 3TLPA 5DYAA 4YYHA 5FBXA 3RCWA 5FE4A 4QR3A 4O7FA 4A9OA 3P1DA 5IGKA 3I3JA 5F2PA 4QSRA 3D7CA 5L98A 5HLSA 4YY6A 5L8UA 4CURA 3JVLA 5E9LA 5FFVA 4C67A 5FE5A 5D3NA 5DW2A 5AD3A 4QUUA 5LJ1A 4Z6IA 4QSUA 4MR6A 2E7OA 4MR3A 1JSPB 5DX4A 4O77A 5J0DA 5ENEA 3IU5A 5F1LA 3U5JA 4NUEA 4YYIA 5EPRA 4QR5A 5IBNA 1JM4B 4YADA 5D3TA 4NR8A 5CUEA 3LQHA 1F68A 3HMHA 5AMEA 4QNSA 2F6NA 5C8GA 5DFDA 2MJVB 5KTWA 5G4SA 5KTUA 4J3IA 3HMEA 4HXMA 4Y03A 2YW5A 5DY7A 5F36A 3LXJA 4O75A 4CFLA 3QZSA 4NYXA 4N4GA 5A5PA 5I83A 4OGJA 5A81A 5I7XA 5FB1A 5I80A 3ZYUA 4IR3A 3G0LA 3P1EA 2OSSA 4QC3A 5IGMA 4ZC9A 5EK9A 5CP5A 4NYVA 4O74A 4NQNA 5DKDA 5FH6A 4YK0A 4DONA 5DLZA 3SVHA 5BT4A 5D7XA 4TZ8A 2E7NA 5ETDA 4A9FA 3U5PA 4HXNA 4KV1A 5ENHA 5KO4A 3Q2EA 4QSPA 4PKLA 3UVWA 5CQ4A 5L96A 5LKZA 3ONIA 4A9KA 4YBSA 4YBTA 4YBMA 1WUGA 3UV4A 4MR4A 4QYDA 3UW9A 2I7KA 4KCXA 4C66A 5HRVA 4PCIA 5DW1A 4CLBA 4QSTA 2RO1A 5DYCA 4O70A 3P1FA 5LVRA 4BW2A 5EWWA 5I40A 4YH3A 4LC2A 5FFYA 4YAXA 4ALGA 5E9MA 5CRMA 5CUGA 5JWMA 3MUKA 4HBWA 5HFRA 4TU6A 4BW4A 5FH8A 2L5EA 4XUBA 4YYJA 4UIUA 5CQ8A 5H1VA 4YYDA 5IIDA 5D3JA 2L85A 5CRZA 3U5NA 4LRGA 3G0JA 5E7DA 5CUAA 4WIVA 5CUCA 4WHUA 4NUDA 4IR6A 5FFWA 5IGLA 5AD2A 5AMFA 3QZTA 5HQ7A 4YYGA 3LJWA 4YC9A 5C7NA 4BJXA 4IORA 2D82A 4NUCA 2N9GA 4MEQA 5D3HA 5EP7A 4N4HA 5EQ1A 4O71A 4A9LA 5C85A 4LR6A 5EWCA 4UYGA 4XUAA 5E74A 5EICA 4NR7A 3MQMA 2YYNA 4UITA
chains in the Genus database with same CATH superfamily
4Z1QA 5EPSA 4UYFB 5EU1A 2YEMA 2OO1A 4QY4A 5CU8A 4OGIA 5ENFA 5E9VA 5HRXA 5C87A 2KTBB 5HQ6A 3SVGA 4WHWA 4ZQLA 5FE8A 5ENJA 4O7CA 4TT6A 5HQ5A 5D24A 4MENA 4CUUA 5LUUA 4UYFA 5D26A 5II1A 4FLPA 4QSXA 4PS5A 2RFJA 2F6JA 5A5OA 4NRAA 4O78A 4LYIA 4IR4A 2I8NA 5D3SA 5L99A 4IOOA 5A5NA 5E73A 5E0RA 5FE7A 4CFKA 3LQIA 5ENCA 2YEKA 5CUDA 5H1UA 4AKHA 5COIA 4GPJA 5ETBA 4QSWA 5DYXA 2OUOA 2G4AA 1N72A 2WP2A 5FE3A 3Q2FA 4HXKA 5H85A 4UIWA 5EWDA 3MXFA 5DFBA 5E3GA 3HMFA 4BW1A 3DWYA 5HCLA 4J0SA 4BHWA 2DWWA 4ZW1A 5FB0A 4UIVA 4LZSA 5ENGA 2DVSA 4AKGA 4QEVA 4UYDA 2R0YA 4XYAA 4TQNA 5FG4A 5EWVA 5L97A 5CQ3A 2YQDA 3UV5A 5IG6A 1WUMA 4CUQA 5CGPA 4YY4A 4O76A 3ERRA 4UIXA 4YYKA 5K29A 5IGNA 3O33A 1ZS5A 3O34A 4F3IA 4YYMA 4A9HA 5ENIA 3P5OA 2DVQA 5DKCA 5EGUA 5C4QA 3SVFA 5CQTA 4OUFA 3FKMX 5FG5A 4Z1SA 4QBMA 5EPBA 2DVRA 4NR4A 5A83A 4LZRA 3S91A 4MR5A 4XY8A 4NR9A 3MB4A 5FE6A 2R10A 5FE2A 5F61A 5CFWA 4QSVA 4HXRA 5DBMA 4XY9A 5D3PA 2E3KA 4IOQA 5EV9A 4NS5A 4UYHA 4YATA 5CQ5A 3VKHA 5I29A 4CUPA 4LDFA 3UVXA 4HBXA 5G4RA 4QSQA 5F62A 5LKUA 4HXLA 5F5ZA 3U5LA 4TU4A 5A5QA 3JVKA 5C89A 4O7AA 5FE0A 4LYSA 3K2JA 5I89A 5EISA 4LYWA 4QR4A 5E9IA 2RNXA 3AADA 5DKHA 4HBYA 3O35A 4TTEA 5LJ0A 5CS8A 5CTLA 5LVQA 3MB3A 5F60A 5EM3A 1X0JA 5JI8A 4TZ2A 4NR5A 5HFQA 2FSAA 5KHMA 5CY9A 4BW3A 5E3DA 4HXPA 2H60A 1E6IA 5HENA 4E96A 3D1DA 4Z93A 4HXOA 4NRCA 3AQAA 5A5RA 4A9EA 3O36A 2LSPB 4KV4A 5FH7A 3JVJA 4QB3A 4N3WA 3S92A 3O37A 3UVYA 4YABA 5CQ6A 5D3RA 3MULA 4MEOA 5II2A 5LKXA 5H1TA 5A85A 3U5MA 4YH4A 5CQAA 5CZGA 4YYNA 4O72A 5L8TA 2RI7A 4NR6A 5ENBA 2L84A 2RS9B 4Z6HA 4J0RA 4NRBA 3GG3A 4PY6A 4A9JA 5D0CA 4N4FA 4PCEA 4J1PA 5CPEA 4CL9A 5I7YA 5TCMA 4QYLA 5FE1A 5F1HA 4NYWA 5LKTA 2R0VA 2RNWA 5E9KA 4QZSA 4NXJA 5I88A 5FE9A 4X2IA 3P1CA 4TT4A 5EWHA 5I1QA 