3MQMA

Crystal structure of the bromodomain of human ash1l
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
126
structure length
126
Chain Sequence
SMEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Probable histone-lysine N-methyltransferase ASH1L
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mqmA00
5IGNA 2OO1A 5FE9A 5CQ5A 5H1UA 4PTBA 5ENIA 4BW2A 4PKLA 4NYVA 4PY6A 5C85A 4NUCA 5CUAA 5KHMA 2DVQA 5I1QA 4LZ2A 2YEKA 5FG4A 5A82A 5FDZA 4YC9A 2YDWA 2D9EA 4LYIA 5TB6A 5C4QA 5DKCA 5ENBA 4Q0OA 3UVXA 5AD2A 2DWWA 4A9KA 3UVWA 5J0DA 4UIVA 5F5ZA 4A9NA 5BT4A 3IU5A 5L8UA 4OGIA 3U5JA 4ALHA 4BJXA 4UYGA 4QSPA 5DYXA 3MULA 4XUAA 4YH4A 4YYIA 5CQ3A 5LKXA 2OUOA 2L84A 5LJ1A 2R0YA 3MB4A 2E7NA 4N4FA 5HQ7A 5IGLA 2FSAA 5A7CA 3RCWA 5ACYA 5FE6A 5EU1A 2OSSA 2RNXA 3JVLA 1E6IA 4YH3A 4LDFA 5FE7A 5EWCA 3HMEA 4IOOA 3O34A 3K2JA 2G4AA 5D3NA 5ENGA 4QZSA 2L5EA 5CPEA 5FFYA 5I7YA 5HELA 4UIYA 2R0SA 3UW9A 4IR5A 4IR6A 5D3RA 5CFWA 2DVVA 5EI4A 3U5MA 5IGKA 4BHWA 5E3DA 4HXMA 5ENCA 4QR3A 4XUBA 4LZSA 4MEPA 4LYWA 4QNSA 5DW2A 5FE8A 5CQ7A 4CUTA 5LKZA 4O76A 5C7NA 5DYUA 5F1LA 4QSRA 5KU3A 5EVAA 4OGJA 5EWDA 3I3JA 4NR9A 4YBMA 4QSXA 4NRBA 5FE5A 4IOQA 5I86A 3SVHA 4QUTA 5A5QA 2NXBA 4QB3A 5E9IA 2WP1A 4YABA 4O7FA 5IGMA 4XYAA 4KV1A 4LRGA 3NXBA 5D0CA 5HM0A 5CTLA 4UYFB 5HEMA 5LKTA 4A9HA 5I89A 4BW3A 4YATA 5FH8A 4Z1QA 4NUEA 4QC3A 4YYHA 4DONA 5L98A 5CQ8A 5EICA 3HMHA 3TLPA 5HRXA 4QC1A 5BT3A 5E74A 3MQMA 4O75A 2I8NA 4UYEA 5I40A 5KTXA 5HFRA 5A5OA 5I88A 4Q0NA 5DYCA 4X2IA 3JVKA 4O7BA 4RVRA 5CRZA 3S92A 5I29A 3AADA 5D3LA 5F1HA 5HLSA 4A9IA 4ALGA 5D7XA 4NXJA 4QR5A 2F6NA 4ZQLA 4TU4A 5EV9A 4LC2A 2RI7A 2WP2A 4HXPA 5DY7A 5FG5A 4TT6A 4KCXA 3P1DA 4YYNA 4O7CA 2E3KA 4YADA 3O35A 3SVGA 5I80A 5E7DA 3P1EA 5ENFA 4A9FA 5EQ1A 2RFJA 3HMFA 3U5KA 4HXSA 4NS5A 5HJCA 4J1PA 4Z93A 4QYLA 1N72A 5FE0A 5ENEA 4AKNA 4HBVA 5JI8A 5KTUA 5FE2A 5D26A 1ZS5A 5D3HA 4NYXA 4MEOA 2GRCA 5D3PA 2E7OA 2I7KA 5CRMA 5LVQA 1JSPB 3P5OA 4N4IA 4A9JA 5E9MA 5KO4A 4A9EA 5CGPA 4YAXA 2DVRA 3P1CA 4QSUA 4WHWA 2RNWA 5A5PA 2LSPB 2R0VA 5EPSA 2R10A 5EP7A 2YW5A 5DYAA 3D7CA 5FE4A 5EISA 4IORA 2L85A 5JWMA 4O72A 5DFDA 5FH6A 5E9KA 4TTEA 4CFKA 4UITA 4YYGA 4HXRA 5IIDA 5LVRA 4A9MA 2H60A 5FFWA 5EGUA 4YYKA 5DW1A 5CUGA 3ONIA 5DFBA 4ZW1A 5HQ6A 5D3JA 5EPBA 5H85A 5G4RA 5FH7A 4MR5A 3UV5A 5CQ4A 5AMEA 3QZVA 5CY9A 3LQHA 4YBSA 4O78A 5IG6A 5A81A 3AQAA 4O71A 4LYSA 5D3SA 4UYFA 4TQNA 2DATA 5CUBA 5HFQA 4QR4A 3MUKA 4YY6A 5I83A 2YEMA 4J3IA 4HXLA 4NR7A 4HBYA 5AMFA 1EQFA 5COIA 1WUGA 3P1FA 4UIWA 4YY4A 5L96A 4YBTA 3QZTA 4QBMA 3G0JA 5DFCA 5CP5A 4MR4A 5FBXA 3Q2EA 4TS8A 3G0LA 3LQJA 5HQ5A 4LR6A 5CQAA 1F68A 5DLZA 2YQDA 3U5LA 3FKMX 4J0SA 4HXNA 4O77A 4NRCA 3Q2FA 5EM3A 5E9VA 5LKUA 4NR5A 4NYWA 4MR6A 3UVDA 4BW4A 5EA1A 4CUQA 4KV4A 4YYMA 5H1TA 4MENA 4A9OA 5II1A 4ZC9A 3U5OA 4CUPA 5C8GA 5TCMA 5I7XA 4HBWA 4Z1SA 5ENHA 5CQ6A 4O70A 4E96A 5LJ0A 4Z6HA 3QZSA 2RNYA 2D82A 5L8TA 4BW1A 4N4HA 3O33A 3LXJA 4UIXA 3LQIA 4QEWA 4UYDA 5H1VA 4XY9A 5D3TA 5L97A 4UIZA 5A85A 4TYLA 4QUUA 5K29A 5A83A 5A5RA 3JVMA 5F2PA 4CUSA 4CUUA 5C89A 4GPJA 4F3IA 4LZRA 3IU6A 4HXOA 4PCIA 2YYNA 3MB3A 4YK0A 5F62A 5A5NA 5LUUA 5EK9A 4QY4A 3LJWA 4QSTA 4QEVA 5L99A 4NQMA 5F60A 4QSWA 2N9GA 5EPRA 4QSQA 5E3GA 4O74A 3ZYUA 5HENA 5ETDA 3MXFA 4IR4A 5FB1A 5F36A 2KTBB 4O7EA 4UYHA 5CU8A 4FLPA 5G4SA 4IR3A 4PCEA 4TZ2A 5HCLA 4NRAA 5CZGA 4N3WA 5D25A 5EWWA 5FE3A 5BT5A 5CS8A 4WIVA 2RO1A 4J0RA 5A5SA 5EWVA 5HRVA 4QEUA 5CUEA 5HRWA 4NQNA 5E0RA 5FG6A 5F3AA 5E9YA 4QSVA 4TT4A 3O37A 5ETBA 5FB0A 3O36A 4O7AA 3DWYA 5D24A 3JVJA 5DKDA 2RS9B 5DLXA 4OUFA 4Z6IA 5IBNA 4NUDA 3SVFA 1JM4B 5FE1A 4Y03A 4YYJA 5AD3A 5DBMA 4WHUA 4CL9A 5EWHA 4UIUA 5KTWA 4XY8A 5ENJA 5F61A 4HXKA 4TU6A 4CURA 5DX4A 3DAIA 4NR4A 3U5NA 4N4GA 2DKWA 5F25A 3GG3A 4C66A 3UV4A 2MJVB 4A9LA 1X0JA 5E73A 5FFVA 3UV2A 5CUDA 4C67A 2YELA 4MR3A 5E9LA 4TZ8A 4YYDA 4CLBA 4TT2A 4QYDA 5LJ2A 4NR6A 1WUMA 3UVYA 2DVSA 4HBXA 4QSSA 4NR8A 4CFLA 2F6JA 3U5PA 5CQTA 5F63A 5DKHA 4MEQA 5C87A 4PS5A 5CUCA 3S91A 5II2A
