5LVQA

Crystal structure of human pcaf bromodomain in complex with compound-d (cpd-d), n-methyl-2-(tetrahydro-2h-pyran-4-yloxy)benzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT2B
publication title Discovery of New Bromodomain Scaffolds by Biosensor Fragment Screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5lvqA00
5FB1A 4CUUA 4F3IA 4NUDA 5D3LA 4UYEA 3G0JA 4BHWA 4WHUA 5CUAA 5EGUA 5A5NA 3UVDA 5FE8A 5IGMA 3UVYA 5IG6A 3ONIA 4J1PA 4J0SA 4Z6HA 4UYGA 4NR8A 5F62A 4LC2A 5CS8A 5E9YA 4QEUA 4YC9A 3IU6A 2OO1A 3AQAA 5L8UA 4CL9A 4IOOA 4YABA 3LQHA 5F63A 2H60A 3AADA 5FBXA 5FFVA 4CURA 2RO1A 3MULA 3S91A 5L99A 5AMEA 3U5MA 5HELA 5I29A 2E7NA 2F6JA 4QSXA 4Y03A 5A5SA 2N9GA 5CFWA 4HXSA 4QC3A 4NYVA 4PY6A 3SVHA 5E3GA 5LJ0A 2L85A 3O34A 4NR6A 5H85A 5HQ7A 3P1DA 4PS5A 4NYWA 4A9IA 5JWMA 5F25A 5D3HA 5EA1A 2YEKA 5EPBA 1WUGA 5FFYA 4YYJA 4PCEA 4YYDA 2D82A 5DKDA 5I80A 2DVQA 4FLPA 3O36A 5A81A 1JM4B 5LKUA 5E3DA 5L96A 4BW1A 4WHWA 5IBNA 4N4FA 4Q0NA 3U5NA 5DY7A 4CUPA 4KV1A 2WP2A 4A9KA 5CUDA 4O7AA 2RS9B 4DONA 3UVWA 5EV9A 4PKLA 5I40A 5DFBA 5EICA 3NXBA 4LYIA 4XYAA 5E9KA 5L8TA 2OUOA 5A5RA 5HRWA 5CUBA 3LJWA 5FE4A 5E9LA 4NR7A 4YATA 4QSSA 4NR9A 5DKCA 3HMEA 5BT4A 5HQ6A 5FE6A 2NXBA 5CQ5A 4UIZA 5EWDA 4UYFB 4TQNA 5E74A 5ETDA 5FG4A 3U5LA 4LYSA 2YEMA 4A9MA 5EPSA 5EVAA 4XY9A 4QSQA 5D0CA 4PCIA 3MB3A 3UW9A 2WP1A 4C67A 4NYXA 5CUEA 5CP5A 5CQ7A 4TT2A 4X2IA 5EK9A 5BT5A 3FKMX 5CRMA 4QSRA 4QSWA 5C89A 5CZGA 4ZQLA 5DLXA 4QSPA 5KHMA 3P5OA 5LJ1A 5EQ1A 4IR5A 4ZC9A 4QC1A 3JVMA 5DW2A 4YBSA 4A9FA 4QR5A 5FFWA 5DKHA 5I88A 4YK0A 3UV5A 5FG6A 4TT4A 4O77A 5LKZA 5F3AA 5DX4A 5EWHA 5ENJA 5FB0A 4MR5A 3LXJA 4CUQA 2E3KA 2R0YA 4NRBA 4O75A 5C4QA 4CUSA 4LZSA 5A5OA 5I7XA 3QZTA 5D25A 5CTLA 5CUGA 5LKXA 5CQ3A 4HBVA 5ENFA 4YH4A 4QB3A 5EWVA 4HBWA 4MEOA 4O72A 4BW3A 4XY8A 3Q2FA 4NQNA 4Q0OA 4TTEA 4E96A 2YW5A 5F1LA 5KU3A 4BW4A 5I1QA 4O74A 5L97A 3P1FA 4LZ2A 4KV4A 5FE7A 5A5QA 5D3JA 5CQAA 3O37A 4QSVA 5ENGA 4CLBA 5CRZA 4NXJA 4ALGA 4NR4A 5HRXA 5G4SA 4MEQA 5KTWA 5CQ8A 5A83A 5EWWA 4UYDA 4HBXA 4CFKA 4MR4A 4YYIA 5IGNA 5C87A 5H1UA 5LVRA 2DVVA 4XUBA 5CQ4A 3HMFA 2R0SA 5D7XA 4LRGA 4QYLA 5FE3A 5CQTA 4AKNA 5DLZA 3I3JA 5D3PA 5I83A 4UIUA 4GPJA 4A9OA 5DBMA 2E7OA 4QEWA 5II2A 5FE9A 4PTBA 5E0RA 5EISA 5AMFA 5EI4A 5HFQA 5D3SA 1EQFA 2RNXA 4QZSA 4OUFA 4BW2A 5D24A 2D9EA 5H1VA 5E7DA 3P1CA 4OGIA 5A85A 4O7EA 4LZRA 4BJXA 4O7FA 5D26A 3TLPA 4YADA 4O70A 1X0JA 2DVRA 2G4AA 5C8GA 5DYUA 5E73A 4A9EA 5KTXA 4HXRA 4TS8A 5D3TA 1E6IA 4QY4A 3HMHA 3SVFA 4YBMA 3JVKA 2OSSA 5DW1A 4UIVA 5FE0A 2F6NA 4UYHA 4LYWA 3GG3A 5ENIA 4A9JA 4YY6A 4Z1QA 5DFDA 5IGLA 1N72A 5CU8A 4A9HA 5HCLA 5DYAA 3UV4A 4NUCA 4TU6A 5A82A 5D3NA 2DWWA 2YELA 5FE5A 5KO4A 5FE2A 5IGKA 4O76A 5HENA 5ETBA 3U5OA 3D7CA 5BT3A 5E9VA 3LQIA 4HXOA 5HEMA 5AD3A 2L5EA 4KCXA 4IR4A 4O71A 4Z93A 4YBTA 2KTBB 4O7BA 4J0RA 4N3WA 4HXMA 5CGPA 5DYXA 4RVRA 5C7NA 4UYFA 5EM3A 4IR6A 4YYMA 5EWCA 4QUTA 4IORA 3S92A 4WIVA 5HM0A 5I86A 3P1EA 5ENBA 3QZVA 5CUCA 4YY4A 3U5KA 4NQMA 4O78A 5FDZA 5A7CA 4UIYA 3DWYA 5IIDA 3IU5A 4UIWA 3G0LA 5ENEA 2YYNA 4LR6A 5HRVA 2MJVB 2GRCA 5HLSA 4N4GA 5HQ5A 5CPEA 5I89A 2DATA 3MUKA 5FG5A 3DAIA 5LJ2A 5FE1A 5A5PA 5J0DA 3JVLA 4Z6IA 4J3IA 4IR3A 2RFJA 5C85A 4TZ2A 5H1TA 4CUTA 4MEPA 4MR6A 5II1A 3O33A 4QSUA 4UIXA 4UITA 5LUUA 4A9NA 4ALHA 4IOQA 4QSTA 2YQDA 2RNWA 4YAXA 2I8NA 4NS5A 4C66A 4YYGA 5DFCA 2LSPB 5D3RA 3Q2EA 2L84A 2DVSA 5ENCA 2DKWA 4NR5A 2RI7A 3U5PA 4QBMA 5TB6A 4CFLA 3UV2A 4YYHA 4QR4A 5KTUA 4OGJA 4QYDA 4XUAA 5F1HA 5I7YA 4NUEA 5TCMA 5K29A 4YYNA 5ENHA 5EU1A 2I7KA 5L98A 3ZYUA 5HFRA 5FH7A 5FH6A 5E9MA 4HBYA 3MB4A 4O7CA 4YYKA 4HXLA 5JI8A 5E9IA 5EPRA 5LKTA 4HXKA 1ZS5A 4NRAA 3JVJA 3MQMA 3U5JA 3K2JA 5EP7A 4LDFA 5G4RA 4N4IA 4Z1SA 5ACYA 3RCWA 5AD2A 4TU4A 1JSPB 4TYLA 3O35A 4TZ8A 4YH3A 4A9LA 4N4HA 5F60A 5F36A 4QR3A 4QUUA 3SVGA 2R0VA 2R10A 4NRCA 1F68A 5CQ6A 4QNSA 2FSAA 4HXPA 2RNYA 5F61A 1WUMA 3MXFA 5LVQA 5COIA 4ZW1A 5CY9A 4MENA 2YDWA 4MR3A 4HXNA 5DYCA 3QZSA 3LQJA 5F2PA 5F5ZA 4QEVA 5FH8A 3UVXA 5HJCA 4TT6A