5FDZA 5A82A 5D3LA 3JVMA 3U5OA 4AKIA 2NXBA 2EJNA 5EVAA 1EQFA 3UVDA 4CUSA 4QEUA 5A7CA 4IR5A 5LJ2A 5CUBA 3D1BA 4RVRA 3DAIA 4QEWA 2D9EA 2WP1A 4TYLA 2DATA 5F3AA 5BT5A 5DYUA 3UV2A 4CUTA 3QZVA 4TT2A 5ACYA 4O7BA 5FG6A 4MEPA 5HELA 4TS8A 5TB6A 4A9IA 2YELA 4Q0NA 4A9NA 5BT3A 4LZ2A 4UIYA 2DKWA 5KU3A 2R0SA 3U5KA 4PTBA 5HM0A 4HBVA 5EI4A 5EA1A 4A9MA 5I86A 5DFCA 4O7EA 5HEMA 3NXBA 2DVVA 2YDWA 2RNYA 4NQMA 5HJCA 4Q0OA 5A5SA 4QUTA 4QSSA 5E9YA 4AKNA 5F63A 4UYEA 4UIZA 5F25A 4QC1A 4N4IA 5CQ7A 5HRWA 4ALHA 5D25A 5DLXA 5KTXA 4HXSA 2GRCA 3LQJA 3IU6A 3TLPA 5DYAA 4YYHA 5FBXA 3RCWA 5FE4A 4QR3A 4O7FA 4A9OA 3P1DA 5IGKA 3I3JA 5F2PA 4QSRA 3D7CA 5L98A 5HLSA 4YY6A 5L8UA 4CURA 3JVLA 5E9LA 5FFVA 4C67A 5FE5A 5D3NA 5DW2A 5AD3A 4QUUA 5LJ1A 4Z6IA 4QSUA 4MR6A 2E7OA 4MR3A 1JSPB 5DX4A 4O77A 5J0DA 5ENEA 3IU5A 5F1LA 3U5JA 4NUEA 4YYIA 5EPRA 4QR5A 5IBNA 1JM4B 4YADA 5D3TA 4NR8A 5CUEA 3LQHA 1F68A 3HMHA 5AMEA 4QNSA 2F6NA 5C8GA 5DFDA 2MJVB 5KTWA 5G4SA 5KTUA 4J3IA 3HMEA 4HXMA 4Y03A 2YW5A 5DY7A 5F36A 3LXJA 4O75A 4CFLA 3QZSA 4NYXA 4N4GA 5A5PA 5I83A 4OGJA 5A81A 1PUOA 5I7XA 5FB1A 5I80A 3ZYUA 4IR3A 3G0LA 3P1EA 2OSSA 4QC3A 5IGMA 4ZC9A 5EK9A 5CP5A 1ZKRA 4NYVA 4O74A 4NQNA 5DKDA 5FH6A 4YK0A 4DONA 5DLZA 3SVHA 5BT4A 5D7XA 4TZ8A 2E7NA 5ETDA 4A9FA 3U5PA 4HXNA 4KV1A 5ENHA 5KO4A 3Q2EA 4QSPA 4PKLA 3UVWA 5CQ4A 5L96A 5LKZA 3ONIA 4A9KA 4YBSA 4YBTA 4YBMA 1WUGA 3UV4A 4MR4A 4QYDA 3UW9A 2I7KA 4KCXA 4C66A 5HRVA 4PCIA 5DW1A 4CLBA 4QSTA 2RO1A 5DYCA 4O70A 3P1FA 5LVRA 4BW2A 3VKGA 5EWWA 5I40A 4YH3A 4LC2A 5FFYA 4YAXA 4ALGA 5E9MA 5CRMA 5CUGA 5JWMA 3MUKA 4HBWA 5HFRA 4TU6A 4BW4A 5FH8A 2L5EA 4XUBA 4YYJA 4UIUA 5CQ8A 5H1VA 4YYDA 5IIDA 5D3JA 2L85A 5CRZA 3U5NA 4LRGA 3G0JA 5E7DA 5CUAA 4WIVA 5CUCA 4WHUA 4NUDA 4IR6A 5FFWA 5IGLA 5AD2A 5AMFA 3QZTA 5HQ7A 4YYGA 3LJWA 4YC9A 5C7NA 4BJXA 4IORA 2D82A 4NUCA 2N9GA 4MEQA 5D3HA 5EP7A 4N4HA 5EQ1A 4O71A 4A9LA 5C85A 4LR6A 5EWCA 4UYGA 4XUAA 5E74A 5EICA 4NR7A 3MQMA 2YYNA 4UITA 4AI6A
chains in the Genus database with same CATH topology
4Z1QA 5EPSA 4UYFB 5EU1A 2YEMA 2OO1A 4QY4A 5CU8A 4OGIA 5ENFA 5E9VA 5HRXA 5C87A 2KTBB 5HQ6A 3SVGA 4WHWA 4ZQLA 5FE8A 5ENJA 4O7CA 4TT6A 5HQ5A 5D24A 4MENA 4CUUA 5LUUA 4UYFA 5D26A 5II1A 4FLPA 4QSXA 4PS5A 2RFJA 2F6JA 5A5OA 4NRAA 4O78A 4LYIA 4IR4A 2I8NA 5D3SA 5L99A 4IOOA 5A5NA 5E73A 5E0RA 5FE7A 4CFKA 3LQIA 5ENCA 2YEKA 5CUDA 5H1UA 5COIA 4GPJA 5ETBA 4QSWA 5DYXA 2OUOA 2G4AA 1N72A 2WP2A 5FE3A 3Q2FA 4HXKA 5H85A 4UIWA 5EWDA 3MXFA 5DFBA 5E3GA 3HMFA 4BW1A 3DWYA 5HCLA 4J0SA 4BHWA 2DWWA 4ZW1A 5FB0A 4UIVA 4LZSA 5ENGA 2DVSA 4QEVA 4UYDA 2R0YA 4XYAA 4TQNA 5FG4A 5EWVA 5L97A 5CQ3A 2YQDA 3UV5A 5IG6A 1WUMA 4CUQA 5CGPA 4YY4A 4O76A 4UIXA 4YYKA 5K29A 5IGNA 3O33A 1ZS5A 3O34A 4F3IA 4YYMA 4A9HA 5ENIA 3P5OA 2DVQA 5DKCA 5EGUA 5C4QA 3SVFA 5CQTA 4OUFA 3FKMX 5FG5A 4Z1SA 4QBMA 5EPBA 2DVRA 4NR4A 5A83A 4LZRA 3S91A 4MR5A 4XY8A 4NR9A 3MB4A 5FE6A 2R10A 5FE2A 5F61A 5CFWA 4QSVA 4HXRA 5DBMA 4XY9A 5D3PA 2E3KA 4IOQA 5EV9A 4NS5A 4UYHA 4YATA 5CQ5A 5I29A 4CUPA 4LDFA 3UVXA 4HBXA 5G4RA 4QSQA 5F62A 5LKUA 4HXLA 5F5ZA 3U5LA 4TU4A 5A5QA 3JVKA 5C89A 4O7AA 5FE0A 4LYSA 3K2JA 5I89A 5EISA 4LYWA 4QR4A 5E9IA 2RNXA 3AADA 5DKHA 4HBYA 3O35A 4TTEA 5LJ0A 5CS8A 5CTLA 5LVQA 