chains in the Genus database with same CATH superfamily
5IGNA 2OO1A 5FE9A 5CQ5A 5H1UA 4PTBA 5ENIA 4BW2A 4PKLA 4NYVA 4PY6A 5C85A 4NUCA 5CUAA 5KHMA 2DVQA 5I1QA 4LZ2A 2YEKA 5FG4A 5A82A 5FDZA 4YC9A 2YDWA 2D9EA 4LYIA 5TB6A 5C4QA 5DKCA 5ENBA 4Q0OA 3UVXA 5AD2A 2DWWA 4A9KA 3UVWA 5J0DA 4UIVA 5F5ZA 4A9NA 5BT4A 3IU5A 5L8UA 4OGIA 3U5JA 4ALHA 4BJXA 4UYGA 4QSPA 5DYXA 3MULA 4XUAA 4YH4A 4YYIA 5CQ3A 5LKXA 2OUOA 2L84A 5LJ1A 2R0YA 3MB4A 2E7NA 4N4FA 5HQ7A 5IGLA 2FSAA 5A7CA 3RCWA 5ACYA 5FE6A 5EU1A 2OSSA 2RNXA 3JVLA 1E6IA 4YH3A 4LDFA 5FE7A 5EWCA 3HMEA 4IOOA 3O34A 3K2JA 2G4AA 5D3NA 5ENGA 4QZSA 2L5EA 5CPEA 5FFYA 5I7YA 5HELA 4UIYA 2R0SA 3UW9A 4IR5A 5D3RA 4IR6A 5CFWA 2DVVA 5EI4A 3U5MA 5IGKA 4BHWA 5E3DA 4HXMA 5ENCA 4QR3A 4XUBA 4LZSA 4MEPA 4LYWA 4QNSA 5DW2A 5FE8A 5CQ7A 4CUTA 5LKZA 4O76A 5C7NA 5DYUA 5F1LA 4QSRA 5KU3A 5EVAA 4OGJA 5EWDA 3I3JA 4NR9A 4YBMA 4QSXA 4NRBA 5FE5A 4IOQA 5I86A 3SVHA 4QUTA 5A5QA 2NXBA 4QB3A 5E9IA 2WP1A 4YABA 4O7FA 5IGMA 4XYAA 4KV1A 4LRGA 3NXBA 5D0CA 5HM0A 5CTLA 4UYFB 5HEMA 5LKTA 4A9HA 5I89A 4BW3A 4YATA 5FH8A 4Z1QA 4NUEA 4QC3A 4YYHA 4DONA 5L98A 5CQ8A 5EICA 3HMHA 3TLPA 5HRXA 4QC1A 5BT3A 5E74A 3MQMA 4O75A 2I8NA 4UYEA 5I40A 5KTXA 5HFRA 5A5OA 5I88A 4Q0NA 5DYCA 4AKIA 4X2IA 3JVKA 4O7BA 4RVRA 5CRZA 3VKGA 3S92A 5I29A 3AADA 5D3LA 5F1HA 5HLSA 4A9IA 4ALGA 5D7XA 4NXJA 4QR5A 2F6NA 4ZQLA 4TU4A 5EV9A 4LC2A 2RI7A 2WP2A 4HXPA 5DY7A 5FG5A 4TT6A 4KCXA 3P1DA 4YYNA 4O7CA 2E3KA 4YADA 3O35A 3SVGA 5I80A 5E7DA 3P1EA 5ENFA 4A9FA 5EQ1A 2RFJA 3HMFA 3U5KA 4HXSA 4NS5A 5HJCA 4J1PA 4Z93A 4QYLA 1N72A 5FE0A 5ENEA 4AKNA 4HBVA 5JI8A 5KTUA 5FE2A 5D26A 1ZS5A 5D3HA 4NYXA 4MEOA 2GRCA 5D3PA 4AKGA 2E7OA 2I7KA 5CRMA 5LVQA 1JSPB 3P5OA 4N4IA 4A9JA 5E9MA 5KO4A 4A9EA 5CGPA 4YAXA 2DVRA 3P1CA 4QSUA 4WHWA 2RNWA 5A5PA 2LSPB 2R0VA 5EPSA 2R10A 5EP7A 2YW5A 5DYAA 3D7CA 5FE4A 5EISA 4IORA 2L85A 5JWMA 4O72A 5DFDA 5FH6A 5E9KA 4TTEA 4CFKA 4UITA 4YYGA 4HXRA 5IIDA 5LVRA 4A9MA 2H60A 5FFWA 5EGUA 4YYKA 5DW1A 3D1DA 5CUGA 3ONIA 5DFBA 4ZW1A 5HQ6A 5D3JA 5EPBA 5H85A 5G4RA 5FH7A 4MR5A 3UV5A 5CQ4A 5AMEA 3QZVA 5CY9A 3LQHA 4YBSA 4O78A 5IG6A 5A81A 3AQAA 4O71A 4LYSA 5D3SA 4UYFA 4TQNA 2DATA 5CUBA 5HFQA 4QR4A 3MUKA 4YY6A 5I83A 2YEMA 4J3IA 4HXLA 4NR7A 4HBYA 5AMFA 1EQFA 5COIA 1WUGA 1ZKRA 3P1FA 4UIWA 4YY4A 5L96A 4YBTA 3QZTA 4QBMA 3G0JA 5CP5A 5DFCA 4MR4A 5FBXA 3Q2EA 4TS8A 3G0LA 3LQJA 5HQ5A 4LR6A 5CQAA 1F68A 5DLZA 2YQDA 3U5LA 3FKMX 4J0SA 4HXNA 4O77A 4NRCA 1PUOA 3Q2FA 5EM3A 5E9VA 5LKUA 4NR5A 4NYWA 4MR6A 3UVDA 4BW4A 5EA1A 4CUQA 4KV4A 4YYMA 5H1TA 4MENA 4A9OA 5II1A 4ZC9A 3U5OA 4CUPA 5C8GA 5TCMA 5I7XA 4HBWA 4Z1SA 5ENHA 5CQ6A 4O70A 4E96A 4AKHA 5LJ0A 4Z6HA 3QZSA 2RNYA 2D82A 5L8TA 4BW1A 2EJNA 4N4HA 3O33A 3LXJA 4UIXA 3LQIA 4QEWA 4UYDA 5H1VA 4XY9A 5D3TA 5L97A 4UIZA 5A85A 4TYLA 4QUUA 5K29A 5A83A 5A5RA 3JVMA 5F2PA 4CUSA 4CUUA 5C89A 4GPJA 4F3IA 4LZRA 3IU6A 4HXOA 4PCIA 2YYNA 3MB3A 4YK0A 5F62A 5A5NA 5LUUA 5EK9A 4QY4A 3LJWA 4QSTA 4QEVA 5L99A 4NQMA 5F60A 4QSWA 2N9GA 5EPRA 4QSQA 5E3GA 4O74A 3ZYUA 5HENA 5ETDA 3MXFA 4IR4A 5FB1A 5F36A 2KTBB 4O7EA 4UYHA 5CU8A 4FLPA 