3S92A

Crystal structure of the second bromodomain of human brd3 in complex with the inhibitor jq1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 3
publication title Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3s92A00
4A9JA 4A9IA 4CUTA 2I8NA 1WUMA 4UYEA 4HXNA 4C66A 3MQMA 4O78A 5DYCA 4QSXA 5E3GA 4QYLA 4BW1A 5IIDA 5LKTA 2RNWA 2D9EA 4UIWA 5DFDA 3U5NA 5FDZA 5FFYA 4LC2A 4LZSA 2RNXA 4HXMA 4TT2A 3FKMX 4N4HA 5CGPA 5AMFA 5DYAA 5IGNA 5HQ6A 5FB0A 4HXOA 5D3PA 4TYLA 4A9OA 4Q0OA 5I80A 4GPJA 3P1FA 5CY9A 5CQ8A 5CFWA 5IGMA 5D3JA 4O76A 5F3AA 5CUBA 4Z1SA 4YBMA 4NYXA 5CRMA 4IR4A 3U5LA 4NYVA 4AKNA 4MR5A 3AADA 5ENGA 4Q0NA 5F1HA 5FE9A 2L5EA 4OGJA 3D7CA 5H1VA 5EK9A 5F61A 3LQHA 4KV1A 5CQ7A 5I7YA 4BHWA 4Z6HA 2DVQA 3SVGA 2LSPB 4QEVA 5AD3A 5BT4A 5HM0A 4YC9A 5F36A 5EU1A 4QEUA 4XUBA 3JVKA 3QZVA 5EVAA 5I29A 2F6NA 5HQ5A 5CUGA 5A7CA 3UVXA 5CUEA 4A9KA 2YELA 2YYNA 5E9MA 4YYDA 5CP5A 5DX4A 5II2A 4ZC9A 3S92A 4YYIA 5HRXA 5H1UA 4QSPA 5D3SA 4ZQLA 5LKUA 5FG5A 4A9FA 1F68A 3UVDA 4PCIA 4NYWA 4CLBA 2DATA 4NRCA 3SVFA 4QR5A 4UITA 5LJ1A 5C8GA 4J1PA 2YDWA 5A82A 4YYGA 5HRVA 5FE4A 2DKWA 4UYHA 5IGLA 1N72A 4BW3A 5FE0A 4J0RA 3Q2EA 2OO1A 3JVLA 5G4SA 3UVYA 3DAIA 4Z6IA 2R0YA 5I86A 5DW1A 4QSVA 4LR6A 3UW9A 2RNYA 4CUQA 5D24A 4HBWA 5HLSA 2R10A 1X0JA 4IR6A 4CUSA 5AD2A 5A5NA 4TZ8A 4QSUA 5DKDA 3UVWA 4Z1QA 1ZS5A 5E9YA 4O72A 4YABA 5A5OA 3TLPA 4LYIA 2DVRA 5HFQA 3G0LA 5EM3A 3SVHA 5L97A 4QNSA 5A5PA 4N3WA 5E7DA 1JSPB 5L99A 5EP7A 4QR4A 4LYWA 4YH3A 4HXSA 2OSSA 5FB1A 4YBSA 4UIXA 5TB6A 4YH4A 5CQ4A 5FG6A 5EPBA 2N9GA 3IU5A 4X2IA 4TZ2A 5HEMA 5HCLA 4UYGA 5E74A 1WUGA 4LZ2A 3MULA 4WHUA 5ETBA 4MR6A 3NXBA 4O77A 5ACYA 2DVSA 4N4GA 4QSTA 4BW2A 5F62A 5EWWA 5EGUA 4ALGA 4QEWA 4NQMA 4IOOA 4YYKA 5CS8A 5E3DA 4WIVA 4O70A 4J0SA 5HQ7A 5COIA 5J0DA 3P1CA 5CTLA 2L85A 3QZTA 4QYDA 4YYMA 5DFBA 5BT5A 2R0SA 3MXFA 4IR5A 5TCMA 4O7AA 5A83A 2DWWA 4QSWA 4CUPA 5CQAA 5D3HA 5F25A 5LJ2A 5II1A 5KTXA 4OUFA 5DKHA 4KCXA 4YADA 4HBXA 5DYUA 4ZW1A 5D3RA 3HMFA 4NR8A 4YATA 5CPEA 4LZRA 4DONA 3U5KA 2YEKA 2WP2A 4TTEA 5ENJA 5DW2A 5CRZA 5HJCA 5D3NA 4PCEA 4RVRA 4O7EA 5CQ5A 4YYJA 4HXKA 5C85A 5D0CA 2E7NA 4YY6A 5C89A 5CUCA 5F1LA 1JM4B 2RS9B 4TS8A 5H1TA 5ENEA 4HXRA 4PKLA 4LYSA 5EISA 4CFLA 4YY4A 5I83A 4UYFB 5DLZA 2E3KA 4MEQA 3AQAA 4UIUA 5EWDA 5DKCA 5FFVA 3UV2A 4QC1A 5HELA 4NUCA 4LRGA 4NR9A 5CU8A 5IBNA 4N4FA 4PY6A 5KHMA 2WP1A 4NRAA 5EA1A 5HRWA 3U5PA 4TU4A 3ONIA 4N4IA 5FBXA 4HXPA 4MENA 2OUOA 4O7CA 3O37A 5EICA 4UYFA 5E0RA 5F60A 4XY9A 5FH8A 5HENA 4PTBA 5FE1A 4QC3A 5G4RA 4QZSA 3MUKA 2R0VA 5D25A 3P5OA 5LJ0A 4YYNA 4IORA 5EWVA 4A9LA 3HMHA 4A9MA 4XYAA 3U5OA 5ETDA 3S91A 5EI4A 4NR6A 4TQNA 5CQTA 4NR5A 3ZYUA 4LDFA 5ENCA 5I40A 4TT6A 5BT3A 3Q2FA 3LXJA 5E9KA 5D3TA 4UIYA 3UV5A 5K29A 5ENIA 4FLPA 3QZSA 4CL9A 5ENBA 5FE3A 4Y03A 5KTWA 3DWYA 5I89A 5I7XA 4HXLA 5FE6A 4J3IA 5ENFA 3LQIA 4QSQA 3RCWA 2F6JA 4NQNA 4YAXA 5FE5A 5E9LA 4BW4A 2GRCA 5KO4A 5LVRA 5EWHA 5A5QA 4NUDA 4O75A 4MR3A 5CUDA 4UYDA 3I3JA 4CURA 5DFCA 5CQ3A 4A9HA 4IR3A 4O71A 5FE8A 2RFJA 5DY7A 3MB4A 4NUEA 5D26A 4QY4A 3IU6A 5JI8A 5CQ6A 4A9EA 5I88A 5D7XA 3O33A 4XUAA 3LJWA 4F3IA 5C87A 2E7OA 5EWCA 5F5ZA 5LUUA 3U5JA 4TT4A 4YYHA 5IGKA 4MEOA 3UV4A 4HBYA 4QBMA 2G4AA 5KU3A 4NXJA 4O7FA 5HFRA 5EPRA 4ALHA 5IG6A 5E9VA 2KTBB 4WHWA 5DBMA 2DVVA 2FSAA 4YK0A 3GG3A 5FE2A 5A81A 2RO1A 4NRBA 5F2PA 5C4QA 3LQJA 1EQFA 3O36A 5EPSA 4IOQA 4NS5A 2YW5A 4Z93A 4A9NA 1E6IA 3P1DA 2MJVB 3O34A 4NR7A 5FH6A 2RI7A 5FE7A 3K2JA 2YEMA 4QR3A 5LVQA 5ENHA 3P1EA 4CUUA 5FH7A 4UIVA 5L96A 5L98A 2NXBA 4OGIA 4HBVA 5L8UA 5E73A 5A5RA 4NR4A 4QSSA 3JVMA 4E96A 3G0JA 5EQ1A 5CZGA 5DLXA 5KTUA 4CFKA 5C7NA 5I1QA 5JWMA 4O7BA 4UIZA 5AMEA 4KV4A 3MB3A 5EV9A 5FG4A 5CUAA 4C67A 4QSRA 5A85A 2YQDA 5A5SA 4QB3A 5H85A 5FFWA 4PS5A 4QUUA 3U5MA 5D3LA 5L8TA 4O74A 4QUTA 3JVJA 4MR4A 5LKZA 2I7KA 2H60A 3O35A 3HMEA 2D82A 5DYXA 5F63A 2L84A 4BJXA 4XY8A 4MEPA 4YBTA 4TU6A 5E9IA 5LKXA