3MB3A 5F60A 5EM3A 1X0JA 5JI8A 4TZ2A 4NR5A 5HFQA 2FSAA 5KHMA 5CY9A 4BW3A 5E3DA 4HXPA 2H60A 1E6IA 5HENA 4E96A 4Z93A 4HXOA 4NRCA 3AQAA 5A5RA 4A9EA 3O36A 2LSPB 4KV4A 5FH7A 3JVJA 4QB3A 4N3WA 3S92A 3O37A 3UVYA 4YABA 5CQ6A 5D3RA 3MULA 4MEOA 5II2A 5LKXA 5H1TA 5A85A 3U5MA 4YH4A 5CQAA 5CZGA 4YYNA 4O72A 5L8TA 2RI7A 4NR6A 5ENBA 2L84A 2RS9B 4Z6HA 4J0RA 4NRBA 3GG3A 4PY6A 4A9JA 5D0CA 4N4FA 4PCEA 4J1PA 5CPEA 4CL9A 5I7YA 5TCMA 4QYLA 5FE1A 5F1HA 4NYWA 5LKTA 2R0VA 2RNWA 5E9KA 4QZSA 4NXJA 5I88A 5FE9A 4X2IA 3P1CA 4TT4A 5EWHA 5I1QA 5FDZA 5A82A 5D3LA 3JVMA 3U5OA 2NXBA 5EVAA 1EQFA 3UVDA 4CUSA 4QEUA 5A7CA 4IR5A 5LJ2A 5CUBA 4RVRA 3DAIA 4QEWA 2D9EA 2WP1A 4TYLA 2DATA 5F3AA 5BT5A 5DYUA 3UV2A 4CUTA 3QZVA 4TT2A 5ACYA 4O7BA 5FG6A 4MEPA 5HELA 4TS8A 5TB6A 4A9IA 2YELA 4Q0NA 4A9NA 5BT3A 4LZ2A 4UIYA 2DKWA 5KU3A 2R0SA 3U5KA 4PTBA 5HM0A 4HBVA 5EI4A 5EA1A 4A9MA 5I86A 5DFCA 4O7EA 5HEMA 3NXBA 2DVVA 2YDWA 2RNYA 4NQMA 5HJCA 4Q0OA 5A5SA 4QUTA 4QSSA 5E9YA 4AKNA 5F63A 4UYEA 4UIZA 5F25A 4QC1A 4N4IA 5CQ7A 5HRWA 4ALHA 5D25A 5DLXA 5KTXA 4HXSA 2GRCA 3LQJA 3IU6A 3TLPA 5DYAA 4YYHA 5FBXA 3RCWA 5FE4A 4QR3A 4O7FA 4A9OA 3P1DA 5IGKA 3I3JA 5F2PA 4QSRA 3D7CA 5L98A 5HLSA 4YY6A 5L8UA 4CURA 3JVLA 5E9LA 5FFVA 4C67A 5FE5A 5D3NA 5DW2A 5AD3A 4QUUA 5LJ1A 4Z6IA 4QSUA 4MR6A 2E7OA 4MR3A 1JSPB 5DX4A 4O77A 5J0DA 5ENEA 3IU5A 5F1LA 3U5JA 4NUEA 4YYIA 5EPRA 4QR5A 5IBNA 1JM4B 4YADA 5D3TA 4NR8A 5CUEA 3LQHA 1F68A 3HMHA 5AMEA 4QNSA 2F6NA 5C8GA 5DFDA 2MJVB 5KTWA 5G4SA 5KTUA 4J3IA 3HMEA 4HXMA 4Y03A 2YW5A 5DY7A 5F36A 3LXJA 4O75A 4CFLA 3QZSA 4NYXA 4N4GA 5A5PA 5I83A 4OGJA 5A81A 5I7XA 5FB1A 5I80A 3ZYUA 4IR3A 3G0LA 3P1EA 2OSSA 4QC3A 5IGMA 4ZC9A 5EK9A 5CP5A 4NYVA 4O74A 4NQNA 5DKDA 5FH6A 4YK0A 4DONA 5DLZA 3SVHA 5BT4A 5D7XA 4TZ8A 2E7NA 5ETDA 4A9FA 3U5PA 4HXNA 4KV1A 5ENHA 5KO4A 3Q2EA 4QSPA 4PKLA 3UVWA 5CQ4A 5L96A 5LKZA 3ONIA 4A9KA 4YBSA 4YBTA 4YBMA 1WUGA 3UV4A 4MR4A 4QYDA 3UW9A 2I7KA 4KCXA 4C66A 5HRVA 4PCIA 5DW1A 4CLBA 4QSTA 2RO1A 5DYCA 4O70A 3P1FA 5LVRA 4BW2A 5EWWA 5I40A 4YH3A 4LC2A 5FFYA 4YAXA 4ALGA 5E9MA 5CRMA 5CUGA 5JWMA 3MUKA 4HBWA 5HFRA 4TU6A 4BW4A 5FH8A 2L5EA 4XUBA 4YYJA 4UIUA 5CQ8A 5H1VA 4YYDA 5IIDA 5D3JA 2L85A 5CRZA 3U5NA 4LRGA 3G0JA 5E7DA 5CUAA 4WIVA 5CUCA 4WHUA 4NUDA 4IR6A 5FFWA 5IGLA 5AD2A 5AMFA 3QZTA 5HQ7A 4YYGA 3LJWA 4YC9A 5C7NA 4BJXA 4IORA 2D82A 4NUCA 2N9GA 4MEQA 5D3HA 5EP7A 4N4HA 5EQ1A 4O71A 4A9LA 5C85A 4LR6A 5EWCA 4UYGA 4XUAA 5E74A 5EICA 4NR7A 3MQMA 2YYNA 4UITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1Q A;  5EPS A;  4UYF B;  5EU1 A;  2YEM A;  2OO1 A;  4QY4 A;  5CU8 A;  4OGI A;  5ENF A;  5E9V A;  5HRX A;  5C87 A;  2KTB B;  5HQ6 A;  3SVG A;  4WHW A;  4ZQL A;  5FE8 A;  5ENJ A;  4O7C A;  4TT6 A;  5HQ5 A;  5D24 A;  4MEN A;  4CUU A;  5LUU A;  4UYF A;  5D26 A;  5II1 A;  4FLP A;  4QSX A;  4PS5 A;  2RFJ A;  2F6J A;  5A5O A;  4NRA A;  4O78 A;  4LYI A;  4IR4 A;  2I8N A;  5D3S A;  5L99 A;  4IOO A;  5A5N A;  5E73 A;  5E0R A;  5FE7 A;  4CFK A;  3LQI A;  5ENC A;  2YEK A;  5CUD A;  5H1U A;  5COI A;  4GPJ A;  5ETB A;  4QSW A;  5DYX A;  2OUO A;  2G4A A;  1N72 A;  2WP2 A;  5FE3 A;  3Q2F A;  4HXK A;  5H85 A;  4UIW A;  5EWD A;  3MXF A;  5DFB A;  5E3G A;  