5G4SA 4IR3A 4PCEA 4TZ2A 5HCLA 4NRAA 5CZGA 4N3WA 5D25A 5EWWA 5FE3A 5BT5A 5CS8A 4WIVA 2RO1A 4J0RA 5A5SA 5EWVA 5HRVA 4QEUA 5CUEA 5HRWA 4NQNA 5E0RA 5FG6A 5F3AA 5E9YA 4QSVA 4TT4A 3O37A 5ETBA 5FB0A 3O36A 4O7AA 3DWYA 5D24A 3JVJA 5DKDA 2RS9B 5DLXA 4OUFA 4Z6IA 5IBNA 4NUDA 3SVFA 1JM4B 5FE1A 3ERRA 4Y03A 4YYJA 5AD3A 5DBMA 4WHUA 4CL9A 5EWHA 4UIUA 5KTWA 4XY8A 5ENJA 5F61A 4HXKA 4TU6A 4CURA 5DX4A 3DAIA 4NR4A 3U5NA 4N4GA 2DKWA 5F25A 3D1BA 4AI6A 3GG3A 4C66A 3UV4A 2MJVB 4A9LA 1X0JA 5E73A 5FFVA 3UV2A 5CUDA 4C67A 2YELA 4MR3A 5E9LA 4TZ8A 4YYDA 4CLBA 4TT2A 4QYDA 5LJ2A 4NR6A 1WUMA 3UVYA 2DVSA 4HBXA 4QSSA 4NR8A 4CFLA 2F6JA 3U5PA 3VKHA 5CQTA 5F63A 5DKHA 4MEQA 5C87A 4PS5A 5CUCA 3S91A 5II2A
chains in the Genus database with same CATH topology
5IGNA 2OO1A 5FE9A 5CQ5A 5H1UA 4PTBA 5ENIA 4BW2A 4PKLA 4NYVA 4PY6A 5C85A 4NUCA 5CUAA 5KHMA 2DVQA 5I1QA 4LZ2A 2YEKA 5FG4A 5A82A 5FDZA 4YC9A 2YDWA 2D9EA 4LYIA 5TB6A 5C4QA 5DKCA 5ENBA 4Q0OA 3UVXA 5AD2A 2DWWA 4A9KA 3UVWA 5J0DA 4UIVA 5F5ZA 4A9NA 5BT4A 3IU5A 5L8UA 4OGIA 3U5JA 4ALHA 4BJXA 4UYGA 4QSPA 5DYXA 3MULA 4XUAA 4YH4A 4YYIA 5CQ3A 5LKXA 2OUOA 2L84A 5LJ1A 2R0YA 3MB4A 2E7NA 4N4FA 5HQ7A 5IGLA 2FSAA 5A7CA 3RCWA 5ACYA 5FE6A 5EU1A 2OSSA 2RNXA 3JVLA 1E6IA 4YH3A 4LDFA 5FE7A 5EWCA 3HMEA 4IOOA 3O34A 3K2JA 2G4AA 5D3NA 5ENGA 4QZSA 2L5EA 5CPEA 5FFYA 5I7YA 5HELA 4UIYA 2R0SA 3UW9A 4IR5A 4IR6A 5D3RA 5CFWA 2DVVA 5EI4A 3U5MA 5IGKA 4BHWA 5E3DA 4HXMA 5ENCA 4QR3A 4XUBA 4LZSA 4MEPA 4LYWA 4QNSA 5DW2A 5FE8A 5CQ7A 4CUTA 5LKZA 4O76A 5C7NA 5DYUA 5F1LA 4QSRA 5KU3A 5EVAA 4OGJA 5EWDA 3I3JA 4NR9A 4YBMA 4QSXA 4NRBA 5FE5A 4IOQA 5I86A 3SVHA 4QUTA 5A5QA 2NXBA 4QB3A 5E9IA 2WP1A 4YABA 4O7FA 5IGMA 4XYAA 4KV1A 4LRGA 3NXBA 5D0CA 5HM0A 5CTLA 4UYFB 5HEMA 5LKTA 4A9HA 5I89A 4BW3A 4YATA 5FH8A 4Z1QA 4NUEA 4QC3A 4YYHA 4DONA 5L98A 5CQ8A 5EICA 3HMHA 3TLPA 5HRXA 4QC1A 5BT3A 5E74A 3MQMA 4O75A 2I8NA 4UYEA 5I40A 5KTXA 5HFRA 5A5OA 5I88A 4Q0NA 5DYCA 4X2IA 3JVKA 4O7BA 4RVRA 5CRZA 3S92A 5I29A 3AADA 5D3LA 5F1HA 5HLSA 4A9IA 4ALGA 5D7XA 4NXJA 4QR5A 2F6NA 4ZQLA 4TU4A 5EV9A 4LC2A 2RI7A 2WP2A 4HXPA 5DY7A 5FG5A 4TT6A 4KCXA 3P1DA 4YYNA 4O7CA 2E3KA 4YADA 3O35A 3SVGA 5I80A 5E7DA 3P1EA 5ENFA 4A9FA 5EQ1A 2RFJA 3HMFA 3U5KA 4HXSA 4NS5A 5HJCA 4J1PA 4Z93A 4QYLA 1N72A 5FE0A 5ENEA 4AKNA 4HBVA 5JI8A 5KTUA 5FE2A 5D26A 1ZS5A 5D3HA 4NYXA 4MEOA 2GRCA 5D3PA 2E7OA 2I7KA 5CRMA 5LVQA 1JSPB 3P5OA 4N4IA 4A9JA 5E9MA 5KO4A 4A9EA 5CGPA 4YAXA 2DVRA 3P1CA 4QSUA 4WHWA 2RNWA 5A5PA 2LSPB 2R0VA 5EPSA 2R10A 5EP7A 2YW5A 5DYAA 3D7CA 5FE4A 5EISA 4IORA 2L85A 5JWMA 4O72A 5DFDA 5FH6A 5E9KA 4TTEA 4CFKA 4UITA 4YYGA 4HXRA 5IIDA 5LVRA 4A9MA 2H60A 5FFWA 5EGUA 4YYKA 5DW1A 5CUGA 3ONIA 5DFBA 4ZW1A 5HQ6A 5D3JA 5EPBA 5H85A 5G4RA 5FH7A 4MR5A 3UV5A 5CQ4A 5AMEA 3QZVA 5CY9A 3LQHA 4YBSA 4O78A 5IG6A 5A81A 3AQAA 4O71A 4LYSA 5D3SA 4UYFA 4TQNA 2DATA 5CUBA 5HFQA 4QR4A 3MUKA 4YY6A 5I83A 2YEMA 4J3IA 4HXLA 4NR7A 4HBYA 5AMFA 1EQFA 5COIA 1WUGA 3P1FA 4UIWA 4YY4A 5L96A 4YBTA 3QZTA 4QBMA 3G0JA 5DFCA 5CP5A 4MR4A 5FBXA 3Q2EA 4TS8A 3G0LA 3LQJA 5HQ5A 4LR6A 5CQAA 1F68A 5DLZA 2YQDA 3U5LA 3FKMX 4J0SA 4HXNA 4O77A 4NRCA 3Q2FA 5EM3A 5E9VA 5LKUA 4NR5A 4NYWA 4MR6A 3UVDA 4BW4A 5EA1A 4CUQA 4KV4A 4YYMA 5H1TA 4MENA 4A9OA 5II1A 4ZC9A 3U5OA 4CUPA 5C8GA 5TCMA 5I7XA 4HBWA 4Z1SA 5ENHA 5CQ6A 4O70A 4E96A 5LJ0A 4Z6HA 3QZSA 2RNYA 2D82A 5L8TA 4BW1A 4N4HA 3O33A 3LXJA 4UIXA 3LQIA 4QEWA 4UYDA 5H1VA 4XY9A 5D3TA 5L97A 4UIZA 5A85A 4TYLA 4QUUA 5K29A 5A83A 5A5RA 3JVMA 5F2PA 4CUSA 4CUUA 5C89A 4GPJA 4F3IA 4LZRA 3IU6A 4HXOA 4PCIA 