chains in the Genus database with same CATH superfamily
4A9JA 4A9IA 4CUTA 2I8NA 1WUMA 4UYEA 4HXNA 4C66A 3MQMA 4O78A 5DYCA 4QSXA 5E3GA 4QYLA 4BW1A 5IIDA 5LKTA 2RNWA 2D9EA 4UIWA 5DFDA 3U5NA 5FDZA 5FFYA 4LC2A 4LZSA 2RNXA 4HXMA 4TT2A 3FKMX 4N4HA 5CGPA 5AMFA 5DYAA 5IGNA 5HQ6A 5FB0A 4HXOA 5D3PA 4TYLA 4A9OA 4Q0OA 5I80A 4GPJA 3P1FA 5CY9A 5CQ8A 5CFWA 5IGMA 5D3JA 4O76A 5F3AA 5CUBA 4Z1SA 4YBMA 4NYXA 5CRMA 4IR4A 3U5LA 4NYVA 4AKNA 4MR5A 3AADA 5ENGA 4Q0NA 5F1HA 5FE9A 2L5EA 4OGJA 3D7CA 5H1VA 5EK9A 5F61A 3LQHA 4KV1A 5CQ7A 5I7YA 4BHWA 4Z6HA 2DVQA 3SVGA 2LSPB 4QEVA 5AD3A 5BT4A 5HM0A 4YC9A 5F36A 5EU1A 4QEUA 4XUBA 3JVKA 3QZVA 5EVAA 5I29A 2F6NA 5HQ5A 5CUGA 5A7CA 3UVXA 5CUEA 4A9KA 2YELA 2YYNA 5E9MA 4YYDA 5CP5A 5DX4A 5II2A 4ZC9A 3S92A 4YYIA 5HRXA 5H1UA 4AKHA 4QSPA 5D3SA 3VKHA 4ZQLA 5LKUA 5FG5A 4A9FA 1F68A 3UVDA 4PCIA 4NYWA 4CLBA 2DATA 4NRCA 3SVFA 4QR5A 4UITA 5LJ1A 5C8GA 4J1PA 2YDWA 5A82A 4YYGA 5HRVA 5FE4A 2DKWA 4UYHA 5IGLA 1N72A 4BW3A 5FE0A 4J0RA 3Q2EA 2OO1A 3JVLA 5G4SA 3UVYA 3DAIA 4Z6IA 2R0YA 5I86A 5DW1A 4QSVA 4LR6A 3UW9A 2RNYA 4CUQA 5D24A 4HBWA 5HLSA 2R10A 1X0JA 4IR6A 4CUSA 5AD2A 5A5NA 4TZ8A 4QSUA 5DKDA 3UVWA 4Z1QA 1ZS5A 5E9YA 4O72A 4YABA 5A5OA 3TLPA 4LYIA 2DVRA 5HFQA 3G0LA 5EM3A 3SVHA 5L97A 4QNSA 5A5PA 4N3WA 5E7DA 1JSPB 5L99A 5EP7A 4QR4A 4LYWA 4YH3A 4HXSA 2OSSA 5FB1A 4YBSA 4UIXA 5TB6A 4YH4A 5CQ4A 5FG6A 5EPBA 2N9GA 3IU5A 4X2IA 4TZ2A 5HEMA 5HCLA 4UYGA 5E74A 1WUGA 4LZ2A 3MULA 4WHUA 5ETBA 4MR6A 3NXBA 4O77A 5ACYA 2DVSA 4N4GA 4QSTA 4BW2A 5F62A 5EWWA 5EGUA 4ALGA 4QEWA 4NQMA 4IOOA 4YYKA 5CS8A 5E3DA 4WIVA 4O70A 4J0SA 5HQ7A 5COIA 5J0DA 3P1CA 5CTLA 2L85A 3QZTA 4QYDA 4YYMA 5DFBA 5BT5A 2R0SA 3MXFA 4IR5A 5TCMA 4O7AA 5A83A 2DWWA 4QSWA 4CUPA 3VKGA 5CQAA 5D3HA 5F25A 5LJ2A 5II1A 5KTXA 4OUFA 5DKHA 4KCXA 4YADA 4HBXA 5DYUA 4ZW1A 5D3RA 3HMFA 4NR8A 2EJNA 4YATA 5CPEA 4LZRA 4DONA 3U5KA 2YEKA 2WP2A 4TTEA 5ENJA 5DW2A 5CRZA 5HJCA 5D3NA 4PCEA 4RVRA 4O7EA 5CQ5A 4YYJA 4HXKA 5C85A 5D0CA 2E7NA 4YY6A 5C89A 5CUCA 5F1LA 1JM4B 2RS9B 4TS8A 5H1TA 5ENEA 4HXRA 4PKLA 4LYSA 5EISA 4CFLA 4YY4A 5I83A 4UYFB 5DLZA 4AI6A 2E3KA 4MEQA 3AQAA 4UIUA 5EWDA 5DKCA 5FFVA 3UV2A 4QC1A 5HELA 4NUCA 4LRGA 4NR9A 5CU8A 5IBNA 4N4FA 4PY6A 5KHMA 2WP1A 4NRAA 5EA1A 5HRWA 3U5PA 4TU4A 3ONIA 4N4IA 5FBXA 4HXPA 3D1DA 4MENA 2OUOA 4O7CA 3O37A 5EICA 4UYFA 5E0RA 5F60A 4XY9A 5FH8A 5HENA 4PTBA 5FE1A 4QC3A 1PUOA 5G4RA 4QZSA 3MUKA 2R0VA 5D25A 3P5OA 5LJ0A 4YYNA 4IORA 5EWVA 4A9LA 3HMHA 4A9MA 4XYAA 3U5OA 5ETDA 1ZKRA 4AKGA 3S91A 5EI4A 4NR6A 4TQNA 5CQTA 4NR5A 3ZYUA 4LDFA 5ENCA 5I40A 4TT6A 5BT3A 3Q2FA 3LXJA 5E9KA 5D3TA 4UIYA 3UV5A 5K29A 5ENIA 4FLPA 3QZSA 4CL9A 5ENBA 5FE3A 4Y03A 5KTWA 3DWYA 5I89A 5I7XA 4HXLA 5FE6A 4J3IA 5ENFA 3LQIA 4QSQA 3RCWA 2F6JA 4NQNA 4YAXA 5FE5A 5E9LA 4BW4A 2GRCA 5KO4A 5LVRA 5EWHA 5A5QA 4NUDA 4O75A 4MR3A 5CUDA 4UYDA 3I3JA 4CURA 5DFCA 5CQ3A 4A9HA 4IR3A 4O71A 5FE8A 2RFJA 5DY7A 3MB4A 4NUEA 5D26A 4QY4A 3IU6A 5JI8A 5CQ6A 4A9EA 5I88A 5D7XA 3O33A 4XUAA 3LJWA 4F3IA 5C87A 2E7OA 3D1BA 5EWCA 5F5ZA 5LUUA 3U5JA 4TT4A 4YYHA 5IGKA 4MEOA 3UV4A 4HBYA 4QBMA 2G4AA 5KU3A 4NXJA 4O7FA 5HFRA 4AKIA 5EPRA 4ALHA 5IG6A 5E9VA 