chains in the Genus database with same CATH superfamily
5FB1A 4CUUA 4F3IA 4NUDA 5D3LA 4UYEA 3G0JA 4BHWA 4WHUA 5CUAA 5EGUA 5A5NA 3UVDA 5FE8A 5IGMA 3UVYA 5IG6A 3ONIA 4J1PA 4J0SA 4Z6HA 4UYGA 4NR8A 5F62A 4LC2A 5CS8A 5E9YA 4QEUA 4YC9A 3IU6A 2OO1A 3AQAA 5L8UA 4CL9A 2EJNA 4IOOA 4YABA 3LQHA 5F63A 2H60A 3AADA 5FBXA 5FFVA 4CURA 2RO1A 3MULA 3S91A 5L99A 5AMEA 3U5MA 5HELA 5I29A 2E7NA 2F6JA 4QSXA 4Y03A 5A5SA 2N9GA 5CFWA 4HXSA 4QC3A 4NYVA 4PY6A 3SVHA 5E3GA 5LJ0A 2L85A 3O34A 4NR6A 5H85A 5HQ7A 3P1DA 4PS5A 4NYWA 4A9IA 5JWMA 5F25A 5D3HA 5EA1A 2YEKA 5EPBA 1WUGA 5FFYA 4YYJA 4PCEA 4YYDA 2D82A 5DKDA 4AKIA 5I80A 2DVQA 4FLPA 3VKGA 3O36A 5A81A 1JM4B 5LKUA 5E3DA 5L96A 4BW1A 4WHWA 5IBNA 4N4FA 4Q0NA 3U5NA 5DY7A 4CUPA 4KV1A 2WP2A 4A9KA 5CUDA 4O7AA 2RS9B 4DONA 3UVWA 5EV9A 4PKLA 5I40A 1PUOA 5DFBA 5EICA 3NXBA 4LYIA 4XYAA 5E9KA 5L8TA 2OUOA 5A5RA 5HRWA 5CUBA 3LJWA 5FE4A 5E9LA 4NR7A 4YATA 4QSSA 4NR9A 5DKCA 3HMEA 5BT4A 5HQ6A 3D1DA 2NXBA 5FE6A 5CQ5A 4UIZA 5EWDA 4UYFB 4TQNA 5E74A 5ETDA 5FG4A 3U5LA 4LYSA 2YEMA 4A9MA 5EPSA 5EVAA 4XY9A 4QSQA 5D0CA 4PCIA 3MB3A 3UW9A 2WP1A 4C67A 4NYXA 5CUEA 5CP5A 5CQ7A 4TT2A 4X2IA 5EK9A 5BT5A 3FKMX 5CRMA 4QSRA 4QSWA 5C89A 5CZGA 4ZQLA 5DLXA 4QSPA 5KHMA 3P5OA 5LJ1A 5EQ1A 1ZKRA 4IR5A 4ZC9A 4QC1A 3JVMA 5DW2A 4YBSA 4A9FA 4QR5A 5FFWA 5DKHA 5I88A 4YK0A 3UV5A 5FG6A 4TT4A 4O77A 5LKZA 5F3AA 5DX4A 5EWHA 5ENJA 5FB0A 4MR5A 3LXJA 4CUQA 2E3KA 2R0YA 4NRBA 4O75A 5C4QA 4CUSA 4LZSA 5A5OA 5I7XA 3QZTA 5D25A 5CTLA 5CUGA 5LKXA 5CQ3A 4HBVA 5ENFA 4YH4A 4QB3A 5EWVA 4HBWA 4MEOA 4O72A 4BW3A 4XY8A 3Q2FA 4NQNA 4Q0OA 4TTEA 4E96A 2YW5A 5F1LA 5KU3A 4BW4A 5I1QA 4O74A 5L97A 3P1FA 4LZ2A 4KV4A 5FE7A 5A5QA 5D3JA 5CQAA 3O37A 4QSVA 5ENGA 4CLBA 5CRZA 4NXJA 4ALGA 4NR4A 5HRXA 5G4SA 4MEQA 5KTWA 5CQ8A 5A83A 5EWWA 4UYDA 4HBXA 4CFKA 4MR4A 4YYIA 5IGNA 5C87A 5H1UA 5LVRA 2DVVA 4XUBA 5CQ4A 3HMFA 2R0SA 5D7XA 4LRGA 4QYLA 5FE3A 5CQTA 4AKNA 5DLZA 3I3JA 5D3PA 5I83A 4UIUA 4GPJA 4A9OA 5DBMA 2E7OA 4QEWA 5II2A 5FE9A 4PTBA 5E0RA 5EISA 5AMFA 5EI4A 5HFQA 5D3SA 1EQFA 2RNXA 4QZSA 4OUFA 4BW2A 5D24A 2D9EA 5H1VA 5E7DA 3P1CA 4OGIA 5A85A 4O7EA 4LZRA 4BJXA 4O7FA 5D26A 3TLPA 4YADA 4O70A 1X0JA 2DVRA 2G4AA 5C8GA 5DYUA 5E73A 4A9EA 5KTXA 4HXRA 4TS8A 5D3TA 1E6IA 4QY4A 3HMHA 3SVFA 4YBMA 3JVKA 2OSSA 5DW1A 4UIVA 5FE0A 2F6NA 4UYHA 4LYWA 3D1BA 3GG3A 5ENIA 4A9JA 4YY6A 4Z1QA 5DFDA 5IGLA 1N72A 5CU8A 4A9HA 5HCLA 5DYAA 3UV4A 4NUCA 4TU6A 5A82A 5D3NA 2DWWA 2YELA 5FE5A 5KO4A 5FE2A 5IGKA 4O76A 5HENA 5ETBA 3U5OA 3D7CA 5BT3A 5E9VA 3LQIA 4HXOA 5HEMA 5AD3A 2L5EA 4KCXA 4IR4A 4O71A 4Z93A 4YBTA 2KTBB 4O7BA 4J0RA 4N3WA 4HXMA 5CGPA 5DYXA 4RVRA 5C7NA 4UYFA 5EM3A 4IR6A 4YYMA 5EWCA 4QUTA 4IORA 4AKGA 3S92A 4WIVA 5HM0A 5I86A 3P1EA 5ENBA 3QZVA 5CUCA 4YY4A 3U5KA 4NQMA 4O78A 5FDZA 5A7CA 4UIYA 3DWYA 5IIDA 3IU5A 4UIWA 3G0LA 4AI6A 5ENEA 2YYNA 4LR6A 5HRVA 2MJVB 2GRCA 5HLSA 4N4GA 5HQ5A 5CPEA 5I89A 2DATA 3MUKA 5FG5A 3DAIA 5LJ2A 5FE1A 5A5PA 5J0DA 3JVLA 4AKHA 4Z6IA 4J3IA 4IR3A 2RFJA 5C85A 4TZ2A 5H1TA 4CUTA 4MEPA 4MR6A 5II1A 3O33A 4QSUA 4UIXA 4UITA 5LUUA 4A9NA 4ALHA 