2YYNA 3MB3A 4YK0A 5F62A 5A5NA 5LUUA 5EK9A 4QY4A 3LJWA 4QSTA 4QEVA 5L99A 4NQMA 5F60A 4QSWA 2N9GA 5EPRA 4QSQA 5E3GA 4O74A 3ZYUA 5HENA 5ETDA 3MXFA 4IR4A 5FB1A 5F36A 2KTBB 4O7EA 4UYHA 5CU8A 4FLPA 5G4SA 4IR3A 4PCEA 4TZ2A 5HCLA 4NRAA 5CZGA 4N3WA 5D25A 5EWWA 5FE3A 5BT5A 5CS8A 4WIVA 2RO1A 4J0RA 5A5SA 5EWVA 5HRVA 4QEUA 5CUEA 5HRWA 4NQNA 5E0RA 5FG6A 5F3AA 5E9YA 4QSVA 4TT4A 3O37A 5ETBA 5FB0A 3O36A 4O7AA 3DWYA 5D24A 3JVJA 5DKDA 2RS9B 5DLXA 4OUFA 4Z6IA 5IBNA 4NUDA 3SVFA 1JM4B 5FE1A 4Y03A 4YYJA 5AD3A 5DBMA 4WHUA 4CL9A 5EWHA 4UIUA 5KTWA 4XY8A 5ENJA 5F61A 4HXKA 4TU6A 4CURA 5DX4A 3DAIA 4NR4A 3U5NA 4N4GA 2DKWA 5F25A 3GG3A 4C66A 3UV4A 2MJVB 4A9LA 1X0JA 5E73A 5FFVA 3UV2A 5CUDA 4C67A 2YELA 4MR3A 5E9LA 4TZ8A 4YYDA 4CLBA 4TT2A 4QYDA 5LJ2A 4NR6A 1WUMA 3UVYA 2DVSA 4HBXA 4QSSA 4NR8A 4CFLA 2F6JA 3U5PA 5CQTA 5F63A 5DKHA 4MEQA 5C87A 4PS5A 5CUCA 3S91A 5II2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGN A;  2OO1 A;  5FE9 A;  5CQ5 A;  5H1U A;  4PTB A;  5ENI A;  4BW2 A;  4PKL A;  4NYV A;  4PY6 A;  5C85 A;  4NUC A;  5CUA A;  5KHM A;  2DVQ A;  5I1Q A;  4LZ2 A;  2YEK A;  5FG4 A;  5A82 A;  5FDZ A;  4YC9 A;  2YDW A;  2D9E A;  4LYI A;  5TB6 A;  5C4Q A;  5DKC A;  5ENB A;  4Q0O A;  3UVX A;  5AD2 A;  2DWW A;  4A9K A;  3UVW A;  5J0D A;  4UIV A;  5F5Z A;  4A9N A;  5BT4 A;  3IU5 A;  5L8U A;  4OGI A;  3U5J A;  4ALH A;  4BJX A;  4UYG A;  4QSP A;  5DYX A;  3MUL A;  4XUA A;  4YH4 A;  4YYI A;  5CQ3 A;  5LKX A;  2OUO A;  2L84 A;  5LJ1 A;  2R0Y A;  3MB4 A;  2E7N A;  4N4F A;  5HQ7 A;  5IGL A;  2FSA A;  5A7C A;  3RCW A;  5ACY A;  5FE6 A;  5EU1 A;  2OSS A;  2RNX A;  3JVL A;  1E6I A;  4YH3 A;  4LDF A;  5FE7 A;  5EWC A;  3HME A;  4IOO A;  3O34 A;  3K2J A;  2G4A A;  5D3N A;  5ENG A;  4QZS A;  2L5E A;  5CPE A;  5FFY A;  5I7Y A;  5HEL A;  4UIY A;  2R0S A;  3UW9 A;  4IR5 A;  4IR6 A;  5D3R A;  5CFW A;  2DVV A;  5EI4 A;  3U5M A;  5IGK A;  4BHW A;  5E3D A;  4HXM A;  5ENC A;  4QR3 A;  4XUB A;  4LZS A;  4MEP A;  4LYW A;  4QNS A;  5DW2 A;  5FE8 A;  5CQ7 A;  4CUT A;  5LKZ A;  4O76 A;  5C7N A;  5DYU A;  5F1L A;  4QSR A;  5KU3 A;  5EVA A;  4OGJ A;  5EWD A;  3I3J A;  4NR9 A;  4YBM A;  4QSX A;  4NRB A;  5FE5 A;  4IOQ A;  5I86 A;  3SVH A;  4QUT A;  5A5Q A;  2NXB A;  4QB3 A;  5E9I A;  2WP1 A;  4YAB A;  4O7F A;  5IGM A;  4XYA A;  4KV1 A;  4LRG A;  3NXB A;  5D0C A;  5HM0 A;  5CTL A;  4UYF B;  5HEM A;  5LKT A;  4A9H A;  5I89 A;  4BW3 A;  4YAT A;  5FH8 A;  4Z1Q A;  4NUE A;  4QC3 A;  4YYH A;  4DON A;  5L98 A;  5CQ8 A;  5EIC A;  3HMH A;  3TLP A;  5HRX A;  4QC1 A;  5BT3 A;  5E74 A;  3MQM A;  4O75 A;  2I8N A;  4UYE A;  5I40 A;  5KTX A;  5HFR A;  5A5O A;  5I88 A;  4Q0N A;  5DYC A;  4X2I A;  3JVK A;  4O7B A;  4RVR A;  5CRZ A;  3S92 A;  5I29 A;  3AAD A;  5D3L A;  5F1H A;  5HLS A;  4A9I A;  4ALG A;  5D7X A;  4NXJ A;  4QR5 A;  2F6N A;  4ZQL A;  4TU4 A;  5EV9 A;  4LC2 A;  2RI7 A;  2WP2 A;  4HXP A;  5DY7 A;  5FG5 A;  4TT6 A;  4KCX A;  3P1D A;  4YYN A;  4O7C A;  2E3K A;  4YAD A;  3O35 A;  3SVG A;  5I80 A;  5E7D A;  3P1E A;  5ENF A;  4A9F A;  5EQ1 A;  2RFJ A;  3HMF A;  3U5K A;  4HXS A;  4NS5 A;  5HJC A;  4J1P A;  4Z93 A;  4QYL A;  1N72 A;  5FE0 A;  5ENE A;  4AKN A;  4HBV A;  5JI8 A;  5KTU A;  5FE2 A;  5D26 A;  1ZS5 A;  5D3H A;  4NYX A;  4MEO A;  2GRC A;  5D3P A;  2E7O A;  2I7K A;  5CRM A;  5LVQ A;  1JSP B;  3P5O A;  4N4I A;  4A9J A;  5E9M A;  5KO4 A;  4A9E A;  5CGP A;  4YAX A;  2DVR A;  3P1C A;  4QSU A;  4WHW A;  2RNW A;  5A5P A;  2LSP B;  2R0V A;  5EPS A;  