3S92A

Crystal structure of the second bromodomain of human brd3 in complex with the inhibitor jq1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Bromodomain-containing protein 3
publication title Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1
rcsb
source organism Homo sapiens
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3s92A00
2DVSA 3TLPA 4NYVA 2E3KA 3UVYA 4QC3A 4LZRA 3AADA 5HRVA 5AMEA 5EWHA 4QNSA 5ETBA 4HBXA 5EWDA 4Q0NA 4UIVA 5E9IA 4RVRA 3UV2A 4O77A 5JI8A 1ZS5A 5AMFA 4TTEA 3HMFA 5E9VA 3U5KA 5FB0A 5E0RA 4BHWA 5LVQA 5EWWA 5II1A 4O7CA 5FE7A 5I40A 4YYDA 4ZC9A 3S92A 5KTXA 3UV5A 4N4IA 4HXNA 5E74A 5A5SA 5CQ4A 4A9OA 4OGJA 2YEKA 4O7EA 4TS8A 4LR6A 2WP1A 2RS9B 4Y03A 5EU1A 4BJXA 3JVLA 5AD2A 1EQFA 5TB6A 5HCLA 3UVDA 5DKHA 5DX4A 1F68A 5CZGA 5A83A 2H60A 5LJ1A 3MQMA 5FE6A 4QUTA 4MEPA 4A9KA 3O33A 4MEQA 5HFRA 4HXMA 4PCIA 5LKUA 4YYGA 4YYIA 3K2JA 4TT2A 3O37A 4QSSA 2E7OA 4PS5A 5D3SA 5IG6A 4Q0OA 5ENJA 5DYUA 4LYSA 4QZSA 4KV1A 5H1UA 4LC2A 2RNWA 4HXLA 3ZYUA 4IOQA 5CQ3A 4O7AA 5FE5A 4PKLA 5LVRA 4QSRA 3U5MA 5C7NA 5A7CA 4CUSA 4XUBA 4XY8A 1WUGA 5CFWA 5E3DA 5IGKA 4YY4A 4TU4A 3DWYA 3UVXA 5A5QA 2N9GA 5EWVA 3D7CA 5EWCA 4GPJA 4C67A 4A9NA 4QR5A 4MR6A 4YH4A 4YC9A 5H85A 5CRZA 5AD3A 2OUOA 2FSAA 2YW5A 4QSTA 5D3JA 2OO1A 3JVKA 4QSPA 4CUUA 4QSQA 4Z1QA 5DKCA 5D3RA 5I89A 5EP7A 4A9LA 3MULA 2L84A 4NXJA 2E7NA 4J0SA 4NR5A 4ALHA 4J3IA 4TU6A 4IR5A 2KTBB 4ZQLA 4YYMA 4A9IA 4Z1SA 4YATA 5L96A 3ONIA 4QY4A 4YAXA 5D7XA 4PTBA 5LKTA 5KO4A 2DVVA 5E73A 2F6JA 4LYWA 5CPEA 5I80A 3JVMA 4F3IA 5IIDA 4YYJA 5L8UA 5F61A 5IGLA 5FH7A 4HXSA 5D3HA 4LDFA 5FBXA 1JM4B 4QR3A 5I7XA 3NXBA 5ETDA 4YABA 4QSVA 3U5JA 2YDWA 4AKNA 5CQAA 5C85A 5COIA 4O70A 5G4RA 4WIVA 4YYHA 5K29A 4E96A 5C87A 5CS8A 5EK9A 4BW4A 5HEMA 3SVHA 5FG4A 5DKDA 5I7YA 4KCXA 5J0DA 4UITA 1JSPB 4UYFB 5L8TA 5CQ7A 5FB1A 3O35A 4CL9A 5DFBA 5E9MA 5A5RA 4Z93A 4J1PA 5C4QA 4IOOA 4QYDA 3LQHA 2RI7A 3I3JA 5HFQA 4NR4A 4CLBA 5ENIA 4NQNA 3S91A 2YEMA 2RFJA 4UIUA 5E9KA 5FFYA 4PY6A 5EVAA 2G4AA 4IR4A 4TYLA 3FKMX 4QC1A 5EQ1A 3UW9A 5HENA 4HBYA 1WUMA 5ENBA 4YYNA 4QEWA 1E6IA 5HJCA 2YELA 2D82A 4QEVA 4QR4A 5EV9A 4O74A 2WP2A 5A85A 4CFKA 4WHWA 5DW2A 3LXJA 2YQDA 5F63A 5CGPA 2RO1A 4HXPA 5HRXA 5A81A 5ENCA 5ENHA 4NRCA 5F1HA 4QB3A 5F1LA 4XY9A 5EM3A 4NYXA 4MENA 5FE0A 5HRWA 5A5PA 4UYEA 3AQAA 4CUPA 4UIYA 5E3GA 5FE4A 4A9JA 2L85A 4YBSA 5KHMA 3P5OA 5ENGA 3SVGA 4NUEA 5DYAA 5FFWA 5I86A 5EISA 5EI4A 5BT5A 4MR5A 5F60A 5CY9A 5F62A 5DYCA 4QSXA 5HQ7A 3GG3A 4HXRA 5L97A 4TT4A 4UYFA 4Z6HA 4NQMA 4TZ2A 3P1DA 5FH6A 5D24A 3DAIA 4LZ2A 5LKZA 3UV4A 4OGIA 5JWMA 5CQ8A 4TQNA 4X2IA 4XUAA 4BW2A 5HQ6A 2RNYA 2MJVB 5C8GA 4N4FA 5LUUA 4ALGA 5A82A 5KTWA 4HXKA 3LQJA 5L98A 4N3WA 3IU5A 5F3AA 5CRMA 4YADA 5DLXA 5FE1A 3O36A 4UYDA 4NRBA 2D9EA 5DBMA 5FE9A 4O76A 5C89A 4DONA 5CUGA 5KTUA 4NYWA 5I83A 4NUDA 2R0SA 3SVFA 4NRAA 5I1QA 