3HMF A;  4BW1 A;  3DWY A;  5HCL A;  4J0S A;  4BHW A;  2DWW A;  4ZW1 A;  5FB0 A;  4UIV A;  4LZS A;  5ENG A;  2DVS A;  4QEV A;  4UYD A;  2R0Y A;  4XYA A;  4TQN A;  5FG4 A;  5EWV A;  5L97 A;  5CQ3 A;  2YQD A;  3UV5 A;  5IG6 A;  1WUM A;  4CUQ A;  5CGP A;  4YY4 A;  4O76 A;  4UIX A;  4YYK A;  5K29 A;  5IGN A;  3O33 A;  1ZS5 A;  3O34 A;  4F3I A;  4YYM A;  4A9H A;  5ENI A;  3P5O A;  2DVQ A;  5DKC A;  5EGU A;  5C4Q A;  3SVF A;  5CQT A;  4OUF A;  3FKM X;  5FG5 A;  4Z1S A;  4QBM A;  5EPB A;  2DVR A;  4NR4 A;  5A83 A;  4LZR A;  3S91 A;  4MR5 A;  4XY8 A;  4NR9 A;  3MB4 A;  5FE6 A;  2R10 A;  5FE2 A;  5F61 A;  5CFW A;  4QSV A;  4HXR A;  5DBM A;  4XY9 A;  5D3P A;  2E3K A;  4IOQ A;  5EV9 A;  4NS5 A;  4UYH A;  4YAT A;  5CQ5 A;  5I29 A;  4CUP A;  4LDF A;  3UVX A;  4HBX A;  5G4R A;  4QSQ A;  5F62 A;  5LKU A;  4HXL A;  5F5Z A;  3U5L A;  4TU4 A;  5A5Q A;  3JVK A;  5C89 A;  4O7A A;  5FE0 A;  4LYS A;  3K2J A;  5I89 A;  5EIS A;  4LYW A;  4QR4 A;  5E9I A;  2RNX A;  3AAD A;  5DKH A;  4HBY A;  3O35 A;  4TTE A;  5LJ0 A;  5CS8 A;  5CTL A;  5LVQ A;  3MB3 A;  5F60 A;  5EM3 A;  1X0J A;  5JI8 A;  4TZ2 A;  4NR5 A;  5HFQ A;  2FSA A;  5KHM A;  5CY9 A;  4BW3 A;  5E3D A;  4HXP A;  2H60 A;  1E6I A;  5HEN A;  4E96 A;  4Z93 A;  4HXO A;  4NRC A;  3AQA A;  5A5R A;  4A9E A;  3O36 A;  2LSP B;  4KV4 A;  5FH7 A;  3JVJ A;  4QB3 A;  4N3W A;  3S92 A;  3O37 A;  3UVY A;  4YAB A;  5CQ6 A;  5D3R A;  3MUL A;  4MEO A;  5II2 A;  5LKX A;  5H1T A;  5A85 A;  3U5M A;  4YH4 A;  5CQA A;  5CZG A;  4YYN A;  4O72 A;  5L8T A;  2RI7 A;  4NR6 A;  5ENB A;  2L84 A;  2RS9 B;  4Z6H A;  4J0R A;  4NRB A;  3GG3 A;  4PY6 A;  4A9J A;  5D0C A;  4N4F A;  4PCE A;  4J1P A;  5CPE A;  4CL9 A;  5I7Y A;  5TCM A;  4QYL A;  5FE1 A;  5F1H A;  4NYW A;  5LKT A;  2R0V A;  2RNW A;  5E9K A;  4QZS A;  4NXJ A;  5I88 A;  5FE9 A;  4X2I A;  3P1C A;  4TT4 A;  5EWH A;  5I1Q A;  5FDZ A;  5A82 A;  5D3L A;  3JVM A;  3U5O A;  2NXB A;  5EVA A;  1EQF A;  3UVD A;  4CUS A;  4QEU A;  5A7C A;  4IR5 A;  5LJ2 A;  5CUB A;  4RVR A;  3DAI A;  4QEW A;  2D9E A;  2WP1 A;  4TYL A;  2DAT A;  5F3A A;  5BT5 A;  5DYU A;  3UV2 A;  4CUT A;  3QZV A;  4TT2 A;  5ACY A;  4O7B A;  5FG6 A;  4MEP A;  5HEL A;  4TS8 A;  5TB6 A;  4A9I A;  2YEL A;  4Q0N A;  4A9N A;  5BT3 A;  4LZ2 A;  4UIY A;  2DKW A;  5KU3 A;  2R0S A;  3U5K A;  4PTB A;  5HM0 A;  4HBV A;  5EI4 A;  5EA1 A;  4A9M A;  5I86 A;  5DFC A;  4O7E A;  5HEM A;  3NXB A;  2DVV A;  2YDW A;  2RNY A;  4NQM A;  5HJC A;  4Q0O A;  5A5S A;  4QUT A;  4QSS A;  5E9Y A;  4AKN A;  5F63 A;  4UYE A;  4UIZ A;  5F25 A;  4QC1 A;  4N4I A;  5CQ7 A;  5HRW A;  4ALH A;  5D25 A;  5DLX A;  5KTX A;  4HXS A;  2GRC A;  3LQJ A;  3IU6 A;  3TLP A;  5DYA A;  4YYH A;  5FBX A;  3RCW A;  5FE4 A;  4QR3 A;  4O7F A;  4A9O A;  3P1D A;  5IGK A;  3I3J A;  5F2P A;  4QSR A;  3D7C A;  5L98 A;  5HLS A;  4YY6 A;  5L8U A;  4CUR A;  3JVL A;  5E9L A;  5FFV A;  4C67 A;  5FE5 A;  5D3N A;  5DW2 A;  5AD3 A;  4QUU A;  5LJ1 A;  4Z6I A;  4QSU A;  4MR6 A;  2E7O A;  4MR3 A;  1JSP B;  5DX4 A;  4O77 A;  5J0D A;  5ENE A;  3IU5 A;  5F1L A;  3U5J A;  4NUE A;  4YYI A;  5EPR A;  4QR5 A;  5IBN A;  1JM4 B;  4YAD A;  