2R10 A;  5EP7 A;  2YW5 A;  5DYA A;  3D7C A;  5FE4 A;  5EIS A;  4IOR A;  2L85 A;  5JWM A;  4O72 A;  5DFD A;  5FH6 A;  5E9K A;  4TTE A;  4CFK A;  4UIT A;  4YYG A;  4HXR A;  5IID A;  5LVR A;  4A9M A;  2H60 A;  5FFW A;  5EGU A;  4YYK A;  5DW1 A;  5CUG A;  3ONI A;  5DFB A;  4ZW1 A;  5HQ6 A;  5D3J A;  5EPB A;  5H85 A;  5G4R A;  5FH7 A;  4MR5 A;  3UV5 A;  5CQ4 A;  5AME A;  3QZV A;  5CY9 A;  3LQH A;  4YBS A;  4O78 A;  5IG6 A;  5A81 A;  3AQA A;  4O71 A;  4LYS A;  5D3S A;  4UYF A;  4TQN A;  2DAT A;  5CUB A;  5HFQ A;  4QR4 A;  3MUK A;  4YY6 A;  5I83 A;  2YEM A;  4J3I A;  4HXL A;  4NR7 A;  4HBY A;  5AMF A;  1EQF A;  5COI A;  1WUG A;  3P1F A;  4UIW A;  4YY4 A;  5L96 A;  4YBT A;  3QZT A;  4QBM A;  3G0J A;  5DFC A;  5CP5 A;  4MR4 A;  5FBX A;  3Q2E A;  4TS8 A;  3G0L A;  3LQJ A;  5HQ5 A;  4LR6 A;  5CQA A;  1F68 A;  5DLZ A;  2YQD A;  3U5L A;  3FKM X;  4J0S A;  4HXN A;  4O77 A;  4NRC A;  3Q2F A;  5EM3 A;  5E9V A;  5LKU A;  4NR5 A;  4NYW A;  4MR6 A;  3UVD A;  4BW4 A;  5EA1 A;  4CUQ A;  4KV4 A;  4YYM A;  5H1T A;  4MEN A;  4A9O A;  5II1 A;  4ZC9 A;  3U5O A;  4CUP A;  5C8G A;  5TCM A;  5I7X A;  4HBW A;  4Z1S A;  5ENH A;  5CQ6 A;  4O70 A;  4E96 A;  5LJ0 A;  4Z6H A;  3QZS A;  2RNY A;  2D82 A;  5L8T A;  4BW1 A;  4N4H A;  3O33 A;  3LXJ A;  4UIX A;  3LQI A;  4QEW A;  4UYD A;  5H1V A;  4XY9 A;  5D3T A;  5L97 A;  4UIZ A;  5A85 A;  4TYL A;  4QUU A;  5K29 A;  5A83 A;  5A5R A;  3JVM A;  5F2P A;  4CUS A;  4CUU A;  5C89 A;  4GPJ A;  4F3I A;  4LZR A;  3IU6 A;  4HXO A;  4PCI A;  2YYN A;  3MB3 A;  4YK0 A;  5F62 A;  5A5N A;  5LUU A;  5EK9 A;  4QY4 A;  3LJW A;  4QST A;  4QEV A;  5L99 A;  4NQM A;  5F60 A;  4QSW A;  2N9G A;  5EPR A;  4QSQ A;  5E3G A;  4O74 A;  3ZYU A;  5HEN A;  5ETD A;  3MXF A;  4IR4 A;  5FB1 A;  5F36 A;  2KTB B;  4O7E A;  4UYH A;  5CU8 A;  4FLP A;  5G4S A;  4IR3 A;  4PCE A;  4TZ2 A;  5HCL A;  4NRA A;  5CZG A;  4N3W A;  5D25 A;  5EWW A;  5FE3 A;  5BT5 A;  5CS8 A;  4WIV A;  2RO1 A;  4J0R A;  5A5S A;  5EWV A;  5HRV A;  4QEU A;  5CUE A;  5HRW A;  4NQN A;  5E0R A;  5FG6 A;  5F3A A;  5E9Y A;  4QSV A;  4TT4 A;  3O37 A;  5ETB A;  5FB0 A;  3O36 A;  4O7A A;  3DWY A;  5D24 A;  3JVJ A;  5DKD A;  2RS9 B;  5DLX A;  4OUF A;  4Z6I A;  5IBN A;  4NUD A;  3SVF A;  1JM4 B;  5FE1 A;  4Y03 A;  4YYJ A;  5AD3 A;  5DBM A;  4WHU A;  4CL9 A;  5EWH A;  4UIU A;  5KTW A;  4XY8 A;  5ENJ A;  5F61 A;  4HXK A;  4TU6 A;  4CUR A;  5DX4 A;  3DAI A;  4NR4 A;  3U5N A;  4N4G A;  2DKW A;  5F25 A;  3GG3 A;  4C66 A;  3UV4 A;  2MJV B;  4A9L A;  1X0J A;  5E73 A;  5FFV A;  3UV2 A;  5CUD A;  4C67 A;  2YEL A;  4MR3 A;  5E9L A;  4TZ8 A;  4YYD A;  4CLB A;  4TT2 A;  4QYD A;  5LJ2 A;  4NR6 A;  1WUM A;  3UVY A;  2DVS A;  4HBX A;  4QSS A;  4NR8 A;  4CFL A;  2F6J A;  3U5P A;  5CQT A;  5F63 A;  5DKH A;  4MEQ A;  5C87 A;  4PS5 A;  5CUC A;  3S91 A;  5II2 A; 
#chains in the Genus database with same CATH topology
 5IGN A;  2OO1 A;  5FE9 A;  5CQ5 A;  5H1U A;  4PTB A;  5ENI A;  4BW2 A;  4PKL A;  4NYV A;  4PY6 A;  5C85 A;  4NUC A;  5CUA A;  5KHM A;  2DVQ A;  5I1Q A;  4LZ2 A;  2YEK A;  5FG4 A;  5A82 A;  5FDZ A;  4YC9 A;  2YDW A;  2D9E A;  4LYI A;  5TB6 A;  5C4Q A;  5DKC A;  5ENB A;  4Q0O A;  3UVX A;  5AD2 A;  2DWW A;  4A9K A;  3UVW A;  5J0D A;  4UIV A;  5F5Z A;  4A9N A;  5BT4 A;  3IU5 A;  5L8U A;  4OGI A;  3U5J A;  4ALH A;  4BJX A;  4UYG A;  4QSP A;  5DYX A;  3MUL A;  4XUA A;  4YH4 A;  4YYI A;  5CQ3 A;  5LKX A;  2OUO A;  2L84 A;  5LJ1 A;  2R0Y A;  3MB4 A;  2E7N