5KU3A 4YYKA 4FLPA 4UIXA 4J0RA 5EGUA 4IR6A 4NR8A 5D3NA 3MUKA 5DYXA 5ENEA 5D0CA 3QZSA 4O7FA 5EA1A 4QUUA 4IORA 4CUTA 4CUQA 5D25A 5A5OA 4NR7A 5DFCA 4XYAA 4OUFA 5F25A 1N72A 5FG5A 5CUAA 4LRGA 5CU8A 4LZSA 2GRCA 2OSSA 4HBWA 2R0YA 4A9MA 4TT6A 4WHUA 3G0JA 4HXOA 4UYGA 5DLZA 2YYNA 4NS5A 2F6NA 5FE3A 3HMEA 5ENFA 3G0LA 5G4SA 5H1TA 3U5NA 3U5PA 3IU6A 5E9LA 5IBNA 3P1EA 4LYIA 2I7KA 3QZVA 4C66A 4BW1A 4YK0A 5FH8A 5E7DA 3Q2FA 5ACYA 5IGNA 5FE2A 5CTLA 4IR3A 3U5OA 2L5EA 5CUEA 5D26A 2DWWA 4UIWA 4O71A 4QSWA 4NUCA 3JVJA 3P1CA 4O78A 5CUDA 4O7BA 5IGMA 5L99A 4MR3A 4ZW1A 2R0VA 4NR6A 4QSUA 4O72A 4BW3A 2DVRA 4A9EA 4CURA 3U5LA 4QEUA 5F5ZA 4CFLA 5F2PA 2RNXA 4NR9A 3MXFA 2DVQA 5F36A 5FG6A 3RCWA 5D3PA 5FDZA 5TCMA 5CUCA 3P1FA 4YBTA 4QYLA 4UYHA 4A9FA 5CUBA 4QBMA 5CQTA 5DW1A 4Z6IA 5FE8A 3LJWA 4N4HA 4N4GA 5CQ6A 5HM0A 5LJ0A 3LQIA 5EPSA 3O34A 5D3TA 5E9YA 5DFDA 2R10A 4MR4A 4MEOA 2LSPB 5CQ5A 5BT4A 4O75A 4A9HA 5CP5A 1X0JA 3UVWA 5EPRA 5HELA 5LJ2A 2I8NA 5EPBA 3MB4A 5FFVA 4UIZA 5I29A 4TZ8A 5A5NA 5EICA 4HBVA 5HLSA 5II2A 4KV4A 2DATA 2DKWA 3MB3A 5DY7A 5BT3A 5H1VA 2NXBA 4YH3A 4PCEA 3Q2EA 3HMHA 4YBMA 3QZTA 5LKXA 4YY6A 5I88A 5HQ5A 5D3LA
chains in the Genus database with same CATH superfamily
2DVSA 3TLPA 4NYVA 2E3KA 3UVYA 4QC3A 4LZRA 3AADA 5HRVA 5AMEA 5EWHA 4QNSA 5ETBA 4HBXA 5EWDA 4Q0NA 4UIVA 5E9IA 4RVRA 3UV2A 4O77A 5JI8A 1ZS5A 5AMFA 4TTEA 3HMFA 5E9VA 2EJNA 5FB0A 3U5KA 5E0RA 4BHWA 5LVQA 5EWWA 5II1A 4O7CA 5FE7A 5I40A 4YYDA 4ZC9A 3S92A 4AI6A 5KTXA 3UV5A 4N4IA 4HXNA 5E74A 5A5SA 5CQ4A 4A9OA 4OGJA 2YEKA 4O7EA 4TS8A 4LR6A 2WP1A 2RS9B 4Y03A 5EU1A 4BJXA 3JVLA 5AD2A 1EQFA 5TB6A 5HCLA 3UVDA 5DKHA 5DX4A 1F68A 5CZGA 5A83A 2H60A 5LJ1A 3MQMA 5FE6A 4QUTA 4MEPA 4A9KA 3O33A 4MEQA 5HFRA 4HXMA 4PCIA 5LKUA 4YYGA 4YYIA 3K2JA 4TT2A 3O37A 4QSSA 2E7OA 4PS5A 5D3SA 5IG6A 4Q0OA 5ENJA 3VKHA 5DYUA 4LYSA 4QZSA 4KV1A 5H1UA 4LC2A 2RNWA 4HXLA 4AKIA 3ZYUA 4IOQA 5CQ3A 4O7AA 5FE5A 4PKLA 5LVRA 4QSRA 3U5MA 5C7NA 5A7CA 4CUSA 4XUBA 4XY8A 1WUGA 5CFWA 5E3DA 5IGKA 4YY4A 4TU4A 3DWYA 3UVXA 5A5QA 2N9GA 5EWVA 3D7CA 5EWCA 4GPJA 4C67A 4A9NA 4QR5A 4MR6A 4YH4A 4YC9A 5H85A 5CRZA 5AD3A 2OUOA 2FSAA 2YW5A 4QSTA 5D3JA 2OO1A 3JVKA 4QSPA 4CUUA 4QSQA 4Z1QA 5DKCA 5D3RA 5I89A 5EP7A 4A9LA 3MULA 2L84A 4NXJA 2E7NA 4J0SA 4NR5A 4ALHA 4J3IA 4TU6A 4IR5A 2KTBB 4ZQLA 4YYMA 4A9IA 4Z1SA 4YATA 5L96A 3ONIA 4QY4A 4YAXA 5D7XA 4PTBA 5LKTA 5KO4A 2DVVA 5E73A 2F6JA 4LYWA 5CPEA 5I80A 3JVMA 4F3IA 5IIDA 4YYJA 5L8UA 5F61A 5IGLA 5FH7A 4HXSA 5D3HA 4LDFA 5FBXA 1JM4B 4QR3A 5I7XA 3NXBA 5ETDA 4YABA 4QSVA 3U5JA 2YDWA 4AKNA 5CQAA 5C85A 5COIA 4O70A 5G4RA 4WIVA 4YYHA 5K29A 4E96A 5C87A 5CS8A 5EK9A 4BW4A 5HEMA 3SVHA 5FG4A 5DKDA 5I7YA 4KCXA 5J0DA 4UITA 1JSPB 4UYFB 5L8TA 3ERRA 5CQ7A 5FB1A 3O35A 4CL9A 5DFBA 5E9MA 5A5RA 4J1PA 4Z93A 5C4QA 4IOOA 4QYDA 3LQHA 2RI7A 3I3JA 5HFQA 4NR4A 4CLBA 5ENIA 4NQNA 3S91A 2YEMA 2RFJA 