5D3T A;  4NR8 A;  5CUE A;  3LQH A;  1F68 A;  3HMH A;  5AME A;  4QNS A;  2F6N A;  5C8G A;  5DFD A;  2MJV B;  5KTW A;  5G4S A;  5KTU A;  4J3I A;  3HME A;  4HXM A;  4Y03 A;  2YW5 A;  5DY7 A;  5F36 A;  3LXJ A;  4O75 A;  4CFL A;  3QZS A;  4NYX A;  4N4G A;  5A5P A;  5I83 A;  4OGJ A;  5A81 A;  5I7X A;  5FB1 A;  5I80 A;  3ZYU A;  4IR3 A;  3G0L A;  3P1E A;  2OSS A;  4QC3 A;  5IGM A;  4ZC9 A;  5EK9 A;  5CP5 A;  4NYV A;  4O74 A;  4NQN A;  5DKD A;  5FH6 A;  4YK0 A;  4DON A;  5DLZ A;  3SVH A;  5BT4 A;  5D7X A;  4TZ8 A;  2E7N A;  5ETD A;  4A9F A;  3U5P A;  4HXN A;  4KV1 A;  5ENH A;  5KO4 A;  3Q2E A;  4QSP A;  4PKL A;  3UVW A;  5CQ4 A;  5L96 A;  5LKZ A;  3ONI A;  4A9K A;  4YBS A;  4YBT A;  4YBM A;  1WUG A;  3UV4 A;  4MR4 A;  4QYD A;  3UW9 A;  2I7K A;  4KCX A;  4C66 A;  5HRV A;  4PCI A;  5DW1 A;  4CLB A;  4QST A;  2RO1 A;  5DYC A;  4O70 A;  3P1F A;  5LVR A;  4BW2 A;  5EWW A;  5I40 A;  4YH3 A;  4LC2 A;  5FFY A;  4YAX A;  4ALG A;  5E9M A;  5CRM A;  5CUG A;  5JWM A;  3MUK A;  4HBW A;  5HFR A;  4TU6 A;  4BW4 A;  5FH8 A;  2L5E A;  4XUB A;  4YYJ A;  4UIU A;  5CQ8 A;  5H1V A;  4YYD A;  5IID A;  5D3J A;  2L85 A;  5CRZ A;  3U5N A;  4LRG A;  3G0J A;  5E7D A;  5CUA A;  4WIV A;  5CUC A;  4WHU A;  4NUD A;  4IR6 A;  5FFW A;  5IGL A;  5AD2 A;  5AMF A;  3QZT A;  5HQ7 A;  4YYG A;  3LJW A;  4YC9 A;  5C7N A;  4BJX A;  4IOR A;  2D82 A;  4NUC A;  2N9G A;  4MEQ A;  5D3H A;  5EP7 A;  4N4H A;  5EQ1 A;  4O71 A;  4A9L A;  5C85 A;  4LR6 A;  5EWC A;  4UYG A;  4XUA A;  5E74 A;  5EIC A;  4NR7 A;  3MQM A;  2YYN A;  4UIT A; 
#chains in the Genus database with same CATH topology
 4Z1Q A;  5EPS A;  4UYF B;  5EU1 A;  2YEM A;  2OO1 A;  4QY4 A;  5CU8 A;  4OGI A;  5ENF A;  5E9V A;  5HRX A;  5C87 A;  2KTB B;  5HQ6 A;  3SVG A;  4WHW A;  4ZQL A;  5FE8 A;  5ENJ A;  4O7C A;  4TT6 A;  5HQ5 A;  5D24 A;  4MEN A;  4CUU A;  5LUU A;  4UYF A;  5D26 A;  5II1 A;  4FLP A;  4QSX A;  4PS5 A;  2RFJ A;  2F6J A;  5A5O A;  4NRA A;  4O78 A;  4LYI A;  4IR4 A;  2I8N A;  5D3S A;  5L99 A;  4IOO A;  5A5N A;  5E73 A;  5E0R A;  5FE7 A;  4CFK A;  3LQI A;  5ENC A;  2YEK A;  5CUD A;  5H1U A;  4AKH A;  5COI A;  4GPJ A;  5ETB A;  4QSW A;  5DYX A;  2OUO A;  2G4A A;  1N72 A;  2WP2 A;  5FE3 A;  3Q2F A;  4HXK A;  5H85 A;  4UIW A;  5EWD A;  3MXF A;  5DFB A;  5E3G A;  3HMF A;  4BW1 A;  3DWY A;  5HCL A;  4J0S A;  4BHW A;  2DWW A;  4ZW1 A;  5FB0 A;  4UIV A;  4LZS A;  5ENG A;  2DVS A;  4AKG A;  4QEV A;  4UYD A;  2R0Y A;  4XYA A;  4TQN A;  5FG4 A;  5EWV A;  5L97 A;  5CQ3 A;  2YQD A;  3UV5 A;  5IG6 A;  1WUM A;  4CUQ A;  5CGP A;  4YY4 A;  4O76 A;  3ERR A;  4UIX A;  4YYK A;  5K29 A;  5IGN A;  3O33 A;  1ZS5 A;  3O34 A;  4F3I A;  4YYM A;  4A9H A;  5ENI A;  3P5O A;  2DVQ A;  5DKC A;  5EGU A;  5C4Q A;  3SVF A;  5CQT A;  4OUF A;  3FKM X;  5FG5 A;  4Z1S A;  4QBM A;  5EPB A;  2DVR A;  4NR4 A;  5A83 A;  4LZR A;  3S91 A;  4MR5 A;  4XY8 A;  4NR9 A;  3MB4 A;  5FE6 A;  2R10 A;  5FE2 A;  5F61 A;  5CFW A;  4QSV A;  4HXR A;  5DBM A;  4XY9 A;  5D3P A;  2E3K A;  4IOQ A;  5EV9 A;  4NS5 A;  4UYH A;  4YAT A;  5CQ5 A;  3VKH A;  5I29 A;  4CUP A;  4LDF A;  3UVX A;  4HBX A;  5G4R A;  4QSQ A;  5F62 