A;  4N4F A;  5HQ7 A;  5IGL A;  2FSA A;  5A7C A;  3RCW A;  5ACY A;  5FE6 A;  5EU1 A;  2OSS A;  2RNX A;  3JVL A;  1E6I A;  4YH3 A;  4LDF A;  5FE7 A;  5EWC A;  3HME A;  4IOO A;  3O34 A;  3K2J A;  2G4A A;  5D3N A;  5ENG A;  4QZS A;  2L5E A;  5CPE A;  5FFY A;  5I7Y A;  5HEL A;  4UIY A;  2R0S A;  3UW9 A;  4IR5 A;  5D3R A;  4IR6 A;  5CFW A;  2DVV A;  5EI4 A;  3U5M A;  5IGK A;  4BHW A;  5E3D A;  4HXM A;  5ENC A;  4QR3 A;  4XUB A;  4LZS A;  4MEP A;  4LYW A;  4QNS A;  5DW2 A;  5FE8 A;  5CQ7 A;  4CUT A;  5LKZ A;  4O76 A;  5C7N A;  5DYU A;  5F1L A;  4QSR A;  5KU3 A;  5EVA A;  4OGJ A;  5EWD A;  3I3J A;  4NR9 A;  4YBM A;  4QSX A;  4NRB A;  5FE5 A;  4IOQ A;  5I86 A;  3SVH A;  4QUT A;  5A5Q A;  2NXB A;  4QB3 A;  5E9I A;  2WP1 A;  4YAB A;  4O7F A;  5IGM A;  4XYA A;  4KV1 A;  4LRG A;  3NXB A;  5D0C A;  5HM0 A;  5CTL A;  4UYF B;  5HEM A;  5LKT A;  4A9H A;  5I89 A;  4BW3 A;  4YAT A;  5FH8 A;  4Z1Q A;  4NUE A;  4QC3 A;  4YYH A;  4DON A;  5L98 A;  5CQ8 A;  5EIC A;  3HMH A;  3TLP A;  5HRX A;  4QC1 A;  5BT3 A;  5E74 A;  3MQM A;  4O75 A;  2I8N A;  4UYE A;  5I40 A;  5KTX A;  5HFR A;  5A5O A;  5I88 A;  4Q0N A;  5DYC A;  4AKI A;  4X2I A;  3JVK A;  4O7B A;  4RVR A;  5CRZ A;  3VKG A;  3S92 A;  5I29 A;  3AAD A;  5D3L A;  5F1H A;  5HLS A;  4A9I A;  4ALG A;  5D7X A;  4NXJ A;  4QR5 A;  2F6N A;  4ZQL A;  4TU4 A;  5EV9 A;  4LC2 A;  2RI7 A;  2WP2 A;  4HXP A;  5DY7 A;  5FG5 A;  4TT6 A;  4KCX A;  3P1D A;  4YYN A;  4O7C A;  2E3K A;  4YAD A;  3O35 A;  3SVG A;  5I80 A;  5E7D A;  3P1E A;  5ENF A;  4A9F A;  5EQ1 A;  2RFJ A;  3HMF A;  3U5K A;  4HXS A;  4NS5 A;  5HJC A;  4J1P A;  4Z93 A;  4QYL A;  1N72 A;  5FE0 A;  5ENE A;  4AKN A;  4HBV A;  5JI8 A;  5KTU A;  5FE2 A;  5D26 A;  1ZS5 A;  5D3H A;  4NYX A;  4MEO A;  2GRC A;  5D3P A;  4AKG A;  2E7O A;  2I7K A;  5CRM A;  5LVQ A;  1JSP B;  3P5O A;  4N4I A;  4A9J A;  5E9M A;  5KO4 A;  4A9E A;  5CGP A;  4YAX A;  2DVR A;  3P1C A;  4QSU A;  4WHW A;  2RNW A;  5A5P A;  2LSP B;  2R0V A;  5EPS A;  2R10 A;  5EP7 A;  2YW5 A;  5DYA A;  3D7C A;  5FE4 A;  5EIS A;  4IOR A;  2L85 A;  5JWM A;  4O72 A;  5DFD A;  5FH6 A;  5E9K A;  4TTE A;  4CFK A;  4UIT A;  4YYG A;  4HXR A;  5IID A;  5LVR A;  4A9M A;  2H60 A;  5FFW A;  5EGU A;  4YYK A;  5DW1 A;  3D1D A;  5CUG A;  3ONI A;  5DFB A;  4ZW1 A;  5HQ6 A;  5D3J A;  5EPB A;  5H85 A;  5G4R A;  5FH7 A;  4MR5 A;  3UV5 A;  5CQ4 A;  5AME A;  3QZV A;  5CY9 A;  3LQH A;  4YBS A;  4O78 A;  5IG6 A;  5A81 A;  3AQA A;  4O71 A;  4LYS A;  5D3S A;  4UYF A;  4TQN A;  2DAT A;  5CUB A;  5HFQ A;  4QR4 A;  3MUK A;  4YY6 A;  5I83 A;  2YEM A;  4J3I A;  4HXL A;  4NR7 A;  4HBY A;  5AMF A;  1EQF A;  5COI A;  1WUG A;  1ZKR A;  3P1F A;  4UIW A;  4YY4 A;  5L96 A;  4YBT A;  3QZT A;  4QBM A;  3G0J A;  5CP5 A;  5DFC A;  4MR4 A;  5FBX A;  3Q2E A;  4TS8 A;  3G0L A;  3LQJ A;  5HQ5 A;  4LR6 A;  5CQA A;  1F68 A;  5DLZ A;  2YQD A;  3U5L A;  3FKM X;  4J0S A;  4HXN A;  4O77 A;  4NRC A;  1PUO A;  3Q2F A;  5EM3 A;  5E9V A;  5LKU A;  4NR5 A;  4NYW A;  4MR6 A;  3UVD A;  4BW4 A;  5EA1 A;  4CUQ A;  4KV4 A;  4YYM A;  5H1T A;  4MEN A;  4A9O A;  5II1 A;  4ZC9 A;  3U5O A;  4CUP A;  5C8G A;  5TCM A;  5I7X A;  4HBW A;  4Z1S A;  5ENH A;  5CQ6 A;  4O70 A;  4E96 A;  4AKH A;  5LJ0 A;  4Z6H A;  3QZS A;  2RNY A;  2D82 A;  5L8T A;  4BW1 A;  2EJN A;  4N4H A;  3O33 A;  3LXJ A;  4UIX A;  3LQI A;  4QEW A;  4UYD A;  5H1V A;  4XY9 A;  5D3T A;  5L97 A;  4UIZ A;  5A85 A;  4TYL A;  4QUU A;  5K29 A;  5A83 A;  5A5R A;  3JVM