2KTBB 4WHWA 2DVVA 2FSAA 5DBMA 4YK0A 3GG3A 5FE2A 5A81A 2RO1A 4NRBA 5F2PA 5C4QA 3LQJA 1EQFA 3O36A 5EPSA 4IOQA 4NS5A 2YW5A 4Z93A 4A9NA 1E6IA 3P1DA 2MJVB 3O34A 4NR7A 5FH6A 2RI7A 5FE7A 3K2JA 2YEMA 4QR3A 5LVQA 5ENHA 3P1EA 4CUUA 5FH7A 4UIVA 5L96A 5L98A 2NXBA 4OGIA 4HBVA 5L8UA 5E73A 5A5RA 4NR4A 4QSSA 3JVMA 4E96A 3G0JA 5EQ1A 5CZGA 5DLXA 5KTUA 4CFKA 5C7NA 5I1QA 5JWMA 4O7BA 4UIZA 5AMEA 4KV4A 3MB3A 5EV9A 5FG4A 5CUAA 4C67A 4QSRA 3ERRA 5A85A 2YQDA 5A5SA 4QB3A 5H85A 5FFWA 4PS5A 4QUUA 3U5MA 5D3LA 5L8TA 4O74A 4QUTA 3JVJA 4MR4A 5LKZA 2I7KA 2H60A 3O35A 3HMEA 2D82A 5DYXA 5F63A 2L84A 4BJXA 4XY8A 4MEPA 4YBTA 4TU6A 5E9IA 5LKXA
chains in the Genus database with same CATH topology
4A9JA 4A9IA 4CUTA 2I8NA 1WUMA 4UYEA 4HXNA 4C66A 3MQMA 4O78A 5DYCA 4QSXA 5E3GA 4QYLA 4BW1A 5IIDA 5LKTA 2RNWA 2D9EA 4UIWA 5DFDA 3U5NA 5FDZA 5FFYA 4LC2A 4LZSA 2RNXA 4HXMA 4TT2A 3FKMX 4N4HA 5CGPA 5AMFA 5DYAA 5IGNA 5HQ6A 5FB0A 4HXOA 5D3PA 4TYLA 4A9OA 4Q0OA 5I80A 4GPJA 3P1FA 5CY9A 5CQ8A 5CFWA 5IGMA 5D3JA 4O76A 5F3AA 5CUBA 4Z1SA 4YBMA 4NYXA 5CRMA 4IR4A 3U5LA 4NYVA 4AKNA 4MR5A 3AADA 5ENGA 4Q0NA 5F1HA 5FE9A 2L5EA 4OGJA 3D7CA 5H1VA 5EK9A 5F61A 3LQHA 4KV1A 5CQ7A 5I7YA 4BHWA 4Z6HA 2DVQA 3SVGA 2LSPB 4QEVA 5AD3A 5BT4A 5HM0A 4YC9A 5F36A 5EU1A 4QEUA 4XUBA 3JVKA 3QZVA 5EVAA 5I29A 2F6NA 5HQ5A 5CUGA 5A7CA 3UVXA 5CUEA 4A9KA 2YELA 2YYNA 5E9MA 4YYDA 5CP5A 5DX4A 5II2A 4ZC9A 3S92A 4YYIA 5HRXA 5H1UA 4QSPA 5D3SA 4ZQLA 5LKUA 5FG5A 4A9FA 1F68A 3UVDA 4PCIA 4NYWA 4CLBA 2DATA 4NRCA 3SVFA 4QR5A 4UITA 5LJ1A 5C8GA 4J1PA 2YDWA 5A82A 4YYGA 5HRVA 5FE4A 2DKWA 4UYHA 5IGLA 1N72A 4BW3A 5FE0A 4J0RA 3Q2EA 2OO1A 3JVLA 5G4SA 3UVYA 3DAIA 4Z6IA 2R0YA 5I86A 5DW1A 4QSVA 4LR6A 3UW9A 2RNYA 4CUQA 5D24A 4HBWA 5HLSA 2R10A 1X0JA 4IR6A 4CUSA 5AD2A 5A5NA 4TZ8A 4QSUA 5DKDA 3UVWA 4Z1QA 1ZS5A 5E9YA 4O72A 4YABA 5A5OA 3TLPA 4LYIA 2DVRA 5HFQA 3G0LA 5EM3A 3SVHA 5L97A 4QNSA 5A5PA 4N3WA 5E7DA 1JSPB 5L99A 5EP7A 4QR4A 4LYWA 4YH3A 4HXSA 2OSSA 5FB1A 4YBSA 4UIXA 5TB6A 4YH4A 5CQ4A 5FG6A 5EPBA 2N9GA 3IU5A 4X2IA 4TZ2A 5HEMA 5HCLA 4UYGA 5E74A 1WUGA 4LZ2A 3MULA 4WHUA 5ETBA 4MR6A 3NXBA 4O77A 5ACYA 2DVSA 4N4GA 4QSTA 4BW2A 5F62A 5EWWA 5EGUA 4ALGA 4QEWA 4NQMA 4IOOA 4YYKA 5CS8A 5E3DA 4WIVA 4O70A 4J0SA 5HQ7A 5COIA 5J0DA 3P1CA 5CTLA 2L85A 3QZTA 4QYDA 4YYMA 5DFBA 5BT5A 2R0SA 3MXFA 4IR5A 5TCMA 4O7AA 5A83A 2DWWA 4QSWA 4CUPA 5CQAA 5D3HA 5F25A 5LJ2A 5II1A 5KTXA 4OUFA 5DKHA 4KCXA 4YADA 4HBXA 5DYUA 4ZW1A 5D3RA 3HMFA 4NR8A 4YATA 5CPEA 4LZRA 4DONA 3U5KA 2YEKA 2WP2A 4TTEA 5ENJA 5DW2A 5CRZA 5HJCA 5D3NA 4PCEA 4RVRA 4O7EA 5CQ5A 4YYJA 4HXKA 5C85A 5D0CA 2E7NA 4YY6A 5C89A 5CUCA 5F1LA 1JM4B 2RS9B 4TS8A 5H1TA 5ENEA 4HXRA 4PKLA 4LYSA 5EISA 4CFLA 4YY4A 5I83A 4UYFB 5DLZA 2E3KA 4MEQA 3AQAA 4UIUA 5EWDA 5DKCA 5FFVA 3UV2A 4QC1A 5HELA 4NUCA 4LRGA 4NR9A 5CU8A 5IBNA 4N4FA 4PY6A 5KHMA 2WP1A 4NRAA 5EA1A 5HRWA 3U5PA 4TU4A 3ONIA 4N4IA 5FBXA 4HXPA 4MENA 2OUOA 4O7CA 3O37A 5EICA 4UYFA 5E0RA 5F60A 4XY9A 5FH8A 5HENA 4PTBA 5FE1A 4QC3A 5G4RA 4QZSA 3MUKA 2R0VA 5D25A 3P5OA 5LJ0A 4YYNA 4IORA 5EWVA 4A9LA 3HMHA 4A9MA 4XYAA 3U5OA 5ETDA 3S91A 5EI4A 4NR6A 4TQNA 5CQTA 4NR5A 3ZYUA 4LDFA 5ENCA 5I40A 4TT6A 5BT3A 3Q2FA 3LXJA 5E9KA 5D3TA 4UIYA 3UV5A 5K29A 5ENIA 4FLPA 3QZSA 4CL9A 5ENBA 5FE3A 4Y03A 5KTWA 3DWYA 5I89A 5I7XA 4HXLA 5FE6A 4J3IA 5ENFA 3LQIA 4QSQA 3RCWA 2F6JA 4NQNA 4YAXA 5FE5A 5E9LA 4BW4A 2GRCA 5KO4A 5LVRA 5EWHA 5A5QA 4NUDA 4O75A 4MR3A 5CUDA 4UYDA 3I3JA 4CURA 5DFCA 5CQ3A 4A9HA 4IR3A 4O71A 5FE8A 2RFJA 5DY7A 3MB4A 4NUEA 5D26A 4QY4A 3IU6A 5JI8A 