4UIUA 5E9KA 5FFYA 4PY6A 5EVAA 2G4AA 4IR4A 4TYLA 3FKMX 4QC1A 5EQ1A 3UW9A 5HENA 4HBYA 1WUMA 5ENBA 4YYNA 4QEWA 1E6IA 5HJCA 2YELA 2D82A 4QEVA 4QR4A 5EV9A 4O74A 2WP2A 5A85A 4CFKA 4WHWA 5DW2A 3LXJA 2YQDA 5F63A 5CGPA 2RO1A 4HXPA 5HRXA 5A81A 5ENCA 5ENHA 4NRCA 5F1HA 4QB3A 5F1LA 4XY9A 5EM3A 4NYXA 4MENA 5FE0A 5HRWA 5A5PA 4UYEA 3AQAA 4CUPA 4UIYA 5E3GA 5FE4A 4A9JA 2L85A 4YBSA 5KHMA 3P5OA 5ENGA 3SVGA 4NUEA 5DYAA 5FFWA 5I86A 5EISA 5EI4A 5BT5A 4MR5A 5F60A 5CY9A 4AKHA 5F62A 5DYCA 4QSXA 5HQ7A 3GG3A 4HXRA 5L97A 4TT4A 4UYFA 4Z6HA 4NQMA 4TZ2A 3P1DA 5FH6A 5D24A 3DAIA 4LZ2A 5LKZA 3UV4A 4OGIA 5JWMA 5CQ8A 4TQNA 4X2IA 4XUAA 4BW2A 5HQ6A 2RNYA 2MJVB 5C8GA 4N4FA 5LUUA 4ALGA 5A82A 5KTWA 4HXKA 3D1DA 3LQJA 5L98A 4N3WA 3IU5A 5F3AA 5CRMA 4YADA 5DLXA 5FE1A 3O36A 4UYDA 4NRBA 2D9EA 5DBMA 3D1BA 5FE9A 4O76A 5C89A 4DONA 1PUOA 5CUGA 5KTUA 4NYWA 5I83A 4NUDA 2R0SA 3SVFA 4NRAA 5I1QA 5KU3A 4YYKA 4FLPA 4UIXA 4J0RA 5EGUA 4IR6A 4NR8A 5D3NA 3MUKA 5DYXA 5ENEA 5D0CA 3QZSA 4O7FA 5EA1A 4QUUA 4IORA 4CUTA 4CUQA 5D25A 5A5OA 4NR7A 5DFCA 4XYAA 4OUFA 5F25A 1N72A 5FG5A 5CUAA 4LRGA 1ZKRA 5CU8A 4LZSA 2GRCA 2OSSA 4HBWA 2R0YA 4A9MA 4TT6A 4WHUA 3G0JA 4HXOA 4UYGA 5DLZA 2YYNA 4NS5A 2F6NA 5FE3A 3HMEA 5ENFA 3G0LA 5G4SA 5H1TA 3U5NA 3U5PA 3IU6A 5E9LA 5IBNA 3P1EA 4LYIA 2I7KA 3QZVA 4C66A 4BW1A 4YK0A 5FH8A 5E7DA 3Q2FA 5ACYA 5IGNA 5FE2A 5CTLA 4IR3A 3U5OA 2L5EA 5CUEA 5D26A 2DWWA 4UIWA 4O71A 4QSWA 4NUCA 3JVJA 3P1CA 4O78A 5CUDA 4O7BA 5IGMA 5L99A 3VKGA 4MR3A 4ZW1A 2R0VA 4NR6A 4QSUA 4O72A 4BW3A 2DVRA 4A9EA 4CURA 3U5LA 4QEUA 5F5ZA 4CFLA 5F2PA 2RNXA 4NR9A 3MXFA 2DVQA 5F36A 5FG6A 3RCWA 5D3PA 5FDZA 5TCMA 5CUCA 3P1FA 4YBTA 4QYLA 4UYHA 4A9FA 5CUBA 4QBMA 5CQTA 5DW1A 4Z6IA 5FE8A 3LJWA 4N4HA 4N4GA 5CQ6A 5HM0A 5LJ0A 3LQIA 5EPSA 3O34A 5D3TA 5E9YA 5DFDA 2R10A 4MR4A 4MEOA 2LSPB 5CQ5A 5BT4A 4O75A 4A9HA 5CP5A 1X0JA 3UVWA 5EPRA 5HELA 5LJ2A 2I8NA 5EPBA 3MB4A 5FFVA 4UIZA 4AKGA 5I29A 4TZ8A 5A5NA 5EICA 4HBVA 5HLSA 5II2A 4KV4A 2DATA 2DKWA 3MB3A 5DY7A 5BT3A 5H1VA 2NXBA 4YH3A 4PCEA 3Q2EA 3HMHA 4YBMA 3QZTA 5LKXA 4YY6A 5I88A 5HQ5A 5D3LA
chains in the Genus database with same CATH topology
2DVSA 3TLPA 4NYVA 2E3KA 3UVYA 4QC3A 4LZRA 3AADA 5HRVA 5AMEA 5EWHA 4QNSA 5ETBA 4HBXA 5EWDA 4Q0NA 4UIVA 5E9IA 4RVRA 3UV2A 4O77A 5JI8A 1ZS5A 5AMFA 4TTEA 3HMFA 5E9VA 3U5KA 5FB0A 5E0RA 4BHWA 5LVQA 5EWWA 5II1A 4O7CA 5FE7A 5I40A 4YYDA 4ZC9A 3S92A 5KTXA 3UV5A 4N4IA 4HXNA 5E74A 5A5SA 5CQ4A 4A9OA 4OGJA 2YEKA 4O7EA 4TS8A 4LR6A 2WP1A 2RS9B 4Y03A 5EU1A 4BJXA 3JVLA 5AD2A 1EQFA 5TB6A 5HCLA 3UVDA 5DKHA 5DX4A 1F68A 5CZGA 5A83A 2H60A 5LJ1A 3MQMA 5FE6A 4QUTA 4MEPA 4A9KA 3O33A 4MEQA 5HFRA 4HXMA 4PCIA 5LKUA 4YYGA 4YYIA 3K2JA 4TT2A 3O37A 4QSSA 2E7OA 4PS5A 5D3SA 5IG6A 4Q0OA 5ENJA 5DYUA 4LYSA 4QZSA 4KV1A 5H1UA 4LC2A 2RNWA 4HXLA 3ZYUA 4IOQA 5CQ3A 4O7AA 5FE5A 4PKLA 5LVRA 4QSRA 3U5MA 5C7NA 5A7CA 4CUSA 