4IOQA 4QSTA 2YQDA 2RNWA 4YAXA 2I8NA 4NS5A 4C66A 4YYGA 5DFCA 2LSPB 5D3RA 3Q2EA 2L84A 2DVSA 5ENCA 2DKWA 3VKHA 4NR5A 2RI7A 3U5PA 4QBMA 5TB6A 4CFLA 3UV2A 4YYHA 4QR4A 5KTUA 4OGJA 4QYDA 4XUAA 5F1HA 5I7YA 4NUEA 5TCMA 5K29A 4YYNA 5ENHA 5EU1A 2I7KA 5L98A 3ZYUA 5HFRA 5FH7A 5FH6A 5E9MA 4HBYA 3MB4A 4O7CA 4YYKA 4HXLA 5JI8A 5E9IA 5EPRA 5LKTA 4HXKA 1ZS5A 4NRAA 3JVJA 3MQMA 3U5JA 3K2JA 5EP7A 4LDFA 5G4RA 4N4IA 4Z1SA 5ACYA 3RCWA 5AD2A 4TU4A 1JSPB 3ERRA 4TYLA 3O35A 4TZ8A 4YH3A 4A9LA 4N4HA 5F60A 5F36A 4QR3A 4QUUA 3SVGA 2R0VA 2R10A 4NRCA 1F68A 5CQ6A 4QNSA 2FSAA 4HXPA 2RNYA 5F61A 1WUMA 3MXFA 5LVQA 5COIA 4ZW1A 5CY9A 4MENA 2YDWA 4MR3A 4HXNA 5DYCA 3QZSA 3LQJA 5F2PA 5F5ZA 4QEVA 5FH8A 3UVXA 5HJCA 4TT6A
chains in the Genus database with same CATH topology
5FB1A 4CUUA 4F3IA 4NUDA 5D3LA 4UYEA 3G0JA 4BHWA 4WHUA 5CUAA 5EGUA 5A5NA 3UVDA 5FE8A 5IGMA 3UVYA 5IG6A 3ONIA 4J1PA 4J0SA 4Z6HA 4UYGA 4NR8A 5F62A 4LC2A 5CS8A 5E9YA 4QEUA 4YC9A 3IU6A 2OO1A 3AQAA 5L8UA 4CL9A 4IOOA 4YABA 3LQHA 5F63A 2H60A 3AADA 5FBXA 5FFVA 4CURA 2RO1A 3MULA 3S91A 5L99A 5AMEA 3U5MA 5HELA 5I29A 2E7NA 2F6JA 4QSXA 4Y03A 5A5SA 2N9GA 5CFWA 4HXSA 4QC3A 4NYVA 4PY6A 3SVHA 5E3GA 5LJ0A 2L85A 3O34A 4NR6A 5H85A 5HQ7A 3P1DA 4PS5A 4NYWA 4A9IA 5JWMA 5F25A 5D3HA 5EA1A 2YEKA 5EPBA 1WUGA 5FFYA 4YYJA 4PCEA 4YYDA 2D82A 5DKDA 5I80A 2DVQA 4FLPA 3O36A 5A81A 1JM4B 5LKUA 5E3DA 5L96A 4BW1A 4WHWA 5IBNA 4N4FA 4Q0NA 3U5NA 5DY7A 4CUPA 4KV1A 2WP2A 4A9KA 5CUDA 4O7AA 2RS9B 4DONA 3UVWA 5EV9A 4PKLA 5I40A 5DFBA 5EICA 3NXBA 4LYIA 4XYAA 5E9KA 5L8TA 2OUOA 5A5RA 5HRWA 5CUBA 3LJWA 5FE4A 5E9LA 4NR7A 4YATA 4QSSA 4NR9A 5DKCA 3HMEA 5BT4A 5HQ6A 5FE6A 2NXBA 5CQ5A 4UIZA 5EWDA 4UYFB 4TQNA 5E74A 5ETDA 5FG4A 3U5LA 4LYSA 2YEMA 4A9MA 5EPSA 5EVAA 4XY9A 4QSQA 5D0CA 4PCIA 3MB3A 3UW9A 2WP1A 4C67A 4NYXA 5CUEA 5CP5A 5CQ7A 4TT2A 4X2IA 5EK9A 5BT5A 3FKMX 5CRMA 4QSRA 4QSWA 5C89A 5CZGA 4ZQLA 5DLXA 4QSPA 5KHMA 3P5OA 5LJ1A 5EQ1A 4IR5A 4ZC9A 4QC1A 3JVMA 5DW2A 4YBSA 4A9FA 4QR5A 5FFWA 5DKHA 5I88A 4YK0A 3UV5A 5FG6A 4TT4A 4O77A 5LKZA 5F3AA 5DX4A 5EWHA 5ENJA 5FB0A 4MR5A 3LXJA 4CUQA 2E3KA 2R0YA 4NRBA 4O75A 5C4QA 4CUSA 4LZSA 5A5OA 5I7XA 3QZTA 5D25A 5CTLA 5CUGA 5LKXA 5CQ3A 4HBVA 5ENFA 4YH4A 4QB3A 5EWVA 4HBWA 4MEOA 4O72A 4BW3A 4XY8A 3Q2FA 4NQNA 4Q0OA 4TTEA 4E96A 2YW5A 5F1LA 5KU3A 4BW4A 5I1QA 4O74A 5L97A 3P1FA 4LZ2A 4KV4A 5FE7A 5A5QA 5D3JA 5CQAA 3O37A 4QSVA 5ENGA 4CLBA 5CRZA 4NXJA 4ALGA 4NR4A 5HRXA 5G4SA 4MEQA 5KTWA 5CQ8A 5A83A 5EWWA 4UYDA 4HBXA 4CFKA 4MR4A 4YYIA 5IGNA 5C87A 5H1UA 5LVRA 2DVVA 4XUBA 5CQ4A 3HMFA 2R0SA 5D7XA 4LRGA 4QYLA 5FE3A 5CQTA 4AKNA 5DLZA 3I3JA 5D3PA 5I83A 4UIUA 4GPJA 4A9OA 5DBMA 2E7OA 4QEWA 5II2A 5FE9A 4PTBA 5E0RA 5EISA 5AMFA 5EI4A 5HFQA 5D3SA 1EQFA 2RNXA 4QZSA 4OUFA 4BW2A 5D24A 2D9EA 5H1VA 5E7DA 3P1CA 4OGIA 5A85A 4O7EA 4LZRA 4BJXA 4O7FA 5D26A 3TLPA 4YADA 4O70A 1X0JA 2DVRA 2G4AA 5C8GA 5DYUA 5E73A 4A9EA 5KTXA 4HXRA 4TS8A 5D3TA 1E6IA 4QY4A 3HMHA 3SVFA 4YBMA 3JVKA 2OSSA 5DW1A 4UIVA 5FE0A 2F6NA 4UYHA 4LYWA 3GG3A 5ENIA 4A9JA 4YY6A 4Z1QA 5DFDA 5IGLA 1N72A 5CU8A 4A9HA 5HCLA 5DYAA 3UV4A 4NUCA 4TU6A 5A82A 5D3NA 2DWWA 2YELA 5FE5A 5KO4A 5FE2A 5IGKA 4O76A 5HENA 5ETBA 3U5OA 3D7CA 5BT3A 5E9VA 3LQIA 4HXOA 5HEMA 5AD3A 2L5EA 4KCXA 4IR4A 4O71A 4Z93A 4YBTA 2KTBB 4O7BA 4J0RA 4N3WA 4HXMA 5CGPA 5DYXA 4RVRA 5C7NA 4UYFA 5EM3A 4IR6A 4YYMA 5EWCA 4QUTA 4IORA 3S92A 4WIVA 5HM0A 5I86A 3P1EA 5ENBA 3QZVA 5CUCA 4YY4A 3U5KA 4NQMA 4O78A 5FDZA 5A7CA 4UIYA 3DWYA 5IIDA 3IU5A 4UIWA 3G0LA 5ENEA 2YYNA 4LR6A 5HRVA 2MJVB 2GRCA 5HLSA 4N4GA 