5CQ6A 4A9EA 5I88A 5D7XA 3O33A 4XUAA 3LJWA 4F3IA 5C87A 2E7OA 5EWCA 5F5ZA 5LUUA 3U5JA 4TT4A 4YYHA 5IGKA 4MEOA 3UV4A 4HBYA 4QBMA 2G4AA 5KU3A 4NXJA 4O7FA 5HFRA 5EPRA 4ALHA 5IG6A 5E9VA 2KTBB 4WHWA 5DBMA 2DVVA 2FSAA 4YK0A 3GG3A 5FE2A 5A81A 2RO1A 4NRBA 5F2PA 5C4QA 3LQJA 1EQFA 3O36A 5EPSA 4IOQA 4NS5A 2YW5A 4Z93A 4A9NA 1E6IA 3P1DA 2MJVB 3O34A 4NR7A 5FH6A 2RI7A 5FE7A 3K2JA 2YEMA 4QR3A 5LVQA 5ENHA 3P1EA 4CUUA 5FH7A 4UIVA 5L96A 5L98A 2NXBA 4OGIA 4HBVA 5L8UA 5E73A 5A5RA 4NR4A 4QSSA 3JVMA 4E96A 3G0JA 5EQ1A 5CZGA 5DLXA 5KTUA 4CFKA 5C7NA 5I1QA 5JWMA 4O7BA 4UIZA 5AMEA 4KV4A 3MB3A 5EV9A 5FG4A 5CUAA 4C67A 4QSRA 5A85A 2YQDA 5A5SA 4QB3A 5H85A 5FFWA 4PS5A 4QUUA 3U5MA 5D3LA 5L8TA 4O74A 4QUTA 3JVJA 4MR4A 5LKZA 2I7KA 2H60A 3O35A 3HMEA 2D82A 5DYXA 5F63A 2L84A 4BJXA 4XY8A 4MEPA 4YBTA 4TU6A 5E9IA 5LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9J A;  4A9I A;  4CUT A;  2I8N A;  1WUM A;  4UYE A;  4HXN A;  4C66 A;  3MQM A;  4O78 A;  5DYC A;  4QSX A;  5E3G A;  4QYL A;  4BW1 A;  5IID A;  5LKT A;  2RNW A;  2D9E A;  4UIW A;  5DFD A;  3U5N A;  5FDZ A;  5FFY A;  4LC2 A;  4LZS A;  2RNX A;  4HXM A;  4TT2 A;  3FKM X;  4N4H A;  5CGP A;  5AMF A;  5DYA A;  5IGN A;  5HQ6 A;  5FB0 A;  4HXO A;  5D3P A;  4TYL A;  4A9O A;  4Q0O A;  5I80 A;  4GPJ A;  3P1F A;  5CY9 A;  5CQ8 A;  5CFW A;  5IGM A;  5D3J A;  4O76 A;  5F3A A;  5CUB A;  4Z1S A;  4YBM A;  4NYX A;  5CRM A;  4IR4 A;  3U5L A;  4NYV A;  4AKN A;  4MR5 A;  3AAD A;  5ENG A;  4Q0N A;  5F1H A;  5FE9 A;  2L5E A;  4OGJ A;  3D7C A;  5H1V A;  5EK9 A;  5F61 A;  3LQH A;  4KV1 A;  5CQ7 A;  5I7Y A;  4BHW A;  4Z6H A;  2DVQ A;  3SVG A;  2LSP B;  4QEV A;  5AD3 A;  5BT4 A;  5HM0 A;  4YC9 A;  5F36 A;  5EU1 A;  4QEU A;  4XUB A;  3JVK A;  3QZV A;  5EVA A;  5I29 A;  2F6N A;  5HQ5 A;  5CUG A;  5A7C A;  3UVX A;  5CUE A;  4A9K A;  2YEL A;  2YYN A;  5E9M A;  4YYD A;  5CP5 A;  5DX4 A;  5II2 A;  4ZC9 A;  3S92 A;  4YYI A;  5HRX A;  5H1U A;  4QSP A;  5D3S A;  4ZQL A;  5LKU A;  5FG5 A;  4A9F A;  1F68 A;  3UVD A;  4PCI A;  4NYW A;  4CLB A;  2DAT A;  4NRC A;  3SVF A;  4QR5 A;  4UIT A;  5LJ1 A;  5C8G A;  4J1P A;  2YDW A;  5A82 A;  4YYG A;  5HRV A;  5FE4 A;  2DKW A;  4UYH A;  5IGL A;  1N72 A;  4BW3 A;  5FE0 A;  4J0R A;  3Q2E A;  2OO1 A;  3JVL A;  5G4S A;  3UVY A;  3DAI A;  4Z6I A;  2R0Y A;  5I86 A;  5DW1 A;  4QSV A;  4LR6 A;  3UW9 A;  2RNY A;  4CUQ A;  5D24 A;  4HBW A;  5HLS A;  2R10 A;  1X0J A;  4IR6 A;  4CUS A;  5AD2 A;  5A5N A;  4TZ8 A;  4QSU A;  5DKD A;  3UVW A;  4Z1Q A;  1ZS5 A;  5E9Y A;  4O72 A;  4YAB A;  5A5O A;  3TLP A;  4LYI A;  2DVR A;  5HFQ A;  3G0L A;  5EM3 A;  3SVH A;  5L97 A;  4QNS A;  5A5P A;  4N3W A;  5E7D A;  1JSP B;  5L99 A;  5EP7 A;  4QR4 A;  4LYW A;  4YH3 A;  4HXS A;  2OSS A;  5FB1 A;  4YBS A;  4UIX A;  5TB6 A;  4YH4 A;  5CQ4 A;  5FG6 A;  5EPB A;  2N9G A;  3IU5 A;  4X2I A;  4TZ2 A;  5HEM A;  5HCL A;  4UYG A;  5E74 A;  1WUG A;  4LZ2 A;  3MUL A;  4WHU A;  5ETB A;  4MR6 A;  3NXB A;  4O77 A;  5ACY A;  2DVS A;  4N4G A;  4QST A;  4BW2 A;  5F62 A;  5EWW A;  5EGU A;  4ALG A;  4QEW A;  4NQM A;  4IOO A;  4YYK A;  5CS8 A;  5E3D A;  4WIV A;  4O70 A;  4J0S A;  5HQ7 A;  5COI A;  5J0D A;  3P1C A;  5CTL A;  2L85 A;  3QZT A;  4QYD A;  4YYM A;  5DFB A;  5BT5 A;  2R0S A;  3MXF A;  4IR5 A;  5TCM A;  4O7A A;  5A83 A;  2DWW A;  4QSW A;  4CUP A;  5CQA A;  5D3H A;  5F25 A;  5LJ2 A;  5II1 A;  5KTX A;  4OUF A;  5DKH A;  4KCX A;  4YAD A;  4HBX A;  5DYU A;  4ZW1 A;  5D3R A;  3HMF A;  4NR8 