4XUBA 4XY8A 1WUGA 5CFWA 5E3DA 5IGKA 4YY4A 4TU4A 3DWYA 3UVXA 5A5QA 2N9GA 5EWVA 3D7CA 5EWCA 4GPJA 4C67A 4A9NA 4QR5A 4MR6A 4YH4A 4YC9A 5H85A 5CRZA 5AD3A 2OUOA 2FSAA 2YW5A 4QSTA 5D3JA 2OO1A 3JVKA 4QSPA 4CUUA 4QSQA 4Z1QA 5DKCA 5D3RA 5I89A 5EP7A 4A9LA 3MULA 2L84A 4NXJA 2E7NA 4J0SA 4NR5A 4ALHA 4J3IA 4TU6A 4IR5A 2KTBB 4ZQLA 4YYMA 4A9IA 4Z1SA 4YATA 5L96A 3ONIA 4QY4A 4YAXA 5D7XA 4PTBA 5LKTA 5KO4A 2DVVA 5E73A 2F6JA 4LYWA 5CPEA 5I80A 3JVMA 4F3IA 5IIDA 4YYJA 5L8UA 5F61A 5IGLA 5FH7A 4HXSA 5D3HA 4LDFA 5FBXA 1JM4B 4QR3A 5I7XA 3NXBA 5ETDA 4YABA 4QSVA 3U5JA 2YDWA 4AKNA 5CQAA 5C85A 5COIA 4O70A 5G4RA 4WIVA 4YYHA 5K29A 4E96A 5C87A 5CS8A 5EK9A 4BW4A 5HEMA 3SVHA 5FG4A 5DKDA 5I7YA 4KCXA 5J0DA 4UITA 1JSPB 4UYFB 5L8TA 5CQ7A 5FB1A 3O35A 4CL9A 5DFBA 5E9MA 5A5RA 4Z93A 4J1PA 5C4QA 4IOOA 4QYDA 3LQHA 2RI7A 3I3JA 5HFQA 4NR4A 4CLBA 5ENIA 4NQNA 3S91A 2YEMA 2RFJA 4UIUA 5E9KA 5FFYA 4PY6A 5EVAA 2G4AA 4IR4A 4TYLA 3FKMX 4QC1A 5EQ1A 3UW9A 5HENA 4HBYA 1WUMA 5ENBA 4YYNA 4QEWA 1E6IA 5HJCA 2YELA 2D82A 4QEVA 4QR4A 5EV9A 4O74A 2WP2A 5A85A 4CFKA 4WHWA 5DW2A 3LXJA 2YQDA 5F63A 5CGPA 2RO1A 4HXPA 5HRXA 5A81A 5ENCA 5ENHA 4NRCA 5F1HA 4QB3A 5F1LA 4XY9A 5EM3A 4NYXA 4MENA 5FE0A 5HRWA 5A5PA 4UYEA 3AQAA 4CUPA 4UIYA 5E3GA 5FE4A 4A9JA 2L85A 4YBSA 5KHMA 3P5OA 5ENGA 3SVGA 4NUEA 5DYAA 5FFWA 5I86A 5EISA 5EI4A 5BT5A 4MR5A 5F60A 5CY9A 5F62A 5DYCA 4QSXA 5HQ7A 3GG3A 4HXRA 5L97A 4TT4A 4UYFA 4Z6HA 4NQMA 4TZ2A 3P1DA 5FH6A 5D24A 3DAIA 4LZ2A 5LKZA 3UV4A 4OGIA 5JWMA 5CQ8A 4TQNA 4X2IA 4XUAA 4BW2A 5HQ6A 2RNYA 2MJVB 5C8GA 4N4FA 5LUUA 4ALGA 5A82A 5KTWA 4HXKA 3LQJA 5L98A 4N3WA 3IU5A 5F3AA 5CRMA 4YADA 5DLXA 5FE1A 3O36A 4UYDA 4NRBA 2D9EA 5DBMA 5FE9A 4O76A 5C89A 4DONA 5CUGA 5KTUA 4NYWA 5I83A 4NUDA 2R0SA 3SVFA 4NRAA 5I1QA 5KU3A 4YYKA 4FLPA 4UIXA 4J0RA 5EGUA 4IR6A 4NR8A 5D3NA 3MUKA 5DYXA 5ENEA 5D0CA 3QZSA 4O7FA 5EA1A 4QUUA 4IORA 4CUTA 4CUQA 5D25A 5A5OA 4NR7A 5DFCA 4XYAA 4OUFA 5F25A 1N72A 5FG5A 5CUAA 4LRGA 5CU8A 4LZSA 2GRCA 2OSSA 4HBWA 2R0YA 4A9MA 4TT6A 4WHUA 3G0JA 4HXOA 4UYGA 5DLZA 2YYNA 4NS5A 2F6NA 5FE3A 3HMEA 5ENFA 3G0LA 5G4SA 5H1TA 3U5NA 3U5PA 3IU6A 5E9LA 5IBNA 3P1EA 4LYIA 2I7KA 3QZVA 4C66A 4BW1A 4YK0A 5FH8A 5E7DA 3Q2FA 5ACYA 5IGNA 5FE2A 5CTLA 4IR3A 3U5OA 2L5EA 5CUEA 5D26A 2DWWA 4UIWA 4O71A 4QSWA 4NUCA 3JVJA 3P1CA 4O78A 5CUDA 4O7BA 5IGMA 5L99A 4MR3A 4ZW1A 2R0VA 4NR6A 4QSUA 4O72A 4BW3A 2DVRA 4A9EA 4CURA 3U5LA 4QEUA 5F5ZA 4CFLA 5F2PA 2RNXA 4NR9A 3MXFA 2DVQA 5F36A 5FG6A 3RCWA 5D3PA 5FDZA 5TCMA 5CUCA 3P1FA 4YBTA 4QYLA 4UYHA 4A9FA 5CUBA 4QBMA 5CQTA 5DW1A 4Z6IA 5FE8A 3LJWA 4N4HA 4N4GA 5CQ6A 5HM0A 5LJ0A 3LQIA 5EPSA 3O34A 5D3TA 5E9YA 5DFDA 2R10A 4MR4A 4MEOA 2LSPB 5CQ5A 5BT4A 4O75A 4A9HA 5CP5A 1X0JA 3UVWA 5EPRA 5HELA 5LJ2A 2I8NA 5EPBA 3MB4A 5FFVA 4UIZA 5I29A 4TZ8A 5A5NA 5EICA 4HBVA 5HLSA 5II2A 4KV4A 2DATA 2DKWA 3MB3A 5DY7A 5BT3A 5H1VA 2NXBA 4YH3A 