A;  5LKU A;  4HXL A;  5F5Z A;  3U5L A;  4TU4 A;  5A5Q A;  3JVK A;  5C89 A;  4O7A A;  5FE0 A;  4LYS A;  3K2J A;  5I89 A;  5EIS A;  4LYW A;  4QR4 A;  5E9I A;  2RNX A;  3AAD A;  5DKH A;  4HBY A;  3O35 A;  4TTE A;  5LJ0 A;  5CS8 A;  5CTL A;  5LVQ A;  3MB3 A;  5F60 A;  5EM3 A;  1X0J A;  5JI8 A;  4TZ2 A;  4NR5 A;  5HFQ A;  2FSA A;  5KHM A;  5CY9 A;  4BW3 A;  5E3D A;  4HXP A;  2H60 A;  1E6I A;  5HEN A;  4E96 A;  3D1D A;  4Z93 A;  4HXO A;  4NRC A;  3AQA A;  5A5R A;  4A9E A;  3O36 A;  2LSP B;  4KV4 A;  5FH7 A;  3JVJ A;  4QB3 A;  4N3W A;  3S92 A;  3O37 A;  3UVY A;  4YAB A;  5CQ6 A;  5D3R A;  3MUL A;  4MEO A;  5II2 A;  5LKX A;  5H1T A;  5A85 A;  3U5M A;  4YH4 A;  5CQA A;  5CZG A;  4YYN A;  4O72 A;  5L8T A;  2RI7 A;  4NR6 A;  5ENB A;  2L84 A;  2RS9 B;  4Z6H A;  4J0R A;  4NRB A;  3GG3 A;  4PY6 A;  4A9J A;  5D0C A;  4N4F A;  4PCE A;  4J1P A;  5CPE A;  4CL9 A;  5I7Y A;  5TCM A;  4QYL A;  5FE1 A;  5F1H A;  4NYW A;  5LKT A;  2R0V A;  2RNW A;  5E9K A;  4QZS A;  4NXJ A;  5I88 A;  5FE9 A;  4X2I A;  3P1C A;  4TT4 A;  5EWH A;  5I1Q A;  5FDZ A;  5A82 A;  5D3L A;  3JVM A;  3U5O A;  4AKI A;  2NXB A;  2EJN A;  5EVA A;  1EQF A;  3UVD A;  4CUS A;  4QEU A;  5A7C A;  4IR5 A;  5LJ2 A;  5CUB A;  3D1B A;  4RVR A;  3DAI A;  4QEW A;  2D9E A;  2WP1 A;  4TYL A;  2DAT A;  5F3A A;  5BT5 A;  5DYU A;  3UV2 A;  4CUT A;  3QZV A;  4TT2 A;  5ACY A;  4O7B A;  5FG6 A;  4MEP A;  5HEL A;  4TS8 A;  5TB6 A;  4A9I A;  2YEL A;  4Q0N A;  4A9N A;  5BT3 A;  4LZ2 A;  4UIY A;  2DKW A;  5KU3 A;  2R0S A;  3U5K A;  4PTB A;  5HM0 A;  4HBV A;  5EI4 A;  5EA1 A;  4A9M A;  5I86 A;  5DFC A;  4O7E A;  5HEM A;  3NXB A;  2DVV A;  2YDW A;  2RNY A;  4NQM A;  5HJC A;  4Q0O A;  5A5S A;  4QUT A;  4QSS A;  5E9Y A;  4AKN A;  5F63 A;  4UYE A;  4UIZ A;  5F25 A;  4QC1 A;  4N4I A;  5CQ7 A;  5HRW A;  4ALH A;  5D25 A;  5DLX A;  5KTX A;  4HXS A;  2GRC A;  3LQJ A;  3IU6 A;  3TLP A;  5DYA A;  4YYH A;  5FBX A;  3RCW A;  5FE4 A;  4QR3 A;  4O7F A;  4A9O A;  3P1D A;  5IGK A;  3I3J A;  5F2P A;  4QSR A;  3D7C A;  5L98 A;  5HLS A;  4YY6 A;  5L8U A;  4CUR A;  3JVL A;  5E9L A;  5FFV A;  4C67 A;  5FE5 A;  5D3N A;  5DW2 A;  5AD3 A;  4QUU A;  5LJ1 A;  4Z6I A;  4QSU A;  4MR6 A;  2E7O A;  4MR3 A;  1JSP B;  5DX4 A;  4O77 A;  5J0D A;  5ENE A;  3IU5 A;  5F1L A;  3U5J A;  4NUE A;  4YYI A;  5EPR A;  4QR5 A;  5IBN A;  1JM4 B;  4YAD A;  5D3T A;  4NR8 A;  5CUE A;  3LQH A;  1F68 A;  3HMH A;  5AME A;  4QNS A;  2F6N A;  5C8G A;  5DFD A;  2MJV B;  5KTW A;  5G4S A;  5KTU A;  4J3I A;  3HME A;  4HXM A;  4Y03 A;  2YW5 A;  5DY7 A;  5F36 A;  3LXJ A;  4O75 A;  4CFL A;  3QZS A;  4NYX A;  4N4G A;  5A5P A;  5I83 A;  4OGJ A;  5A81 A;  1PUO A;  5I7X A;  5FB1 A;  5I80 A;  3ZYU A;  4IR3 A;  3G0L A;  3P1E A;  2OSS A;  4QC3 A;  5IGM A;  4ZC9 A;  5EK9 A;  5CP5 A;  1ZKR A;  4NYV A;  4O74 A;  4NQN A;  5DKD A;  5FH6 A;  4YK0 A;  4DON A;  5DLZ A;  3SVH A;  5BT4 A;  5D7X A;  4TZ8 A;  2E7N A;  5ETD A;  4A9F A;  3U5P A;  4HXN A;  4KV1 A;  5ENH A;  5KO4 A;  3Q2E A;  4QSP A;  4PKL A;  3UVW A;  5CQ4 A;  5L96 A;  5LKZ A;  3ONI A;  4A9K A;  4YBS A;  4YBT A;  4YBM A;  1WUG A;  3UV4 A;  4MR4 A;  4QYD A;  3UW9 