A;  4YAT A;  5CPE A;  4LZR A;  4DON A;  3U5K A;  2YEK A;  2WP2 A;  4TTE A;  5ENJ A;  5DW2 A;  5CRZ A;  5HJC A;  5D3N A;  4PCE A;  4RVR A;  4O7E A;  5CQ5 A;  4YYJ A;  4HXK A;  5C85 A;  5D0C A;  2E7N A;  4YY6 A;  5C89 A;  5CUC A;  5F1L A;  1JM4 B;  2RS9 B;  4TS8 A;  5H1T A;  5ENE A;  4HXR A;  4PKL A;  4LYS A;  5EIS A;  4CFL A;  4YY4 A;  5I83 A;  4UYF B;  5DLZ A;  2E3K A;  4MEQ A;  3AQA A;  4UIU A;  5EWD A;  5DKC A;  5FFV A;  3UV2 A;  4QC1 A;  5HEL A;  4NUC A;  4LRG A;  4NR9 A;  5CU8 A;  5IBN A;  4N4F A;  4PY6 A;  5KHM A;  2WP1 A;  4NRA A;  5EA1 A;  5HRW A;  3U5P A;  4TU4 A;  3ONI A;  4N4I A;  5FBX A;  4HXP A;  4MEN A;  2OUO A;  4O7C A;  3O37 A;  5EIC A;  4UYF A;  5E0R A;  5F60 A;  4XY9 A;  5FH8 A;  5HEN A;  4PTB A;  5FE1 A;  4QC3 A;  5G4R A;  4QZS A;  3MUK A;  2R0V A;  5D25 A;  3P5O A;  5LJ0 A;  4YYN A;  4IOR A;  5EWV A;  4A9L A;  3HMH A;  4A9M A;  4XYA A;  3U5O A;  5ETD A;  3S91 A;  5EI4 A;  4NR6 A;  4TQN A;  5CQT A;  4NR5 A;  3ZYU A;  4LDF A;  5ENC A;  5I40 A;  4TT6 A;  5BT3 A;  3Q2F A;  3LXJ A;  5E9K A;  5D3T A;  4UIY A;  3UV5 A;  5K29 A;  5ENI A;  4FLP A;  3QZS A;  4CL9 A;  5ENB A;  5FE3 A;  4Y03 A;  5KTW A;  3DWY A;  5I89 A;  5I7X A;  4HXL A;  5FE6 A;  4J3I A;  5ENF A;  3LQI A;  4QSQ A;  3RCW A;  2F6J A;  4NQN A;  4YAX A;  5FE5 A;  5E9L A;  4BW4 A;  2GRC A;  5KO4 A;  5LVR A;  5EWH A;  5A5Q A;  4NUD A;  4O75 A;  4MR3 A;  5CUD A;  4UYD A;  3I3J A;  4CUR A;  5DFC A;  5CQ3 A;  4A9H A;  4IR3 A;  4O71 A;  5FE8 A;  2RFJ A;  5DY7 A;  3MB4 A;  4NUE A;  5D26 A;  4QY4 A;  3IU6 A;  5JI8 A;  5CQ6 A;  4A9E A;  5I88 A;  5D7X A;  3O33 A;  4XUA A;  3LJW A;  4F3I A;  5C87 A;  2E7O A;  5EWC A;  5F5Z A;  5LUU A;  3U5J A;  4TT4 A;  4YYH A;  5IGK A;  4MEO A;  3UV4 A;  4HBY A;  4QBM A;  2G4A A;  5KU3 A;  4NXJ A;  4O7F A;  5HFR A;  5EPR A;  4ALH A;  5IG6 A;  5E9V A;  2KTB B;  4WHW A;  5DBM A;  2DVV A;  2FSA A;  4YK0 A;  3GG3 A;  5FE2 A;  5A81 A;  2RO1 A;  4NRB A;  5F2P A;  5C4Q A;  3LQJ A;  1EQF A;  3O36 A;  5EPS A;  4IOQ A;  4NS5 A;  2YW5 A;  4Z93 A;  4A9N A;  1E6I A;  3P1D A;  2MJV B;  3O34 A;  4NR7 A;  5FH6 A;  2RI7 A;  5FE7 A;  3K2J A;  2YEM A;  4QR3 A;  5LVQ A;  5ENH A;  3P1E A;  4CUU A;  5FH7 A;  4UIV A;  5L96 A;  5L98 A;  2NXB A;  4OGI A;  4HBV A;  5L8U A;  5E73 A;  5A5R A;  4NR4 A;  4QSS A;  3JVM A;  4E96 A;  3G0J A;  5EQ1 A;  5CZG A;  5DLX A;  5KTU A;  4CFK A;  5C7N A;  5I1Q A;  5JWM A;  4O7B A;  4UIZ A;  5AME A;  4KV4 A;  3MB3 A;  5EV9 A;  5FG4 A;  5CUA A;  4C67 A;  4QSR A;  5A85 A;  2YQD A;  5A5S A;  4QB3 A;  5H85 A;  5FFW A;  4PS5 A;  4QUU A;  3U5M A;  5D3L A;  5L8T A;  4O74 A;  4QUT A;  3JVJ A;  4MR4 A;  5LKZ A;  2I7K A;  2H60 A;  3O35 A;  3HME A;  2D82 A;  5DYX A;  5F63 A;  2L84 A;  4BJX A;  4XY8 A;  4MEP A;  4YBT A;  4TU6 A;  5E9I A;  5LKX A; 
#chains in the Genus database with same CATH topology
 4A9J A;  4A9I A;  4CUT A;  2I8N A;  1WUM A;  4UYE A;  4HXN A;  4C66 A;  3MQM A;  4O78 A;  5DYC A;  4QSX A;  5E3G A;  4QYL A;  4BW1 A;  5IID A;  5LKT A;  2RNW A;  2D9E A;  4UIW A;  5DFD A;  3U5N A;  5FDZ A;  5FFY A;  4LC2 A;  4LZS A;  2RNX A;  4HXM A;  4TT2 A;  3FKM X;  4N4H A;  5CGP A;  5AMF A;  5DYA A;  5IGN A;  5HQ6 A;  5FB0 A;  4HXO A;  5D3P A;  4TYL A;  4A9O A;  4Q0O A;  5I80 A;  4GPJ A;  3P1F A;  5CY9 A;  5CQ8 A;  5CFW A;  5IGM A;  5D3J A;  4O76 A;  5F3A A;  5CUB A;  4Z1S A;  4YBM A;  4NYX A;  5CRM A;  4IR4 A;  3U5L A;  4NYV A;  4AKN A;  4MR5 A;  3AAD A;  5ENG A;  4Q0N A;  