4PCEA 3Q2EA 3HMHA 4YBMA 3QZTA 5LKXA 4YY6A 5I88A 5HQ5A 5D3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVS A;  3TLP A;  4NYV A;  2E3K A;  3UVY A;  4QC3 A;  4LZR A;  3AAD A;  5HRV A;  5AME A;  5EWH A;  4QNS A;  5ETB A;  4HBX A;  5EWD A;  4Q0N A;  4UIV A;  5E9I A;  4RVR A;  3UV2 A;  4O77 A;  5JI8 A;  1ZS5 A;  5AMF A;  4TTE A;  3HMF A;  5E9V A;  3U5K A;  5FB0 A;  5E0R A;  4BHW A;  5LVQ A;  5EWW A;  5II1 A;  4O7C A;  5FE7 A;  5I40 A;  4YYD A;  4ZC9 A;  3S92 A;  5KTX A;  3UV5 A;  4N4I A;  4HXN A;  5E74 A;  5A5S A;  5CQ4 A;  4A9O A;  4OGJ A;  2YEK A;  4O7E A;  4TS8 A;  4LR6 A;  2WP1 A;  2RS9 B;  4Y03 A;  5EU1 A;  4BJX A;  3JVL A;  5AD2 A;  1EQF A;  5TB6 A;  5HCL A;  3UVD A;  5DKH A;  5DX4 A;  1F68 A;  5CZG A;  5A83 A;  2H60 A;  5LJ1 A;  3MQM A;  5FE6 A;  4QUT A;  4MEP A;  4A9K A;  3O33 A;  4MEQ A;  5HFR A;  4HXM A;  4PCI A;  5LKU A;  4YYG A;  4YYI A;  3K2J A;  4TT2 A;  3O37 A;  4QSS A;  2E7O A;  4PS5 A;  5D3S A;  5IG6 A;  4Q0O A;  5ENJ A;  5DYU A;  4LYS A;  4QZS A;  4KV1 A;  5H1U A;  4LC2 A;  2RNW A;  4HXL A;  3ZYU A;  4IOQ A;  5CQ3 A;  4O7A A;  5FE5 A;  4PKL A;  5LVR A;  4QSR A;  3U5M A;  5C7N A;  5A7C A;  4CUS A;  4XUB A;  4XY8 A;  1WUG A;  5CFW A;  5E3D A;  5IGK A;  4YY4 A;  4TU4 A;  3DWY A;  3UVX A;  5A5Q A;  2N9G A;  5EWV A;  3D7C A;  5EWC A;  4GPJ A;  4C67 A;  4A9N A;  4QR5 A;  4MR6 A;  4YH4 A;  4YC9 A;  5H85 A;  5CRZ A;  5AD3 A;  2OUO A;  2FSA A;  2YW5 A;  4QST A;  5D3J A;  2OO1 A;  3JVK A;  4QSP A;  4CUU A;  4QSQ A;  4Z1Q A;  5DKC A;  5D3R A;  5I89 A;  5EP7 A;  4A9L A;  3MUL A;  2L84 A;  4NXJ A;  2E7N A;  4J0S A;  4NR5 A;  4ALH A;  4J3I A;  4TU6 A;  4IR5 A;  2KTB B;  4ZQL A;  4YYM A;  4A9I A;  4Z1S A;  4YAT A;  5L96 A;  3ONI A;  4QY4 A;  4YAX A;  5D7X A;  4PTB A;  5LKT A;  5KO4 A;  2DVV A;  5E73 A;  2F6J A;  4LYW A;  5CPE A;  5I80 A;  3JVM A;  4F3I A;  5IID A;  4YYJ A;  5L8U A;  5F61 A;  5IGL A;  5FH7 A;  4HXS A;  5D3H A;  4LDF A;  5FBX A;  1JM4 B;  4QR3 A;  5I7X A;  3NXB A;  5ETD A;  4YAB A;  4QSV A;  3U5J A;  2YDW A;  4AKN A;  5CQA A;  5C85 A;  5COI A;  4O70 A;  5G4R A;  4WIV A;  4YYH A;  5K29 A;  4E96 A;  5C87 A;  5CS8 A;  5EK9 A;  4BW4 A;  5HEM A;  3SVH A;  5FG4 A;  5DKD A;  5I7Y A;  4KCX A;  5J0D A;  4UIT A;  1JSP B;  4UYF B;  5L8T A;  5CQ7 A;  5FB1 A;  3O35 A;  4CL9 A;  5DFB A;  5E9M A;  5A5R A;  4Z93 A;  4J1P A;  5C4Q A;  4IOO A;  4QYD A;  3LQH A;  2RI7 A;  3I3J A;  5HFQ A;  4NR4 A;  4CLB A;  5ENI A;  4NQN A;  3S91 A;  2YEM A;  2RFJ A;  4UIU A;  5E9K A;  5FFY A;  4PY6 A;  5EVA A;  2G4A A;  4IR4 A;  4TYL A;  3FKM X;  4QC1 A;  5EQ1 A;  3UW9 A;  5HEN A;  4HBY A;  1WUM A;  5ENB A;  4YYN A;  4QEW A;  1E6I A;  5HJC A;  2YEL A;  2D82 A;  4QEV A;  4QR4 A;  5EV9 A;  4O74 A;  2WP2 A;  5A85 A;  4CFK A;  4WHW A;  5DW2 A;  3LXJ A;  2YQD A;  5F63 A;  5CGP