A;  2I7K A;  4KCX A;  4C66 A;  5HRV A;  4PCI A;  5DW1 A;  4CLB A;  4QST A;  2RO1 A;  5DYC A;  4O70 A;  3P1F A;  5LVR A;  4BW2 A;  3VKG A;  5EWW A;  5I40 A;  4YH3 A;  4LC2 A;  5FFY A;  4YAX A;  4ALG A;  5E9M A;  5CRM A;  5CUG A;  5JWM A;  3MUK A;  4HBW A;  5HFR A;  4TU6 A;  4BW4 A;  5FH8 A;  2L5E A;  4XUB A;  4YYJ A;  4UIU A;  5CQ8 A;  5H1V A;  4YYD A;  5IID A;  5D3J A;  2L85 A;  5CRZ A;  3U5N A;  4LRG A;  3G0J A;  5E7D A;  5CUA A;  4WIV A;  5CUC A;  4WHU A;  4NUD A;  4IR6 A;  5FFW A;  5IGL A;  5AD2 A;  5AMF A;  3QZT A;  5HQ7 A;  4YYG A;  3LJW A;  4YC9 A;  5C7N A;  4BJX A;  4IOR A;  2D82 A;  4NUC A;  2N9G A;  4MEQ A;  5D3H A;  5EP7 A;  4N4H A;  5EQ1 A;  4O71 A;  4A9L A;  5C85 A;  4LR6 A;  5EWC A;  4UYG A;  4XUA A;  5E74 A;  5EIC A;  4NR7 A;  3MQM A;  2YYN A;  4UIT A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 4Z1Q A;  5EPS A;  4UYF B;  5EU1 A;  2YEM A;  2OO1 A;  4QY4 A;  5CU8 A;  4OGI A;  5ENF A;  5E9V A;  5HRX A;  5C87 A;  2KTB B;  5HQ6 A;  3SVG A;  4WHW A;  4ZQL A;  5FE8 A;  5ENJ A;  4O7C A;  4TT6 A;  5HQ5 A;  5D24 A;  4MEN A;  4CUU A;  5LUU A;  4UYF A;  5D26 A;  5II1 A;  4FLP A;  4QSX A;  4PS5 A;  2RFJ A;  2F6J A;  5A5O A;  4NRA A;  4O78 A;  4LYI A;  4IR4 A;  2I8N A;  5D3S A;  5L99 A;  4IOO A;  5A5N A;  5E73 A;  5E0R A;  5FE7 A;  4CFK A;  3LQI A;  5ENC A;  2YEK A;  5CUD A;  5H1U A;  5COI A;  4GPJ A;  5ETB A;  4QSW A;  5DYX A;  2OUO A;  2G4A A;  1N72 A;  2WP2 A;  5FE3 A;  3Q2F A;  4HXK A;  5H85 A;  4UIW A;  5EWD A;  3MXF A;  5DFB A;  5E3G A;  3HMF A;  4BW1 A;  3DWY A;  5HCL A;  4J0S A;  4BHW A;  2DWW A;  4ZW1 A;  5FB0 A;  4UIV A;  4LZS A;  5ENG A;  2DVS A;  4QEV A;  4UYD A;  2R0Y A;  4XYA A;  4TQN A;  5FG4 A;  5EWV A;  5L97 A;  5CQ3 A;  2YQD A;  3UV5 A;  5IG6 A;  1WUM A;  4CUQ A;  5CGP A;  4YY4 A;  4O76 A;  4UIX A;  4YYK A;  5K29 A;  5IGN A;  3O33 A;  1ZS5 A;  3O34 A;  4F3I A;  4YYM A;  4A9H A;  5ENI A;  3P5O A;  2DVQ A;  5DKC A;  5EGU A;  5C4Q A;  3SVF A;  5CQT A;  4OUF A;  3FKM X;  5FG5 A;  4Z1S A;  4QBM A;  5EPB A;  2DVR A;  4NR4 A;  5A83 A;  4LZR A;  3S91 A;  4MR5 A;  4XY8 A;  4NR9 A;  3MB4 A;  5FE6 A;  2R10 A;  5FE2 A;  5F61 A;  5CFW A;  4QSV A;  4HXR A;  5DBM A;  4XY9 A;  5D3P A;  2E3K A;  4IOQ A;  5EV9 A;  4NS5 A;  4UYH A;  4YAT A;  5CQ5 A;  5I29 A;  4CUP A;  4LDF A;  3UVX A;  4HBX A;  5G4R A;  4QSQ A;  5F62 A;  5LKU A;  4HXL A;  5F5Z A;  3U5L A;  4TU4 A;  5A5Q A;  3JVK A;  5C89 A;  4O7A A;  5FE0 A;  4LYS A;  3K2J A;  5I89 A;  5EIS A;  4LYW A;  4QR4 A;  5E9I A;  2RNX A;  3AAD A;  5DKH A;  4HBY A;  3O35 A;  4TTE A;  5LJ0 A;  5CS8 A;  5CTL A;  5LVQ A;  3MB3 A;  5F60 A;  5EM3 A;  1X0J A;  5JI8 A;  4TZ2 A;  4NR5 A;  5HFQ A;  2FSA A;  5KHM A;  5CY9 A;  4BW3 A;  5E3D A;  4HXP A;  2H60 A;  1E6I A;  5HEN A;  4E96 A;  4Z93 A;  4HXO A;  4NRC A;  3AQA A;  5A5R A;  4A9E A;  3O36 A;  2LSP B;  4KV4 A;  5FH7 A;  3JVJ A;  4QB3 A;  4N3W A;  3S92 A;  3O37 A;  3UVY A;  4YAB A;  5CQ6 A;  5D3R A;  3MUL A;  4MEO A;  5II2 A;  5LKX A;  5H1T A;  5A85 A;  3U5M A;  4YH4 A;  5CQA A;  5CZG A;  4YYN A;  4O72 A;  5L8T A;  2RI7 A;  4NR6 A;  5ENB A;  2L84 A;  2RS9 B;  4Z6H A;  4J0R A;  