5HQ5A 5CPEA 5I89A 2DATA 3MUKA 5FG5A 3DAIA 5LJ2A 5FE1A 5A5PA 5J0DA 3JVLA 4Z6IA 4J3IA 4IR3A 2RFJA 5C85A 4TZ2A 5H1TA 4CUTA 4MEPA 4MR6A 5II1A 3O33A 4QSUA 4UIXA 4UITA 5LUUA 4A9NA 4ALHA 4IOQA 4QSTA 2YQDA 2RNWA 4YAXA 2I8NA 4NS5A 4C66A 4YYGA 5DFCA 2LSPB 5D3RA 3Q2EA 2L84A 2DVSA 5ENCA 2DKWA 4NR5A 2RI7A 3U5PA 4QBMA 5TB6A 4CFLA 3UV2A 4YYHA 4QR4A 5KTUA 4OGJA 4QYDA 4XUAA 5F1HA 5I7YA 4NUEA 5TCMA 5K29A 4YYNA 5ENHA 5EU1A 2I7KA 5L98A 3ZYUA 5HFRA 5FH7A 5FH6A 5E9MA 4HBYA 3MB4A 4O7CA 4YYKA 4HXLA 5JI8A 5E9IA 5EPRA 5LKTA 4HXKA 1ZS5A 4NRAA 3JVJA 3MQMA 3U5JA 3K2JA 5EP7A 4LDFA 5G4RA 4N4IA 4Z1SA 5ACYA 3RCWA 5AD2A 4TU4A 1JSPB 4TYLA 3O35A 4TZ8A 4YH3A 4A9LA 4N4HA 5F60A 5F36A 4QR3A 4QUUA 3SVGA 2R0VA 2R10A 4NRCA 1F68A 5CQ6A 4QNSA 2FSAA 4HXPA 2RNYA 5F61A 1WUMA 3MXFA 5LVQA 5COIA 4ZW1A 5CY9A 4MENA 2YDWA 4MR3A 4HXNA 5DYCA 3QZSA 3LQJA 5F2PA 5F5ZA 4QEVA 5FH8A 3UVXA 5HJCA 4TT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB1 A;  4CUU A;  4F3I A;  4NUD A;  5D3L A;  4UYE A;  3G0J A;  4BHW A;  4WHU A;  5CUA A;  5EGU A;  5A5N A;  3UVD A;  5FE8 A;  5IGM A;  3UVY A;  5IG6 A;  3ONI A;  4J1P A;  4J0S A;  4Z6H A;  4UYG A;  4NR8 A;  5F62 A;  4LC2 A;  5CS8 A;  5E9Y A;  4QEU A;  4YC9 A;  3IU6 A;  2OO1 A;  3AQA A;  5L8U A;  4CL9 A;  4IOO A;  4YAB A;  3LQH A;  5F63 A;  2H60 A;  3AAD A;  5FBX A;  5FFV A;  4CUR A;  2RO1 A;  3MUL A;  3S91 A;  5L99 A;  5AME A;  3U5M A;  5HEL A;  5I29 A;  2E7N A;  2F6J A;  4QSX A;  4Y03 A;  5A5S A;  2N9G A;  5CFW A;  4HXS A;  4QC3 A;  4NYV A;  4PY6 A;  3SVH A;  5E3G A;  5LJ0 A;  2L85 A;  3O34 A;  4NR6 A;  5H85 A;  5HQ7 A;  3P1D A;  4PS5 A;  4NYW A;  4A9I A;  5JWM A;  5F25 A;  5D3H A;  5EA1 A;  2YEK A;  5EPB A;  1WUG A;  5FFY A;  4YYJ A;  4PCE A;  4YYD A;  2D82 A;  5DKD A;  5I80 A;  2DVQ A;  4FLP A;  3O36 A;  5A81 A;  1JM4 B;  5LKU A;  5E3D A;  5L96 A;  4BW1 A;  4WHW A;  5IBN A;  4N4F A;  4Q0N A;  3U5N A;  5DY7 A;  4CUP A;  4KV1 A;  2WP2 A;  4A9K A;  5CUD A;  4O7A A;  2RS9 B;  4DON A;  3UVW A;  5EV9 A;  4PKL A;  5I40 A;  5DFB A;  5EIC A;  3NXB A;  4LYI A;  4XYA A;  5E9K A;  5L8T A;  2OUO A;  5A5R A;  5HRW A;  5CUB A;  3LJW A;  5FE4 A;  5E9L A;  4NR7 A;  4YAT A;  4QSS A;  4NR9 A;  5DKC A;  3HME A;  5BT4 A;  5HQ6 A;  5FE6 A;  2NXB A;  5CQ5 A;  4UIZ A;  5EWD A;  4UYF B;  4TQN A;  5E74 A;  5ETD A;  5FG4 A;  3U5L A;  4LYS A;  2YEM A;  4A9M A;  5EPS A;  5EVA A;  4XY9 A;  4QSQ A;  5D0C A;  4PCI A;  3MB3 A;  3UW9 A;  2WP1 A;  4C67 A;  4NYX A;  5CUE A;  5CP5 A;  5CQ7 A;  4TT2 A;  4X2I A;  5EK9 A;  5BT5 A;  3FKM X;  5CRM A;  4QSR A;  4QSW A;  5C89 A;  5CZG A;  4ZQL A;  5DLX A;  4QSP A;  5KHM A;  3P5O A;  5LJ1 A;  5EQ1 A;  4IR5 A;  4ZC9 A;  4QC1 A;  3JVM A;  5DW2 A;  4YBS A;  4A9F A;  4QR5 A;  5FFW A;  5DKH A;  5I88 A;  4YK0 A;  3UV5 A;  5FG6 A;  4TT4 A;  4O77 A;  5LKZ A;  5F3A A;  5DX4 A;  5EWH A;  5ENJ A;  5FB0 A;  4MR5 A;  3LXJ A;  4CUQ A;  2E3K A;  2R0Y A;  4NRB A;  4O75 A;  5C4Q A;  4CUS A;  4LZS A;  5A5O A;  5I7X A;  3QZT A;  5D25 A;  5CTL A;  5CUG A;  5LKX A;  5CQ3 A;  4HBV A;  5ENF A;  4YH4 A;  4QB3 A;  5EWV A;  4HBW A;  4MEO A;  4O72 A;  4BW3 A;  4XY8 A;  3Q2F A;  4NQN A;  4Q0O A;  4TTE A;  4E96 A;  2YW5 A;  5F1L A;  5KU3 A;  4BW4 A;  5I1Q A;  4O74 A;  5L97 A;  3P1F A;  4LZ2 A;  4KV4 A;  5FE7 A;  5A5Q A;  5D3J A;  5CQA A;  3O37 A;  4QSV A;  5ENG A;  4CLB A;  5CRZ A;  4NXJ A;  4ALG A;  4NR4 A;  5HRX A;  5G4S A;  4MEQ A;  5KTW A;  5CQ8 A;  5A83 A;  5EWW A;  4UYD A;  4HBX A;  4CFK A;  4MR4 A;  4YYI A;  