A;  2RO1 A;  4HXP A;  5HRX A;  5A81 A;  5ENC A;  5ENH A;  4NRC A;  5F1H A;  4QB3 A;  5F1L A;  4XY9 A;  5EM3 A;  4NYX A;  4MEN A;  5FE0 A;  5HRW A;  5A5P A;  4UYE A;  3AQA A;  4CUP A;  4UIY A;  5E3G A;  5FE4 A;  4A9J A;  2L85 A;  4YBS A;  5KHM A;  3P5O A;  5ENG A;  3SVG A;  4NUE A;  5DYA A;  5FFW A;  5I86 A;  5EIS A;  5EI4 A;  5BT5 A;  4MR5 A;  5F60 A;  5CY9 A;  5F62 A;  5DYC A;  4QSX A;  5HQ7 A;  3GG3 A;  4HXR A;  5L97 A;  4TT4 A;  4UYF A;  4Z6H A;  4NQM A;  4TZ2 A;  3P1D A;  5FH6 A;  5D24 A;  3DAI A;  4LZ2 A;  5LKZ A;  3UV4 A;  4OGI A;  5JWM A;  5CQ8 A;  4TQN A;  4X2I A;  4XUA A;  4BW2 A;  5HQ6 A;  2RNY A;  2MJV B;  5C8G A;  4N4F A;  5LUU A;  4ALG A;  5A82 A;  5KTW A;  4HXK A;  3LQJ A;  5L98 A;  4N3W A;  3IU5 A;  5F3A A;  5CRM A;  4YAD A;  5DLX A;  5FE1 A;  3O36 A;  4UYD A;  4NRB A;  2D9E A;  5DBM A;  5FE9 A;  4O76 A;  5C89 A;  4DON A;  5CUG A;  5KTU A;  4NYW A;  5I83 A;  4NUD A;  2R0S A;  3SVF A;  4NRA A;  5I1Q A;  5KU3 A;  4YYK A;  4FLP A;  4UIX A;  4J0R A;  5EGU A;  4IR6 A;  4NR8 A;  5D3N A;  3MUK A;  5DYX A;  5ENE A;  5D0C A;  3QZS A;  4O7F A;  5EA1 A;  4QUU A;  4IOR A;  4CUT A;  4CUQ A;  5D25 A;  5A5O A;  4NR7 A;  5DFC A;  4XYA A;  4OUF A;  5F25 A;  1N72 A;  5FG5 A;  5CUA A;  4LRG A;  5CU8 A;  4LZS A;  2GRC A;  2OSS A;  4HBW A;  2R0Y A;  4A9M A;  4TT6 A;  4WHU A;  3G0J A;  4HXO A;  4UYG A;  5DLZ A;  2YYN A;  4NS5 A;  2F6N A;  5FE3 A;  3HME A;  5ENF A;  3G0L A;  5G4S A;  5H1T A;  3U5N A;  3U5P A;  3IU6 A;  5E9L A;  5IBN A;  3P1E A;  4LYI A;  2I7K A;  3QZV A;  4C66 A;  4BW1 A;  4YK0 A;  5FH8 A;  5E7D A;  3Q2F A;  5ACY A;  5IGN A;  5FE2 A;  5CTL A;  4IR3 A;  3U5O A;  2L5E A;  5CUE A;  5D26 A;  2DWW A;  4UIW A;  4O71 A;  4QSW A;  4NUC A;  3JVJ A;  3P1C A;  4O78 A;  5CUD A;  4O7B A;  5IGM A;  5L99 A;  4MR3 A;  4ZW1 A;  2R0V A;  4NR6 A;  4QSU A;  4O72 A;  4BW3 A;  2DVR A;  4A9E A;  4CUR A;  3U5L A;  4QEU A;  5F5Z A;  4CFL A;  5F2P A;  2RNX A;  4NR9 A;  3MXF A;  2DVQ A;  5F36 A;  5FG6 A;  3RCW A;  5D3P A;  5FDZ A;  5TCM A;  5CUC A;  3P1F A;  4YBT A;  4QYL A;  4UYH A;  4A9F A;  5CUB A;  4QBM A;  5CQT A;  5DW1 A;  4Z6I A;  5FE8 A;  3LJW A;  4N4H A;  4N4G A;  5CQ6 A;  5HM0 A;  5LJ0 A;  3LQI A;  5EPS A;  3O34 A;  5D3T A;  5E9Y A;  5DFD A;  2R10 A;  4MR4 A;  4MEO A;  2LSP B;  5CQ5 A;  5BT4 A;  4O75 A;  4A9H A;  5CP5 A;  1X0J A;  3UVW A;  5EPR A;  5HEL A;  5LJ2 A;  2I8N A;  5EPB A;  3MB4 A;  5FFV A;  4UIZ A;  5I29 A;  4TZ8 A;  5A5N A;  5EIC A;  4HBV A;  5HLS A;  5II2 A;  4KV4 A;  2DAT A;  2DKW A;  3MB3 A;  5DY7 A;  5BT3 A;  5H1V A;  2NXB A;  4YH3 A;  4PCE A;  3Q2E A;  3HMH A;  4YBM A;  3QZT A;  5LKX A;  4YY6 A;  5I88 A;  5HQ5 A;  5D3L A; 
#chains in the Genus database with same CATH topology