4NRB A;  3GG3 A;  4PY6 A;  4A9J A;  5D0C A;  4N4F A;  4PCE A;  4J1P A;  5CPE A;  4CL9 A;  5I7Y A;  5TCM A;  4QYL A;  5FE1 A;  5F1H A;  4NYW A;  5LKT A;  2R0V A;  2RNW A;  5E9K A;  4QZS A;  4NXJ A;  5I88 A;  5FE9 A;  4X2I A;  3P1C A;  4TT4 A;  5EWH A;  5I1Q A;  5FDZ A;  5A82 A;  5D3L A;  3JVM A;  3U5O A;  2NXB A;  5EVA A;  1EQF A;  3UVD A;  4CUS A;  4QEU A;  5A7C A;  4IR5 A;  5LJ2 A;  5CUB A;  4RVR A;  3DAI A;  4QEW A;  2D9E A;  2WP1 A;  4TYL A;  2DAT A;  5F3A A;  5BT5 A;  5DYU A;  3UV2 A;  4CUT A;  3QZV A;  4TT2 A;  5ACY A;  4O7B A;  5FG6 A;  4MEP A;  5HEL A;  4TS8 A;  5TB6 A;  4A9I A;  2YEL A;  4Q0N A;  4A9N A;  5BT3 A;  4LZ2 A;  4UIY A;  2DKW A;  5KU3 A;  2R0S A;  3U5K A;  4PTB A;  5HM0 A;  4HBV A;  5EI4 A;  5EA1 A;  4A9M A;  5I86 A;  5DFC A;  4O7E A;  5HEM A;  3NXB A;  2DVV A;  2YDW A;  2RNY A;  4NQM A;  5HJC A;  4Q0O A;  5A5S A;  4QUT A;  4QSS A;  5E9Y A;  4AKN A;  5F63 A;  4UYE A;  4UIZ A;  5F25 A;  4QC1 A;  4N4I A;  5CQ7 A;  5HRW A;  4ALH A;  5D25 A;  5DLX A;  5KTX A;  4HXS A;  2GRC A;  3LQJ A;  3IU6 A;  3TLP A;  5DYA A;  4YYH A;  5FBX A;  3RCW A;  5FE4 A;  4QR3 A;  4O7F A;  4A9O A;  3P1D A;  5IGK A;  3I3J A;  5F2P A;  4QSR A;  3D7C A;  5L98 A;  5HLS A;  4YY6 A;  5L8U A;  4CUR A;  3JVL A;  5E9L A;  5FFV A;  4C67 A;  5FE5 A;  5D3N A;  5DW2 A;  5AD3 A;  4QUU A;  5LJ1 A;  4Z6I A;  4QSU A;  4MR6 A;  2E7O A;  4MR3 A;  1JSP B;  5DX4 A;  4O77 A;  5J0D A;  5ENE A;  3IU5 A;  5F1L A;  3U5J A;  4NUE A;  4YYI A;  5EPR A;  4QR5 A;  5IBN A;  1JM4 B;  4YAD A;  5D3T A;  4NR8 A;  5CUE A;  3LQH A;  1F68 A;  3HMH A;  5AME A;  4QNS A;  2F6N A;  5C8G A;  5DFD A;  2MJV B;  5KTW A;  5G4S A;  5KTU A;  4J3I A;  3HME A;  4HXM A;  4Y03 A;  2YW5 A;  5DY7 A;  5F36 A;  3LXJ A;  4O75 A;  4CFL A;  3QZS A;  4NYX A;  4N4G A;  5A5P A;  5I83 A;  4OGJ A;  5A81 A;  5I7X A;  5FB1 A;  5I80 A;  3ZYU A;  4IR3 A;  3G0L A;  3P1E A;  2OSS A;  4QC3 A;  5IGM A;  4ZC9 A;  5EK9 A;  5CP5 A;  4NYV A;  4O74 A;  4NQN A;  5DKD A;  5FH6 A;  4YK0 A;  4DON A;  5DLZ A;  3SVH A;  5BT4 A;  5D7X A;  4TZ8 A;  2E7N A;  5ETD A;  4A9F A;  3U5P A;  4HXN A;  4KV1 A;  5ENH A;  5KO4 A;  3Q2E A;  4QSP A;  4PKL A;  3UVW A;  5CQ4 A;  5L96 A;  5LKZ A;  3ONI A;  4A9K A;  4YBS A;  4YBT A;  4YBM A;  1WUG A;  3UV4 A;  4MR4 A;  4QYD A;  3UW9 A;  2I7K A;  4KCX A;  4C66 A;  5HRV A;  4PCI A;  5DW1 A;  4CLB A;  4QST A;  2RO1 A;  5DYC A;  4O70 A;  3P1F A;  5LVR A;  4BW2 A;  5EWW A;  5I40 A;  4YH3 A;  4LC2 A;  5FFY A;  4YAX A;  4ALG A;  5E9M A;  5CRM A;  5CUG A;  5JWM A;  3MUK A;  4HBW A;  5HFR A;  4TU6 A;  4BW4 A;  5FH8 A;  2L5E A;  4XUB A;  4YYJ A;  4UIU A;  5CQ8 A;  5H1V A;  4YYD A;  5IID A;  5D3J A;  2L85 A;  5CRZ A;  3U5N A;  4LRG A;  3G0J A;  5E7D A;  5CUA A;  4WIV A;  5CUC A;  4WHU A;  4NUD A;  4IR6 A;  5FFW A;  5IGL A;  5AD2 A;  5AMF A;  3QZT A;  5HQ7 A;  4YYG A;  3LJW A;  4YC9 A;  5C7N A;  4BJX A;  4IOR A;  2D82 A;  4NUC A;  2N9G A;  4MEQ A;  5D3H A;  5EP7 A;  4N4H A;  5EQ1 A;  4O71 A;  4A9L A;  5C85 A;  4LR6 A;  5EWC A;  4UYG A;  4XUA A;  5E74 A;  5EIC A;  4NR7 A;  3MQM A;  2YYN A;  4UIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...