5F1H A;  5FE9 A;  2L5E A;  4OGJ A;  3D7C A;  5H1V A;  5EK9 A;  5F61 A;  3LQH A;  4KV1 A;  5CQ7 A;  5I7Y A;  4BHW A;  4Z6H A;  2DVQ A;  3SVG A;  2LSP B;  4QEV A;  5AD3 A;  5BT4 A;  5HM0 A;  4YC9 A;  5F36 A;  5EU1 A;  4QEU A;  4XUB A;  3JVK A;  3QZV A;  5EVA A;  5I29 A;  2F6N A;  5HQ5 A;  5CUG A;  5A7C A;  3UVX A;  5CUE A;  4A9K A;  2YEL A;  2YYN A;  5E9M A;  4YYD A;  5CP5 A;  5DX4 A;  5II2 A;  4ZC9 A;  3S92 A;  4YYI A;  5HRX A;  5H1U A;  4AKH A;  4QSP A;  5D3S A;  3VKH A;  4ZQL A;  5LKU A;  5FG5 A;  4A9F A;  1F68 A;  3UVD A;  4PCI A;  4NYW A;  4CLB A;  2DAT A;  4NRC A;  3SVF A;  4QR5 A;  4UIT A;  5LJ1 A;  5C8G A;  4J1P A;  2YDW A;  5A82 A;  4YYG A;  5HRV A;  5FE4 A;  2DKW A;  4UYH A;  5IGL A;  1N72 A;  4BW3 A;  5FE0 A;  4J0R A;  3Q2E A;  2OO1 A;  3JVL A;  5G4S A;  3UVY A;  3DAI A;  4Z6I A;  2R0Y A;  5I86 A;  5DW1 A;  4QSV A;  4LR6 A;  3UW9 A;  2RNY A;  4CUQ A;  5D24 A;  4HBW A;  5HLS A;  2R10 A;  1X0J A;  4IR6 A;  4CUS A;  5AD2 A;  5A5N A;  4TZ8 A;  4QSU A;  5DKD A;  3UVW A;  4Z1Q A;  1ZS5 A;  5E9Y A;  4O72 A;  4YAB A;  5A5O A;  3TLP A;  4LYI A;  2DVR A;  5HFQ A;  3G0L A;  5EM3 A;  3SVH A;  5L97 A;  4QNS A;  5A5P A;  4N3W A;  5E7D A;  1JSP B;  5L99 A;  5EP7 A;  4QR4 A;  4LYW A;  4YH3 A;  4HXS A;  2OSS A;  5FB1 A;  4YBS A;  4UIX A;  5TB6 A;  4YH4 A;  5CQ4 A;  5FG6 A;  5EPB A;  2N9G A;  3IU5 A;  4X2I A;  4TZ2 A;  5HEM A;  5HCL A;  4UYG A;  5E74 A;  1WUG A;  4LZ2 A;  3MUL A;  4WHU A;  5ETB A;  4MR6 A;  3NXB A;  4O77 A;  5ACY A;  2DVS A;  4N4G A;  4QST A;  4BW2 A;  5F62 A;  5EWW A;  5EGU A;  4ALG A;  4QEW A;  4NQM A;  4IOO A;  4YYK A;  5CS8 A;  5E3D A;  4WIV A;  4O70 A;  4J0S A;  5HQ7 A;  5COI A;  5J0D A;  3P1C A;  5CTL A;  2L85 A;  3QZT A;  4QYD A;  4YYM A;  5DFB A;  5BT5 A;  2R0S A;  3MXF A;  4IR5 A;  5TCM A;  4O7A A;  5A83 A;  2DWW A;  4QSW A;  4CUP A;  3VKG A;  5CQA A;  5D3H A;  5F25 A;  5LJ2 A;  5II1 A;  5KTX A;  4OUF A;  5DKH A;  4KCX A;  4YAD A;  4HBX A;  5DYU A;  4ZW1 A;  5D3R A;  3HMF A;  4NR8 A;  2EJN A;  4YAT A;  5CPE A;  4LZR A;  4DON A;  3U5K A;  2YEK A;  2WP2 A;  4TTE A;  5ENJ A;  5DW2 A;  5CRZ A;  5HJC A;  5D3N A;  4PCE A;  4RVR A;  4O7E A;  5CQ5 A;  4YYJ A;  4HXK A;  5C85 A;  5D0C A;  2E7N A;  4YY6 A;  5C89 A;  5CUC A;  5F1L A;  1JM4 B;  2RS9 B;  4TS8 A;  5H1T A;  5ENE A;  4HXR A;  4PKL A;  4LYS A;  5EIS A;  4CFL A;  4YY4 A;  5I83 A;  4UYF B;  5DLZ A;  4AI6 A;  2E3K A;  4MEQ A;  3AQA A;  4UIU A;  5EWD A;  5DKC A;  5FFV A;  3UV2 A;  4QC1 A;  5HEL A;  4NUC A;  4LRG A;  4NR9 A;  5CU8 A;  5IBN A;  4N4F A;  4PY6 A;  5KHM A;  2WP1 A;  4NRA A;  5EA1 A;  5HRW A;  3U5P A;  4TU4 A;  3ONI A;  4N4I A;  5FBX A;  4HXP A;  3D1D A;  4MEN A;  2OUO A;  4O7C A;  3O37 A;  5EIC A;  4UYF A;  5E0R A;  5F60 A;  4XY9 A;  5FH8 A;  5HEN A;  4PTB A;  5FE1 A;  4QC3 A;  1PUO A;  5G4R A;  4QZS A;  3MUK A;  2R0V A;  5D25 A;  3P5O A;  5LJ0 A;  4YYN A;  4IOR A;  5EWV A;  4A9L A;  3HMH A;  4A9M A;  4XYA A;  3U5O A;  5ETD A;  1ZKR A;  4AKG A;  3S91 A;  5EI4 A;  4NR6 A;  4TQN A;  5CQT A;  4NR5 A;  3ZYU A;  4LDF A;  5ENC A;  5I40 A;  4TT6 A;  5BT3 A;  3Q2F A;  3LXJ A;  5E9K A;  5D3T A;  4UIY A;  3UV5 A;  5K29 A;  5ENI A;  4FLP A;  3QZS A;  4CL9 A;  5ENB A;  5FE3 A;  4Y03 A;  5KTW A;  3DWY A;  5I89 A;  5I7X A;  4HXL A;  5FE6 A;  4J3I A;  5ENF A;  3LQI A;  4QSQ A;  3RCW A;  2F6J A;  4NQN A;  4YAX A;  5FE5 A;  5E9L A;  4BW4 A;  2GRC A;  5KO4 A;  5LVR A;  5EWH A;  5A5Q A;  4NUD A;  4O75 A;  4MR3 