5IGN A;  5C87 A;  5H1U A;  5LVR A;  2DVV A;  4XUB A;  5CQ4 A;  3HMF A;  2R0S A;  5D7X A;  4LRG A;  4QYL A;  5FE3 A;  5CQT A;  4AKN A;  5DLZ A;  3I3J A;  5D3P A;  5I83 A;  4UIU A;  4GPJ A;  4A9O A;  5DBM A;  2E7O A;  4QEW A;  5II2 A;  5FE9 A;  4PTB A;  5E0R A;  5EIS A;  5AMF A;  5EI4 A;  5HFQ A;  5D3S A;  1EQF A;  2RNX A;  4QZS A;  4OUF A;  4BW2 A;  5D24 A;  2D9E A;  5H1V A;  5E7D A;  3P1C A;  4OGI A;  5A85 A;  4O7E A;  4LZR A;  4BJX A;  4O7F A;  5D26 A;  3TLP A;  4YAD A;  4O70 A;  1X0J A;  2DVR A;  2G4A A;  5C8G A;  5DYU A;  5E73 A;  4A9E A;  5KTX A;  4HXR A;  4TS8 A;  5D3T A;  1E6I A;  4QY4 A;  3HMH A;  3SVF A;  4YBM A;  3JVK A;  2OSS A;  5DW1 A;  4UIV A;  5FE0 A;  2F6N A;  4UYH A;  4LYW A;  3GG3 A;  5ENI A;  4A9J A;  4YY6 A;  4Z1Q A;  5DFD A;  5IGL A;  1N72 A;  5CU8 A;  4A9H A;  5HCL A;  5DYA A;  3UV4 A;  4NUC A;  4TU6 A;  5A82 A;  5D3N A;  2DWW A;  2YEL A;  5FE5 A;  5KO4 A;  5FE2 A;  5IGK A;  4O76 A;  5HEN A;  5ETB A;  3U5O A;  3D7C A;  5BT3 A;  5E9V A;  3LQI A;  4HXO A;  5HEM A;  5AD3 A;  2L5E A;  4KCX A;  4IR4 A;  4O71 A;  4Z93 A;  4YBT A;  2KTB B;  4O7B A;  4J0R A;  4N3W A;  4HXM A;  5CGP A;  5DYX A;  4RVR A;  5C7N A;  4UYF A;  5EM3 A;  4IR6 A;  4YYM A;  5EWC A;  4QUT A;  4IOR A;  3S92 A;  4WIV A;  5HM0 A;  5I86 A;  3P1E A;  5ENB A;  3QZV A;  5CUC A;  4YY4 A;  3U5K A;  4NQM A;  4O78 A;  5FDZ A;  5A7C A;  4UIY A;  3DWY A;  5IID A;  3IU5 A;  4UIW A;  3G0L A;  5ENE A;  2YYN A;  4LR6 A;  5HRV A;  2MJV B;  2GRC A;  5HLS A;  4N4G A;  5HQ5 A;  5CPE A;  5I89 A;  2DAT A;  3MUK A;  5FG5 A;  3DAI A;  5LJ2 A;  5FE1 A;  5A5P A;  5J0D A;  3JVL A;  4Z6I A;  4J3I A;  4IR3 A;  2RFJ A;  5C85 A;  4TZ2 A;  5H1T A;  4CUT A;  4MEP A;  4MR6 A;  5II1 A;  3O33 A;  4QSU A;  4UIX A;  4UIT A;  5LUU A;  4A9N A;  4ALH A;  4IOQ A;  4QST A;  2YQD A;  2RNW A;  4YAX A;  2I8N A;  4NS5 A;  4C66 A;  4YYG A;  5DFC A;  2LSP B;  5D3R A;  3Q2E A;  2L84 A;  2DVS A;  5ENC A;  2DKW A;  4NR5 A;  2RI7 A;  3U5P A;  4QBM A;  5TB6 A;  4CFL A;  3UV2 A;  4YYH A;  4QR4 A;  5KTU A;  4OGJ A;  4QYD A;  4XUA A;  5F1H A;  5I7Y A;  4NUE A;  5TCM A;  5K29 A;  4YYN A;  5ENH A;  5EU1 A;  2I7K A;  5L98 A;  3ZYU A;  5HFR A;  5FH7 A;  5FH6 A;  5E9M A;  4HBY A;  3MB4 A;  4O7C A;  4YYK A;  4HXL A;  5JI8 A;  5E9I A;  5EPR A;  5LKT A;  4HXK A;  1ZS5 A;  4NRA A;  3JVJ A;  3MQM A;  3U5J A;  3K2J A;  5EP7 A;  4LDF A;  5G4R A;  4N4I A;  4Z1S A;  5ACY A;  3RCW A;  5AD2 A;  4TU4 A;  1JSP B;  4TYL A;  3O35 A;  4TZ8 A;  4YH3 A;  4A9L A;  4N4H A;  5F60 A;  5F36 A;  4QR3 A;  4QUU A;  3SVG A;  2R0V A;  2R10 A;  4NRC A;  1F68 A;  5CQ6 A;  4QNS A;  2FSA A;  4HXP A;  2RNY A;  5F61 A;  1WUM A;  3MXF A;  5LVQ A;  5COI A;  4ZW1 A;  5CY9 A;  4MEN A;  2YDW A;  4MR3 A;  4HXN A;  5DYC A;  3QZS A;  3LQJ A;  5F2P A;  5F5Z A;  4QEV A;  5FH8 A;  3UVX A;  5HJC A;  4TT6 A; 
#chains in the Genus database with same CATH topology
 5FB1 A;  4CUU A;  4F3I A;  4NUD A;  5D3L A;  4UYE A;  3G0J A;  4BHW A;  4WHU A;  5CUA A;  5EGU A;  5A5N A;  3UVD A;  5FE8 A;  5IGM A;  3UVY A;  5IG6 A;  3ONI A;  4J1P A;  4J0S A;  4Z6H A;  4UYG A;  4NR8 A;  5F62 A;  4LC2 A;  5CS8 A;  5E9Y A;  4QEU A;  4YC9 A;  3IU6 A;  2OO1 A;  3AQA A;  5L8U A;  4CL9 A;  2EJN A;  4IOO A;  4YAB A;  3LQH A;  5F63 A;  2H60 A;  3AAD A;  5FBX A;  5FFV A;  4CUR A;  2RO1 A;  3MUL A;  3S91 A;  5L99 A;  5AME A;  3U5M A;  5HEL A;  5I29 A;  2E7N A;  2F6J A;  4QSX A;  4Y03 A;  5A5S A;  2N9G A;  5CFW A;  4HXS A;  4QC3 A;  