A;  5F2P A;  4CUS A;  4CUU A;  5C89 A;  4GPJ A;  4F3I A;  4LZR A;  3IU6 A;  4HXO A;  4PCI A;  2YYN A;  3MB3 A;  4YK0 A;  5F62 A;  5A5N A;  5LUU A;  5EK9 A;  4QY4 A;  3LJW A;  4QST A;  4QEV A;  5L99 A;  4NQM A;  5F60 A;  4QSW A;  2N9G A;  5EPR A;  4QSQ A;  5E3G A;  4O74 A;  3ZYU A;  5HEN A;  5ETD A;  3MXF A;  4IR4 A;  5FB1 A;  5F36 A;  2KTB B;  4O7E A;  4UYH A;  5CU8 A;  4FLP A;  5G4S A;  4IR3 A;  4PCE A;  4TZ2 A;  5HCL A;  4NRA A;  5CZG A;  4N3W A;  5D25 A;  5EWW A;  5FE3 A;  5BT5 A;  5CS8 A;  4WIV A;  2RO1 A;  4J0R A;  5A5S A;  5EWV A;  5HRV A;  4QEU A;  5CUE A;  5HRW A;  4NQN A;  5E0R A;  5FG6 A;  5F3A A;  5E9Y A;  4QSV A;  4TT4 A;  3O37 A;  5ETB A;  5FB0 A;  3O36 A;  4O7A A;  3DWY A;  5D24 A;  3JVJ A;  5DKD A;  2RS9 B;  5DLX A;  4OUF A;  4Z6I A;  5IBN A;  4NUD A;  3SVF A;  1JM4 B;  5FE1 A;  3ERR A;  4Y03 A;  4YYJ A;  5AD3 A;  5DBM A;  4WHU A;  4CL9 A;  5EWH A;  4UIU A;  5KTW A;  4XY8 A;  5ENJ A;  5F61 A;  4HXK A;  4TU6 A;  4CUR A;  5DX4 A;  3DAI A;  4NR4 A;  3U5N A;  4N4G A;  2DKW A;  5F25 A;  3D1B A;  4AI6 A;  3GG3 A;  4C66 A;  3UV4 A;  2MJV B;  4A9L A;  1X0J A;  5E73 A;  5FFV A;  3UV2 A;  5CUD A;  4C67 A;  2YEL A;  4MR3 A;  5E9L A;  4TZ8 A;  4YYD A;  4CLB A;  4TT2 A;  4QYD A;  5LJ2 A;  4NR6 A;  1WUM A;  3UVY A;  2DVS A;  4HBX A;  4QSS A;  4NR8 A;  4CFL A;  2F6J A;  3U5P A;  3VKH A;  5CQT A;  5F63 A;  5DKH A;  4MEQ A;  5C87 A;  4PS5 A;  5CUC A;  3S91 A;  5II2 A; 
#chains in the Genus database with same CATH homology
 5IGN A;  2OO1 A;  5FE9 A;  5CQ5 A;  5H1U A;  4PTB A;  5ENI A;  4BW2 A;  4PKL A;  4NYV A;  4PY6 A;  5C85 A;  4NUC A;  5CUA A;  5KHM A;  2DVQ A;  5I1Q A;  4LZ2 A;  2YEK A;  5FG4 A;  5A82 A;  5FDZ A;  4YC9 A;  2YDW A;  2D9E A;  4LYI A;  5TB6 A;  5C4Q A;  5DKC A;  5ENB A;  4Q0O A;  3UVX A;  5AD2 A;  2DWW A;  4A9K A;  3UVW A;  5J0D A;  4UIV A;  5F5Z A;  4A9N A;  5BT4 A;  3IU5 A;  5L8U A;  4OGI A;  3U5J A;  4ALH A;  4BJX A;  4UYG A;  4QSP A;  5DYX A;  3MUL A;  4XUA A;  4YH4 A;  4YYI A;  5CQ3 A;  5LKX A;  2OUO A;  2L84 A;  5LJ1 A;  2R0Y A;  3MB4 A;  2E7N A;  4N4F A;  5HQ7 A;  5IGL A;  2FSA A;  5A7C A;  3RCW A;  5ACY A;  5FE6 A;  5EU1 A;  2OSS A;  2RNX A;  3JVL A;  1E6I A;  4YH3 A;  4LDF A;  5FE7 A;  5EWC A;  3HME A;  4IOO A;  3O34 A;  3K2J A;  2G4A A;  5D3N A;  5ENG A;  4QZS A;  2L5E A;  5CPE A;  5FFY A;  5I7Y A;  5HEL A;  4UIY A;  2R0S A;  3UW9 A;  4IR5 A;  4IR6 A;  5D3R A;  5CFW A;  2DVV A;  5EI4 A;  3U5M A;  5IGK A;  4BHW A;  5E3D A;  4HXM A;  5ENC A;  4QR3 A;  4XUB A;  4LZS A;  4MEP A;  4LYW A;  4QNS A;  5DW2 A;  5FE8 A;  5CQ7 A;  4CUT A;  5LKZ A;  4O76 A;  5C7N A;  5DYU A;  5F1L A;  4QSR A;  5KU3 A;  5EVA A;  4OGJ A;  5EWD A;  3I3J A;  4NR9 A;  4YBM A;  4QSX A;  4NRB A;  5FE5 A;  4IOQ A;  5I86 A;  3SVH A;  4QUT A;  5A5Q A;  2NXB A;  4QB3 A;  5E9I A;  2WP1 A;  4YAB A;  4O7F A;  5IGM A;  4XYA A;  4KV1 A;  4LRG A;  3NXB A;  5D0C A;  5HM0 A;  5CTL A;  4UYF B;  5HEM A;  5LKT A;  4A9H A;  5I89 A;  4BW3 A;  4YAT A;  5FH8 A;  4Z1Q A;  4NUE A;  4QC3 A;  4YYH A;  4DON A;  5L98 A;  5CQ8 A;  5EIC A;  3HMH A;  3TLP A;  5HRX A;  4QC1 A;  5BT3 A;  5E74 A;  3MQM A;  4O75 A;  2I8N A;  4UYE A;  5I40 A;  5KTX A;  5HFR A;  5A5O A;  5I88 A;  4Q0N A;  5DYC A;  4X2I A;  3JVK A;  4O7B A;  4RVR A;  5CRZ A;  3S92 A;  5I29 A;  3AAD A;  5D3L A;  5F1H A;  5HLS A;  4A9I A;  4ALG A;  5D7X A;  4NXJ A;  4QR5 A;  2F6N A;  4ZQL A;  4TU4 A;  5EV9 A;  4LC2 A;  2RI7 A;  2WP2 A;  4HXP A;  5DY7 A;  