A;  5CUD A;  4UYD A;  3I3J A;  4CUR A;  5DFC A;  5CQ3 A;  4A9H A;  4IR3 A;  4O71 A;  5FE8 A;  2RFJ A;  5DY7 A;  3MB4 A;  4NUE A;  5D26 A;  4QY4 A;  3IU6 A;  5JI8 A;  5CQ6 A;  4A9E A;  5I88 A;  5D7X A;  3O33 A;  4XUA A;  3LJW A;  4F3I A;  5C87 A;  2E7O A;  3D1B A;  5EWC A;  5F5Z A;  5LUU A;  3U5J A;  4TT4 A;  4YYH A;  5IGK A;  4MEO A;  3UV4 A;  4HBY A;  4QBM A;  2G4A A;  5KU3 A;  4NXJ A;  4O7F A;  5HFR A;  4AKI A;  5EPR A;  4ALH A;  5IG6 A;  5E9V A;  2KTB B;  4WHW A;  2DVV A;  2FSA A;  5DBM A;  4YK0 A;  3GG3 A;  5FE2 A;  5A81 A;  2RO1 A;  4NRB A;  5F2P A;  5C4Q A;  3LQJ A;  1EQF A;  3O36 A;  5EPS A;  4IOQ A;  4NS5 A;  2YW5 A;  4Z93 A;  4A9N A;  1E6I A;  3P1D A;  2MJV B;  3O34 A;  4NR7 A;  5FH6 A;  2RI7 A;  5FE7 A;  3K2J A;  2YEM A;  4QR3 A;  5LVQ A;  5ENH A;  3P1E A;  4CUU A;  5FH7 A;  4UIV A;  5L96 A;  5L98 A;  2NXB A;  4OGI A;  4HBV A;  5L8U A;  5E73 A;  5A5R A;  4NR4 A;  4QSS A;  3JVM A;  4E96 A;  3G0J A;  5EQ1 A;  5CZG A;  5DLX A;  5KTU A;  4CFK A;  5C7N A;  5I1Q A;  5JWM A;  4O7B A;  4UIZ A;  5AME A;  4KV4 A;  3MB3 A;  5EV9 A;  5FG4 A;  5CUA A;  4C67 A;  4QSR A;  3ERR A;  5A85 A;  2YQD A;  5A5S A;  4QB3 A;  5H85 A;  5FFW A;  4PS5 A;  4QUU A;  3U5M A;  5D3L A;  5L8T A;  4O74 A;  4QUT A;  3JVJ A;  4MR4 A;  5LKZ A;  2I7K A;  2H60 A;  3O35 A;  3HME A;  2D82 A;  5DYX A;  5F63 A;  2L84 A;  4BJX A;  4XY8 A;  4MEP A;  4YBT A;  4TU6 A;  5E9I A;  5LKX A; 
#chains in the Genus database with same CATH homology
 4A9J A;  4A9I A;  4CUT A;  2I8N A;  1WUM A;  4UYE A;  4HXN A;  4C66 A;  3MQM A;  4O78 A;  5DYC A;  4QSX A;  5E3G A;  4QYL A;  4BW1 A;  5IID A;  5LKT A;  2RNW A;  2D9E A;  4UIW A;  5DFD A;  3U5N A;  5FDZ A;  5FFY A;  4LC2 A;  4LZS A;  2RNX A;  4HXM A;  4TT2 A;  3FKM X;  4N4H A;  5CGP A;  5AMF A;  5DYA A;  5IGN A;  5HQ6 A;  5FB0 A;  4HXO A;  5D3P A;  4TYL A;  4A9O A;  4Q0O A;  5I80 A;  4GPJ A;  3P1F A;  5CY9 A;  5CQ8 A;  5CFW A;  5IGM A;  5D3J A;  4O76 A;  5F3A A;  5CUB A;  4Z1S A;  4YBM A;  4NYX A;  5CRM A;  4IR4 A;  3U5L A;  4NYV A;  4AKN A;  4MR5 A;  3AAD A;  5ENG A;  4Q0N A;  5F1H A;  5FE9 A;  2L5E A;  4OGJ A;  3D7C A;  5H1V A;  5EK9 A;  5F61 A;  3LQH A;  4KV1 A;  5CQ7 A;  5I7Y A;  4BHW A;  4Z6H A;  2DVQ A;  3SVG A;  2LSP B;  4QEV A;  5AD3 A;  5BT4 A;  5HM0 A;  4YC9 A;  5F36 A;  5EU1 A;  4QEU A;  4XUB A;  3JVK A;  3QZV A;  5EVA A;  5I29 A;  2F6N A;  5HQ5 A;  5CUG A;  5A7C A;  3UVX A;  5CUE A;  4A9K A;  2YEL A;  2YYN A;  5E9M A;  4YYD A;  5CP5 A;  5DX4 A;  5II2 A;  4ZC9 A;  3S92 A;  4YYI A;  5HRX A;  5H1U A;  4QSP A;  5D3S A;  4ZQL A;  5LKU A;  5FG5 A;  4A9F A;  1F68 A;  3UVD A;  4PCI A;  4NYW A;  4CLB A;  2DAT A;  4NRC A;  3SVF A;  4QR5 A;  4UIT A;  5LJ1 A;  5C8G A;  4J1P A;  2YDW A;  5A82 A;  4YYG A;  5HRV A;  5FE4 A;  2DKW A;  4UYH A;  5IGL A;  1N72 A;  4BW3 A;  5FE0 A;  4J0R A;  3Q2E A;  2OO1 A;  3JVL A;  5G4S A;  3UVY A;  3DAI A;  4Z6I A;  2R0Y A;  5I86 A;  5DW1 A;  4QSV A;  4LR6 A;  3UW9 A;  2RNY A;  4CUQ A;  5D24 A;  4HBW A;  5HLS A;  2R10 A;  1X0J A;  4IR6 A;  4CUS A;  5AD2 A;  5A5N A;  4TZ8 A;  4QSU A;  5DKD A;  3UVW A;  4Z1Q A;  1ZS5 A;  5E9Y A;  4O72 A;  4YAB A;  5A5O A;  3TLP A;  4LYI A;  2DVR A;  5HFQ A;  3G0L A;  5EM3 A;  3SVH A;  5L97 A;  4QNS A;  5A5P A;  4N3W A;  5E7D A;  1JSP B;  5L99 A;  5EP7 A;  4QR4 A;  4LYW A;  4YH3 A;  4HXS A;  2OSS A;  5FB1 A;  4YBS A;  4UIX A;  5TB6 A;  4YH4 A;  5CQ4 A;  5FG6 A;  5EPB A;  2N9G A;  3IU5 A;  4X2I A;  4TZ2 A;  