4NYV A;  4PY6 A;  3SVH A;  5E3G A;  5LJ0 A;  2L85 A;  3O34 A;  4NR6 A;  5H85 A;  5HQ7 A;  3P1D A;  4PS5 A;  4NYW A;  4A9I A;  5JWM A;  5F25 A;  5D3H A;  5EA1 A;  2YEK A;  5EPB A;  1WUG A;  5FFY A;  4YYJ A;  4PCE A;  4YYD A;  2D82 A;  5DKD A;  4AKI A;  5I80 A;  2DVQ A;  4FLP A;  3VKG A;  3O36 A;  5A81 A;  1JM4 B;  5LKU A;  5E3D A;  5L96 A;  4BW1 A;  4WHW A;  5IBN A;  4N4F A;  4Q0N A;  3U5N A;  5DY7 A;  4CUP A;  4KV1 A;  2WP2 A;  4A9K A;  5CUD A;  4O7A A;  2RS9 B;  4DON A;  3UVW A;  5EV9 A;  4PKL A;  5I40 A;  1PUO A;  5DFB A;  5EIC A;  3NXB A;  4LYI A;  4XYA A;  5E9K A;  5L8T A;  2OUO A;  5A5R A;  5HRW A;  5CUB A;  3LJW A;  5FE4 A;  5E9L A;  4NR7 A;  4YAT A;  4QSS A;  4NR9 A;  5DKC A;  3HME A;  5BT4 A;  5HQ6 A;  3D1D A;  2NXB A;  5FE6 A;  5CQ5 A;  4UIZ A;  5EWD A;  4UYF B;  4TQN A;  5E74 A;  5ETD A;  5FG4 A;  3U5L A;  4LYS A;  2YEM A;  4A9M A;  5EPS A;  5EVA A;  4XY9 A;  4QSQ A;  5D0C A;  4PCI A;  3MB3 A;  3UW9 A;  2WP1 A;  4C67 A;  4NYX A;  5CUE A;  5CP5 A;  5CQ7 A;  4TT2 A;  4X2I A;  5EK9 A;  5BT5 A;  3FKM X;  5CRM A;  4QSR A;  4QSW A;  5C89 A;  5CZG A;  4ZQL A;  5DLX A;  4QSP A;  5KHM A;  3P5O A;  5LJ1 A;  5EQ1 A;  1ZKR A;  4IR5 A;  4ZC9 A;  4QC1 A;  3JVM A;  5DW2 A;  4YBS A;  4A9F A;  4QR5 A;  5FFW A;  5DKH A;  5I88 A;  4YK0 A;  3UV5 A;  5FG6 A;  4TT4 A;  4O77 A;  5LKZ A;  5F3A A;  5DX4 A;  5EWH A;  5ENJ A;  5FB0 A;  4MR5 A;  3LXJ A;  4CUQ A;  2E3K A;  2R0Y A;  4NRB A;  4O75 A;  5C4Q A;  4CUS A;  4LZS A;  5A5O A;  5I7X A;  3QZT A;  5D25 A;  5CTL A;  5CUG A;  5LKX A;  5CQ3 A;  4HBV A;  5ENF A;  4YH4 A;  4QB3 A;  5EWV A;  4HBW A;  4MEO A;  4O72 A;  4BW3 A;  4XY8 A;  3Q2F A;  4NQN A;  4Q0O A;  4TTE A;  4E96 A;  2YW5 A;  5F1L A;  5KU3 A;  4BW4 A;  5I1Q A;  4O74 A;  5L97 A;  3P1F A;  4LZ2 A;  4KV4 A;  5FE7 A;  5A5Q A;  5D3J A;  5CQA A;  3O37 A;  4QSV A;  5ENG A;  4CLB A;  5CRZ A;  4NXJ A;  4ALG A;  4NR4 A;  5HRX A;  5G4S A;  4MEQ A;  5KTW A;  5CQ8 A;  5A83 A;  5EWW A;  4UYD A;  4HBX A;  4CFK A;  4MR4 A;  4YYI A;  5IGN A;  5C87 A;  5H1U A;  5LVR A;  2DVV A;  4XUB A;  5CQ4 A;  3HMF A;  2R0S A;  5D7X A;  4LRG A;  4QYL A;  5FE3 A;  5CQT A;  4AKN A;  5DLZ A;  3I3J A;  5D3P A;  5I83 A;  4UIU A;  4GPJ A;  4A9O A;  5DBM A;  2E7O A;  4QEW A;  5II2 A;  5FE9 A;  4PTB A;  5E0R A;  5EIS A;  5AMF A;  5EI4 A;  5HFQ A;  5D3S A;  1EQF A;  2RNX A;  4QZS A;  4OUF A;  4BW2 A;  5D24 A;  2D9E A;  5H1V A;  5E7D A;  3P1C A;  4OGI A;  5A85 A;  4O7E A;  4LZR A;  4BJX A;  4O7F A;  5D26 A;  3TLP A;  4YAD A;  4O70 A;  1X0J A;  2DVR A;  2G4A A;  5C8G A;  5DYU A;  5E73 A;  4A9E A;  5KTX A;  4HXR A;  4TS8 A;  5D3T A;  1E6I A;  4QY4 A;  3HMH A;  3SVF A;  4YBM A;  3JVK A;  2OSS A;  5DW1 A;  4UIV A;  5FE0 A;  2F6N A;  4UYH A;  4LYW A;  3D1B A;  3GG3 A;  5ENI A;  4A9J A;  4YY6 A;  4Z1Q A;  5DFD A;  5IGL A;  1N72 A;  5CU8 A;  4A9H A;  5HCL A;  5DYA A;  3UV4 A;  4NUC A;  4TU6 A;  5A82 A;  5D3N A;  2DWW A;  2YEL A;  5FE5 A;  5KO4 A;  5FE2 A;  5IGK A;  4O76 A;  5HEN A;  5ETB A;  3U5O A;  3D7C A;  5BT3 A;  5E9V A;  3LQI A;  4HXO A;  5HEM A;  5AD3 A;  2L5E A;  4KCX A;  4IR4 A;  4O71 A;  4Z93 A;  4YBT A;  2KTB B;  4O7B A;  4J0R A;  4N3W A;  4HXM A;  5CGP A;  5DYX A;  4RVR A;  5C7N A;  4UYF A;  5EM3 A;  4IR6 A;  4YYM A;  5EWC A;  4QUT A;  4IOR A;  4AKG A;  3S92 A;  4WIV A;  5HM0 A;  5I86 A;  3P1E A;  5ENB A;  3QZV A;  5CUC A;  4YY4 A;  3U5K A;  4NQM A;  4O78 A;  5FDZ A;  5A7C A;  4UIY A;  3DWY A;  5IID A;  3IU5 A;  4UIW A;  