 2DVS A;  3TLP A;  4NYV A;  2E3K A;  3UVY A;  4QC3 A;  4LZR A;  3AAD A;  5HRV A;  5AME A;  5EWH A;  4QNS A;  5ETB A;  4HBX A;  5EWD A;  4Q0N A;  4UIV A;  5E9I A;  4RVR A;  3UV2 A;  4O77 A;  5JI8 A;  1ZS5 A;  5AMF A;  4TTE A;  3HMF A;  5E9V A;  2EJN A;  5FB0 A;  3U5K A;  5E0R A;  4BHW A;  5LVQ A;  5EWW A;  5II1 A;  4O7C A;  5FE7 A;  5I40 A;  4YYD A;  4ZC9 A;  3S92 A;  4AI6 A;  5KTX A;  3UV5 A;  4N4I A;  4HXN A;  5E74 A;  5A5S A;  5CQ4 A;  4A9O A;  4OGJ A;  2YEK A;  4O7E A;  4TS8 A;  4LR6 A;  2WP1 A;  2RS9 B;  4Y03 A;  5EU1 A;  4BJX A;  3JVL A;  5AD2 A;  1EQF A;  5TB6 A;  5HCL A;  3UVD A;  5DKH A;  5DX4 A;  1F68 A;  5CZG A;  5A83 A;  2H60 A;  5LJ1 A;  3MQM A;  5FE6 A;  4QUT A;  4MEP A;  4A9K A;  3O33 A;  4MEQ A;  5HFR A;  4HXM A;  4PCI A;  5LKU A;  4YYG A;  4YYI A;  3K2J A;  4TT2 A;  3O37 A;  4QSS A;  2E7O A;  4PS5 A;  5D3S A;  5IG6 A;  4Q0O A;  5ENJ A;  3VKH A;  5DYU A;  4LYS A;  4QZS A;  4KV1 A;  5H1U A;  4LC2 A;  2RNW A;  4HXL A;  4AKI A;  3ZYU A;  4IOQ A;  5CQ3 A;  4O7A A;  5FE5 A;  4PKL A;  5LVR A;  4QSR A;  3U5M A;  5C7N A;  5A7C A;  4CUS A;  4XUB A;  4XY8 A;  1WUG A;  5CFW A;  5E3D A;  5IGK A;  4YY4 A;  4TU4 A;  3DWY A;  3UVX A;  5A5Q A;  2N9G A;  5EWV A;  3D7C A;  5EWC A;  4GPJ A;  4C67 A;  4A9N A;  4QR5 A;  4MR6 A;  4YH4 A;  4YC9 A;  5H85 A;  5CRZ A;  5AD3 A;  2OUO A;  2FSA A;  2YW5 A;  4QST A;  5D3J A;  2OO1 A;  3JVK A;  4QSP A;  4CUU A;  4QSQ A;  4Z1Q A;  5DKC A;  5D3R A;  5I89 A;  5EP7 A;  4A9L A;  3MUL A;  2L84 A;  4NXJ A;  2E7N A;  4J0S A;  4NR5 A;  4ALH A;  4J3I A;  4TU6 A;  4IR5 A;  2KTB B;  4ZQL A;  4YYM A;  4A9I A;  4Z1S A;  4YAT A;  5L96 A;  3ONI A;  4QY4 A;  4YAX A;  5D7X A;  4PTB A;  5LKT A;  5KO4 A;  2DVV A;  5E73 A;  2F6J A;  4LYW A;  5CPE A;  5I80 A;  3JVM A;  4F3I A;  5IID A;  4YYJ A;  5L8U A;  5F61 A;  5IGL A;  5FH7 A;  4HXS A;  5D3H A;  4LDF A;  5FBX A;  1JM4 B;  4QR3 A;  5I7X A;  3NXB A;  5ETD A;  4YAB A;  4QSV A;  3U5J A;  2YDW A;  4AKN A;  5CQA A;  5C85 A;  5COI A;  4O70 A;  5G4R A;  4WIV A;  4YYH A;  5K29 A;  4E96 A;  5C87 A;  5CS8 A;  5EK9 A;  4BW4 A;  5HEM A;  3SVH A;  5FG4 A;  5DKD A;  5I7Y A;  4KCX A;  5J0D A;  4UIT A;  1JSP B;  4UYF B;  5L8T A;  3ERR A;  5CQ7 A;  5FB1 A;  3O35 A;  4CL9 A;  5DFB A;  5E9M A;  5A5R A;  4J1P A;  4Z93 A;  5C4Q A;  4IOO A;  4QYD A;  3LQH A;  2RI7 A;  3I3J A;  5HFQ A;  4NR4 A;  4CLB A;  5ENI A;  4NQN A;  3S91 A;  2YEM A;  2RFJ A;  4UIU A;  5E9K A;  5FFY A;  4PY6 A;  5EVA A;  2G4A A;  4IR4 A;  4TYL A;  3FKM X;  4QC1 A;  5EQ1 A;  3UW9 A;  5HEN A;  4HBY A;  1WUM A;  5ENB A;  4YYN A;  4QEW A;  1E6I A;  5HJC A;  2YEL A;  2D82 A;  4QEV A;  4QR4 A;  5EV9 A;  4O74 A;  2WP2 A;  5A85 A;  4CFK A;  4WHW A;  5DW2 A;  3LXJ A;  2YQD A;  5F63 A;  5CGP A;  2RO1 A;  4HXP A;  5HRX A;  5A81 A;  5ENC A;  5ENH A;  4NRC A;  5F1H A;  4QB3 A;  5F1L A;  4XY9 A;  5EM3 A;  4NYX A;  4MEN A;  5FE0 