5HEM A;  5HCL A;  4UYG A;  5E74 A;  1WUG A;  4LZ2 A;  3MUL A;  4WHU A;  5ETB A;  4MR6 A;  3NXB A;  4O77 A;  5ACY A;  2DVS A;  4N4G A;  4QST A;  4BW2 A;  5F62 A;  5EWW A;  5EGU A;  4ALG A;  4QEW A;  4NQM A;  4IOO A;  4YYK A;  5CS8 A;  5E3D A;  4WIV A;  4O70 A;  4J0S A;  5HQ7 A;  5COI A;  5J0D A;  3P1C A;  5CTL A;  2L85 A;  3QZT A;  4QYD A;  4YYM A;  5DFB A;  5BT5 A;  2R0S A;  3MXF A;  4IR5 A;  5TCM A;  4O7A A;  5A83 A;  2DWW A;  4QSW A;  4CUP A;  5CQA A;  5D3H A;  5F25 A;  5LJ2 A;  5II1 A;  5KTX A;  4OUF A;  5DKH A;  4KCX A;  4YAD A;  4HBX A;  5DYU A;  4ZW1 A;  5D3R A;  3HMF A;  4NR8 A;  4YAT A;  5CPE A;  4LZR A;  4DON A;  3U5K A;  2YEK A;  2WP2 A;  4TTE A;  5ENJ A;  5DW2 A;  5CRZ A;  5HJC A;  5D3N A;  4PCE A;  4RVR A;  4O7E A;  5CQ5 A;  4YYJ A;  4HXK A;  5C85 A;  5D0C A;  2E7N A;  4YY6 A;  5C89 A;  5CUC A;  5F1L A;  1JM4 B;  2RS9 B;  4TS8 A;  5H1T A;  5ENE A;  4HXR A;  4PKL A;  4LYS A;  5EIS A;  4CFL A;  4YY4 A;  5I83 A;  4UYF B;  5DLZ A;  2E3K A;  4MEQ A;  3AQA A;  4UIU A;  5EWD A;  5DKC A;  5FFV A;  3UV2 A;  4QC1 A;  5HEL A;  4NUC A;  4LRG A;  4NR9 A;  5CU8 A;  5IBN A;  4N4F A;  4PY6 A;  5KHM A;  2WP1 A;  4NRA A;  5EA1 A;  5HRW A;  3U5P A;  4TU4 A;  3ONI A;  4N4I A;  5FBX A;  4HXP A;  4MEN A;  2OUO A;  4O7C A;  3O37 A;  5EIC A;  4UYF A;  5E0R A;  5F60 A;  4XY9 A;  5FH8 A;  5HEN A;  4PTB A;  5FE1 A;  4QC3 A;  5G4R A;  4QZS A;  3MUK A;  2R0V A;  5D25 A;  3P5O A;  5LJ0 A;  4YYN A;  4IOR A;  5EWV A;  4A9L A;  3HMH A;  4A9M A;  4XYA A;  3U5O A;  5ETD A;  3S91 A;  5EI4 A;  4NR6 A;  4TQN A;  5CQT A;  4NR5 A;  3ZYU A;  4LDF A;  5ENC A;  5I40 A;  4TT6 A;  5BT3 A;  3Q2F A;  3LXJ A;  5E9K A;  5D3T A;  4UIY A;  3UV5 A;  5K29 A;  5ENI A;  4FLP A;  3QZS A;  4CL9 A;  5ENB A;  5FE3 A;  4Y03 A;  5KTW A;  3DWY A;  5I89 A;  5I7X A;  4HXL A;  5FE6 A;  4J3I A;  5ENF A;  3LQI A;  4QSQ A;  3RCW A;  2F6J A;  4NQN A;  4YAX A;  5FE5 A;  5E9L A;  4BW4 A;  2GRC A;  5KO4 A;  5LVR A;  5EWH A;  5A5Q A;  4NUD A;  4O75 A;  4MR3 A;  5CUD A;  4UYD A;  3I3J A;  4CUR A;  5DFC A;  5CQ3 A;  4A9H A;  4IR3 A;  4O71 A;  5FE8 A;  2RFJ A;  5DY7 A;  3MB4 A;  4NUE A;  5D26 A;  4QY4 A;  3IU6 A;  5JI8 A;  5CQ6 A;  4A9E A;  5I88 A;  5D7X A;  3O33 A;  4XUA A;  3LJW A;  4F3I A;  5C87 A;  2E7O A;  5EWC A;  5F5Z A;  5LUU A;  3U5J A;  4TT4 A;  4YYH A;  5IGK A;  4MEO A;  3UV4 A;  4HBY A;  4QBM A;  2G4A A;  5KU3 A;  4NXJ A;  4O7F A;  5HFR A;  5EPR A;  4ALH A;  5IG6 A;  5E9V A;  2KTB B;  4WHW A;  5DBM A;  2DVV A;  2FSA A;  4YK0 A;  3GG3 A;  5FE2 A;  5A81 A;  2RO1 A;  4NRB A;  5F2P A;  5C4Q A;  3LQJ A;  1EQF A;  3O36 A;  5EPS A;  4IOQ A;  4NS5 A;  2YW5 A;  4Z93 A;  4A9N A;  1E6I A;  3P1D A;  2MJV B;  3O34 A;  4NR7 A;  5FH6 A;  2RI7 A;  5FE7 A;  3K2J A;  2YEM A;  4QR3 A;  5LVQ A;  5ENH A;  3P1E A;  4CUU A;  5FH7 A;  4UIV A;  5L96 A;  5L98 A;  2NXB A;  4OGI A;  4HBV A;  5L8U A;  5E73 A;  5A5R A;  4NR4 A;  4QSS A;  3JVM A;  4E96 A;  3G0J A;  5EQ1 A;  5CZG A;  5DLX A;  5KTU A;  4CFK A;  5C7N A;  5I1Q A;  5JWM A;  4O7B A;  4UIZ A;  5AME A;  4KV4 A;  3MB3 A;  5EV9 A;  5FG4 A;  5CUA A;  4C67 A;  4QSR A;  5A85 A;  2YQD A;  5A5S A;  4QB3 A;  5H85 A;  5FFW A;  4PS5 A;  4QUU A;  3U5M A;  5D3L A;  5L8T A;  4O74 A;  4QUT A;  3JVJ A;  4MR4 A;  5LKZ A;  2I7K A;  2H60 A;  3O35 A;  3HME A;  2D82 A;  5DYX A;  5F63 A;  2L84 A;  4BJX A;  4XY8 A;  4MEP A;  4YBT A;  4TU6 A;  5E9I A;  5LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...