3G0L A;  4AI6 A;  5ENE A;  2YYN A;  4LR6 A;  5HRV A;  2MJV B;  2GRC A;  5HLS A;  4N4G A;  5HQ5 A;  5CPE A;  5I89 A;  2DAT A;  3MUK A;  5FG5 A;  3DAI A;  5LJ2 A;  5FE1 A;  5A5P A;  5J0D A;  3JVL A;  4AKH A;  4Z6I A;  4J3I A;  4IR3 A;  2RFJ A;  5C85 A;  4TZ2 A;  5H1T A;  4CUT A;  4MEP A;  4MR6 A;  5II1 A;  3O33 A;  4QSU A;  4UIX A;  4UIT A;  5LUU A;  4A9N A;  4ALH A;  4IOQ A;  4QST A;  2YQD A;  2RNW A;  4YAX A;  2I8N A;  4NS5 A;  4C66 A;  4YYG A;  5DFC A;  2LSP B;  5D3R A;  3Q2E A;  2L84 A;  2DVS A;  5ENC A;  2DKW A;  3VKH A;  4NR5 A;  2RI7 A;  3U5P A;  4QBM A;  5TB6 A;  4CFL A;  3UV2 A;  4YYH A;  4QR4 A;  5KTU A;  4OGJ A;  4QYD A;  4XUA A;  5F1H A;  5I7Y A;  4NUE A;  5TCM A;  5K29 A;  4YYN A;  5ENH A;  5EU1 A;  2I7K A;  5L98 A;  3ZYU A;  5HFR A;  5FH7 A;  5FH6 A;  5E9M A;  4HBY A;  3MB4 A;  4O7C A;  4YYK A;  4HXL A;  5JI8 A;  5E9I A;  5EPR A;  5LKT A;  4HXK A;  1ZS5 A;  4NRA A;  3JVJ A;  3MQM A;  3U5J A;  3K2J A;  5EP7 A;  4LDF A;  5G4R A;  4N4I A;  4Z1S A;  5ACY A;  3RCW A;  5AD2 A;  4TU4 A;  1JSP B;  3ERR A;  4TYL A;  3O35 A;  4TZ8 A;  4YH3 A;  4A9L A;  4N4H A;  5F60 A;  5F36 A;  4QR3 A;  4QUU A;  3SVG A;  2R0V A;  2R10 A;  4NRC A;  1F68 A;  5CQ6 A;  4QNS A;  2FSA A;  4HXP A;  2RNY A;  5F61 A;  1WUM A;  3MXF A;  5LVQ A;  5COI A;  4ZW1 A;  5CY9 A;  4MEN A;  2YDW A;  4MR3 A;  4HXN A;  5DYC A;  3QZS A;  3LQJ A;  5F2P A;  5F5Z A;  4QEV A;  5FH8 A;  3UVX A;  5HJC A;  4TT6 A; 
#chains in the Genus database with same CATH homology
 5FB1 A;  4CUU A;  4F3I A;  4NUD A;  5D3L A;  4UYE A;  3G0J A;  4BHW A;  4WHU A;  5CUA A;  5EGU A;  5A5N A;  3UVD A;  5FE8 A;  5IGM A;  3UVY A;  5IG6 A;  3ONI A;  4J1P A;  4J0S A;  4Z6H A;  4UYG A;  4NR8 A;  5F62 A;  4LC2 A;  5CS8 A;  5E9Y A;  4QEU A;  4YC9 A;  3IU6 A;  2OO1 A;  3AQA A;  5L8U A;  4CL9 A;  4IOO A;  4YAB A;  3LQH A;  5F63 A;  2H60 A;  3AAD A;  5FBX A;  5FFV A;  4CUR A;  2RO1 A;  3MUL A;  3S91 A;  5L99 A;  5AME A;  3U5M A;  5HEL A;  5I29 A;  2E7N A;  2F6J A;  4QSX A;  4Y03 A;  5A5S A;  2N9G A;  5CFW A;  4HXS A;  4QC3 A;  4NYV A;  4PY6 A;  3SVH A;  5E3G A;  5LJ0 A;  2L85 A;  3O34 A;  4NR6 A;  5H85 A;  5HQ7 A;  3P1D A;  4PS5 A;  4NYW A;  4A9I A;  5JWM A;  5F25 A;  5D3H A;  5EA1 A;  2YEK A;  5EPB A;  1WUG A;  5FFY A;  4YYJ A;  4PCE A;  4YYD A;  2D82 A;  5DKD A;  5I80 A;  2DVQ A;  4FLP A;  3O36 A;  5A81 A;  1JM4 B;  5LKU A;  5E3D A;  5L96 A;  4BW1 A;  4WHW A;  5IBN A;  4N4F A;  4Q0N A;  3U5N A;  5DY7 A;  4CUP A;  4KV1 A;  2WP2 A;  4A9K A;  5CUD A;  4O7A A;  2RS9 B;  4DON A;  3UVW A;  5EV9 A;  4PKL A;  5I40 A;  5DFB A;  5EIC A;  3NXB A;  4LYI A;  4XYA A;  5E9K A;  5L8T A;  2OUO A;  5A5R A;  5HRW A;  5CUB A;  3LJW A;  5FE4 A;  5E9L A;  4NR7 A;  4YAT A;  4QSS A;  4NR9 A;  5DKC A;  3HME A;  5BT4 A;  5HQ6 A;  5FE6 A;  2NXB A;  5CQ5 A;  4UIZ A;  5EWD A;  4UYF B;  4TQN A;  5E74 A;  5ETD A;  5FG4 A;  3U5L A;  4LYS A;  2YEM A;  4A9M A;  5EPS A;  5EVA A;  4XY9 A;  4QSQ A;  5D0C A;  4PCI A;  3MB3 A;  3UW9 A;  2WP1 A;  4C67 A;  4NYX A;  5CUE A;  5CP5 A;  5CQ7 A;  4TT2 A;  4X2I A;  5EK9 A;  5BT5 A;  3FKM X;  5CRM A;  4QSR A;  4QSW A;  5C89 A;  5CZG A;  4ZQL A;  5DLX A;  4QSP A;  5KHM A;  3P5O A;  5LJ1 A;  5EQ1 A;  4IR5 A;  4ZC9 A;  4QC1 A;  3JVM A;  5DW2 A;  4YBS A;  4A9F A;  4QR5 A;  5FFW A;  5DKH A;  5I88 A;  4YK0 A;  3UV5 A;  5FG6 A;  4TT4 A;  4O77 A;  5LKZ A;  5F3A A;  5DX4 A;  5EWH A;  5ENJ A;  5FB0 A;  4MR5 A;  3LXJ A;  4CUQ A;  2E3K A;  2R0Y A;  4NRB