5FG5 A;  4TT6 A;  4KCX A;  3P1D A;  4YYN A;  4O7C A;  2E3K A;  4YAD A;  3O35 A;  3SVG A;  5I80 A;  5E7D A;  3P1E A;  5ENF A;  4A9F A;  5EQ1 A;  2RFJ A;  3HMF A;  3U5K A;  4HXS A;  4NS5 A;  5HJC A;  4J1P A;  4Z93 A;  4QYL A;  1N72 A;  5FE0 A;  5ENE A;  4AKN A;  4HBV A;  5JI8 A;  5KTU A;  5FE2 A;  5D26 A;  1ZS5 A;  5D3H A;  4NYX A;  4MEO A;  2GRC A;  5D3P A;  2E7O A;  2I7K A;  5CRM A;  5LVQ A;  1JSP B;  3P5O A;  4N4I A;  4A9J A;  5E9M A;  5KO4 A;  4A9E A;  5CGP A;  4YAX A;  2DVR A;  3P1C A;  4QSU A;  4WHW A;  2RNW A;  5A5P A;  2LSP B;  2R0V A;  5EPS A;  2R10 A;  5EP7 A;  2YW5 A;  5DYA A;  3D7C A;  5FE4 A;  5EIS A;  4IOR A;  2L85 A;  5JWM A;  4O72 A;  5DFD A;  5FH6 A;  5E9K A;  4TTE A;  4CFK A;  4UIT A;  4YYG A;  4HXR A;  5IID A;  5LVR A;  4A9M A;  2H60 A;  5FFW A;  5EGU A;  4YYK A;  5DW1 A;  5CUG A;  3ONI A;  5DFB A;  4ZW1 A;  5HQ6 A;  5D3J A;  5EPB A;  5H85 A;  5G4R A;  5FH7 A;  4MR5 A;  3UV5 A;  5CQ4 A;  5AME A;  3QZV A;  5CY9 A;  3LQH A;  4YBS A;  4O78 A;  5IG6 A;  5A81 A;  3AQA A;  4O71 A;  4LYS A;  5D3S A;  4UYF A;  4TQN A;  2DAT A;  5CUB A;  5HFQ A;  4QR4 A;  3MUK A;  4YY6 A;  5I83 A;  2YEM A;  4J3I A;  4HXL A;  4NR7 A;  4HBY A;  5AMF A;  1EQF A;  5COI A;  1WUG A;  3P1F A;  4UIW A;  4YY4 A;  5L96 A;  4YBT A;  3QZT A;  4QBM A;  3G0J A;  5DFC A;  5CP5 A;  4MR4 A;  5FBX A;  3Q2E A;  4TS8 A;  3G0L A;  3LQJ A;  5HQ5 A;  4LR6 A;  5CQA A;  1F68 A;  5DLZ A;  2YQD A;  3U5L A;  3FKM X;  4J0S A;  4HXN A;  4O77 A;  4NRC A;  3Q2F A;  5EM3 A;  5E9V A;  5LKU A;  4NR5 A;  4NYW A;  4MR6 A;  3UVD A;  4BW4 A;  5EA1 A;  4CUQ A;  4KV4 A;  4YYM A;  5H1T A;  4MEN A;  4A9O A;  5II1 A;  4ZC9 A;  3U5O A;  4CUP A;  5C8G A;  5TCM A;  5I7X A;  4HBW A;  4Z1S A;  5ENH A;  5CQ6 A;  4O70 A;  4E96 A;  5LJ0 A;  4Z6H A;  3QZS A;  2RNY A;  2D82 A;  5L8T A;  4BW1 A;  4N4H A;  3O33 A;  3LXJ A;  4UIX A;  3LQI A;  4QEW A;  4UYD A;  5H1V A;  4XY9 A;  5D3T A;  5L97 A;  4UIZ A;  5A85 A;  4TYL A;  4QUU A;  5K29 A;  5A83 A;  5A5R A;  3JVM A;  5F2P A;  4CUS A;  4CUU A;  5C89 A;  4GPJ A;  4F3I A;  4LZR A;  3IU6 A;  4HXO A;  4PCI A;  2YYN A;  3MB3 A;  4YK0 A;  5F62 A;  5A5N A;  5LUU A;  5EK9 A;  4QY4 A;  3LJW A;  4QST A;  4QEV A;  5L99 A;  4NQM A;  5F60 A;  4QSW A;  2N9G A;  5EPR A;  4QSQ A;  5E3G A;  4O74 A;  3ZYU A;  5HEN A;  5ETD A;  3MXF A;  4IR4 A;  5FB1 A;  5F36 A;  2KTB B;  4O7E A;  4UYH A;  5CU8 A;  4FLP A;  5G4S A;  4IR3 A;  4PCE A;  4TZ2 A;  5HCL A;  4NRA A;  5CZG A;  4N3W A;  5D25 A;  5EWW A;  5FE3 A;  5BT5 A;  5CS8 A;  4WIV A;  2RO1 A;  4J0R A;  5A5S A;  5EWV A;  5HRV A;  4QEU A;  5CUE A;  5HRW A;  4NQN A;  5E0R A;  5FG6 A;  5F3A A;  5E9Y A;  4QSV A;  4TT4 A;  3O37 A;  5ETB A;  5FB0 A;  3O36 A;  4O7A A;  3DWY A;  5D24 A;  3JVJ A;  5DKD A;  2RS9 B;  5DLX A;  4OUF A;  4Z6I A;  5IBN A;  4NUD A;  3SVF A;  1JM4 B;  5FE1 A;  4Y03 A;  4YYJ A;  5AD3 A;  5DBM A;  4WHU A;  4CL9 A;  5EWH A;  4UIU A;  5KTW A;  4XY8 A;  5ENJ A;  5F61 A;  4HXK A;  4TU6 A;  4CUR A;  5DX4 A;  3DAI A;  4NR4 A;  3U5N A;  4N4G A;  2DKW A;  5F25 A;  3GG3 A;  4C66 A;  3UV4 A;  2MJV B;  4A9L A;  1X0J A;  5E73 A;  5FFV A;  3UV2 A;  5CUD A;  4C67 A;  2YEL A;  4MR3 A;  5E9L A;  4TZ8 A;  4YYD A;  4CLB A;  4TT2 A;  4QYD A;  5LJ2 A;  4NR6 A;  1WUM A;  3UVY A;  2DVS A;  4HBX A;  4QSS A;  4NR8 A;  4CFL A;  2F6J A;  3U5P A;  5CQT A;  5F63 A;  5DKH A;  4MEQ A;  5C87 A;  4PS5 A;  5CUC A;  3S91 A;  5II2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...