A;  4O75 A;  5C4Q A;  4CUS A;  4LZS A;  5A5O A;  5I7X A;  3QZT A;  5D25 A;  5CTL A;  5CUG A;  5LKX A;  5CQ3 A;  4HBV A;  5ENF A;  4YH4 A;  4QB3 A;  5EWV A;  4HBW A;  4MEO A;  4O72 A;  4BW3 A;  4XY8 A;  3Q2F A;  4NQN A;  4Q0O A;  4TTE A;  4E96 A;  2YW5 A;  5F1L A;  5KU3 A;  4BW4 A;  5I1Q A;  4O74 A;  5L97 A;  3P1F A;  4LZ2 A;  4KV4 A;  5FE7 A;  5A5Q A;  5D3J A;  5CQA A;  3O37 A;  4QSV A;  5ENG A;  4CLB A;  5CRZ A;  4NXJ A;  4ALG A;  4NR4 A;  5HRX A;  5G4S A;  4MEQ A;  5KTW A;  5CQ8 A;  5A83 A;  5EWW A;  4UYD A;  4HBX A;  4CFK A;  4MR4 A;  4YYI A;  5IGN A;  5C87 A;  5H1U A;  5LVR A;  2DVV A;  4XUB A;  5CQ4 A;  3HMF A;  2R0S A;  5D7X A;  4LRG A;  4QYL A;  5FE3 A;  5CQT A;  4AKN A;  5DLZ A;  3I3J A;  5D3P A;  5I83 A;  4UIU A;  4GPJ A;  4A9O A;  5DBM A;  2E7O A;  4QEW A;  5II2 A;  5FE9 A;  4PTB A;  5E0R A;  5EIS A;  5AMF A;  5EI4 A;  5HFQ A;  5D3S A;  1EQF A;  2RNX A;  4QZS A;  4OUF A;  4BW2 A;  5D24 A;  2D9E A;  5H1V A;  5E7D A;  3P1C A;  4OGI A;  5A85 A;  4O7E A;  4LZR A;  4BJX A;  4O7F A;  5D26 A;  3TLP A;  4YAD A;  4O70 A;  1X0J A;  2DVR A;  2G4A A;  5C8G A;  5DYU A;  5E73 A;  4A9E A;  5KTX A;  4HXR A;  4TS8 A;  5D3T A;  1E6I A;  4QY4 A;  3HMH A;  3SVF A;  4YBM A;  3JVK A;  2OSS A;  5DW1 A;  4UIV A;  5FE0 A;  2F6N A;  4UYH A;  4LYW A;  3GG3 A;  5ENI A;  4A9J A;  4YY6 A;  4Z1Q A;  5DFD A;  5IGL A;  1N72 A;  5CU8 A;  4A9H A;  5HCL A;  5DYA A;  3UV4 A;  4NUC A;  4TU6 A;  5A82 A;  5D3N A;  2DWW A;  2YEL A;  5FE5 A;  5KO4 A;  5FE2 A;  5IGK A;  4O76 A;  5HEN A;  5ETB A;  3U5O A;  3D7C A;  5BT3 A;  5E9V A;  3LQI A;  4HXO A;  5HEM A;  5AD3 A;  2L5E A;  4KCX A;  4IR4 A;  4O71 A;  4Z93 A;  4YBT A;  2KTB B;  4O7B A;  4J0R A;  4N3W A;  4HXM A;  5CGP A;  5DYX A;  4RVR A;  5C7N A;  4UYF A;  5EM3 A;  4IR6 A;  4YYM A;  5EWC A;  4QUT A;  4IOR A;  3S92 A;  4WIV A;  5HM0 A;  5I86 A;  3P1E A;  5ENB A;  3QZV A;  5CUC A;  4YY4 A;  3U5K A;  4NQM A;  4O78 A;  5FDZ A;  5A7C A;  4UIY A;  3DWY A;  5IID A;  3IU5 A;  4UIW A;  3G0L A;  5ENE A;  2YYN A;  4LR6 A;  5HRV A;  2MJV B;  2GRC A;  5HLS A;  4N4G A;  5HQ5 A;  5CPE A;  5I89 A;  2DAT A;  3MUK A;  5FG5 A;  3DAI A;  5LJ2 A;  5FE1 A;  5A5P A;  5J0D A;  3JVL A;  4Z6I A;  4J3I A;  4IR3 A;  2RFJ A;  5C85 A;  4TZ2 A;  5H1T A;  4CUT A;  4MEP A;  4MR6 A;  5II1 A;  3O33 A;  4QSU A;  4UIX A;  4UIT A;  5LUU A;  4A9N A;  4ALH A;  4IOQ A;  4QST A;  2YQD A;  2RNW A;  4YAX A;  2I8N A;  4NS5 A;  4C66 A;  4YYG A;  5DFC A;  2LSP B;  5D3R A;  3Q2E A;  2L84 A;  2DVS A;  5ENC A;  2DKW A;  4NR5 A;  2RI7 A;  3U5P A;  4QBM A;  5TB6 A;  4CFL A;  3UV2 A;  4YYH A;  4QR4 A;  5KTU A;  4OGJ A;  4QYD A;  4XUA A;  5F1H A;  5I7Y A;  4NUE A;  5TCM A;  5K29 A;  4YYN A;  5ENH A;  5EU1 A;  2I7K A;  5L98 A;  3ZYU A;  5HFR A;  5FH7 A;  5FH6 A;  5E9M A;  4HBY A;  3MB4 A;  4O7C A;  4YYK A;  4HXL A;  5JI8 A;  5E9I A;  5EPR A;  5LKT A;  4HXK A;  1ZS5 A;  4NRA A;  3JVJ A;  3MQM A;  3U5J A;  3K2J A;  5EP7 A;  4LDF A;  5G4R A;  4N4I A;  4Z1S A;  5ACY A;  3RCW A;  5AD2 A;  4TU4 A;  1JSP B;  4TYL A;  3O35 A;  4TZ8 A;  4YH3 A;  4A9L A;  4N4H A;  5F60 A;  5F36 A;  4QR3 A;  4QUU A;  3SVG A;  2R0V A;  2R10 A;  4NRC A;  1F68 A;  5CQ6 A;  4QNS A;  2FSA A;  4HXP A;  2RNY A;  5F61 A;  1WUM A;  3MXF A;  5LVQ A;  5COI A;  4ZW1 A;  5CY9 A;  4MEN A;  2YDW A;  4MR3 A;  4HXN A;  5DYC A;  3QZS A;  3LQJ A;  5F2P A;  5F5Z A;  4QEV A;  5FH8 A;  3UVX A;  5HJC A;  4TT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...