A;  5HRW A;  5A5P A;  4UYE A;  3AQA A;  4CUP A;  4UIY A;  5E3G A;  5FE4 A;  4A9J A;  2L85 A;  4YBS A;  5KHM A;  3P5O A;  5ENG A;  3SVG A;  4NUE A;  5DYA A;  5FFW A;  5I86 A;  5EIS A;  5EI4 A;  5BT5 A;  4MR5 A;  5F60 A;  5CY9 A;  4AKH A;  5F62 A;  5DYC A;  4QSX A;  5HQ7 A;  3GG3 A;  4HXR A;  5L97 A;  4TT4 A;  4UYF A;  4Z6H A;  4NQM A;  4TZ2 A;  3P1D A;  5FH6 A;  5D24 A;  3DAI A;  4LZ2 A;  5LKZ A;  3UV4 A;  4OGI A;  5JWM A;  5CQ8 A;  4TQN A;  4X2I A;  4XUA A;  4BW2 A;  5HQ6 A;  2RNY A;  2MJV B;  5C8G A;  4N4F A;  5LUU A;  4ALG A;  5A82 A;  5KTW A;  4HXK A;  3D1D A;  3LQJ A;  5L98 A;  4N3W A;  3IU5 A;  5F3A A;  5CRM A;  4YAD A;  5DLX A;  5FE1 A;  3O36 A;  4UYD A;  4NRB A;  2D9E A;  5DBM A;  3D1B A;  5FE9 A;  4O76 A;  5C89 A;  4DON A;  1PUO A;  5CUG A;  5KTU A;  4NYW A;  5I83 A;  4NUD A;  2R0S A;  3SVF A;  4NRA A;  5I1Q A;  5KU3 A;  4YYK A;  4FLP A;  4UIX A;  4J0R A;  5EGU A;  4IR6 A;  4NR8 A;  5D3N A;  3MUK A;  5DYX A;  5ENE A;  5D0C A;  3QZS A;  4O7F A;  5EA1 A;  4QUU A;  4IOR A;  4CUT A;  4CUQ A;  5D25 A;  5A5O A;  4NR7 A;  5DFC A;  4XYA A;  4OUF A;  5F25 A;  1N72 A;  5FG5 A;  5CUA A;  4LRG A;  1ZKR A;  5CU8 A;  4LZS A;  2GRC A;  2OSS A;  4HBW A;  2R0Y A;  4A9M A;  4TT6 A;  4WHU A;  3G0J A;  4HXO A;  4UYG A;  5DLZ A;  2YYN A;  4NS5 A;  2F6N A;  5FE3 A;  3HME A;  5ENF A;  3G0L A;  5G4S A;  5H1T A;  3U5N A;  3U5P A;  3IU6 A;  5E9L A;  5IBN A;  3P1E A;  4LYI A;  2I7K A;  3QZV A;  4C66 A;  4BW1 A;  4YK0 A;  5FH8 A;  5E7D A;  3Q2F A;  5ACY A;  5IGN A;  5FE2 A;  5CTL A;  4IR3 A;  3U5O A;  2L5E A;  5CUE A;  5D26 A;  2DWW A;  4UIW A;  4O71 A;  4QSW A;  4NUC A;  3JVJ A;  3P1C A;  4O78 A;  5CUD A;  4O7B A;  5IGM A;  5L99 A;  3VKG A;  4MR3 A;  4ZW1 A;  2R0V A;  4NR6 A;  4QSU A;  4O72 A;  4BW3 A;  2DVR A;  4A9E A;  4CUR A;  3U5L A;  4QEU A;  5F5Z A;  4CFL A;  5F2P A;  2RNX A;  4NR9 A;  3MXF A;  2DVQ A;  5F36 A;  5FG6 A;  3RCW A;  5D3P A;  5FDZ A;  5TCM A;  5CUC A;  3P1F A;  4YBT A;  4QYL A;  4UYH A;  4A9F A;  5CUB A;  4QBM A;  5CQT A;  5DW1 A;  4Z6I A;  5FE8 A;  3LJW A;  4N4H A;  4N4G A;  5CQ6 A;  5HM0 A;  5LJ0 A;  3LQI A;  5EPS A;  3O34 A;  5D3T A;  5E9Y A;  5DFD A;  2R10 A;  4MR4 A;  4MEO A;  2LSP B;  5CQ5 A;  5BT4 A;  4O75 A;  4A9H A;  5CP5 A;  1X0J A;  3UVW A;  5EPR A;  5HEL A;  5LJ2 A;  2I8N A;  5EPB A;  3MB4 A;  5FFV A;  4UIZ A;  4AKG A;  5I29 A;  4TZ8 A;  5A5N A;  5EIC A;  4HBV A;  5HLS A;  5II2 A;  4KV4 A;  2DAT A;  2DKW A;  3MB3 A;  5DY7 A;  5BT3 A;  5H1V A;  2NXB A;  4YH3 A;  4PCE A;  3Q2E A;  3HMH A;  4YBM A;  3QZT A;  5LKX A;  4YY6 A;  5I88 A;  5HQ5 A;  5D3L A; 
#chains in the Genus database with same CATH homology
 2DVS A;  3TLP A;  4NYV A;  2E3K A;  3UVY A;  4QC3 A;  4LZR A;  3AAD A;  5HRV A;  5AME A;  5EWH A;  4QNS A;  5ETB A;  4HBX A;  5EWD A;  4Q0N A;  4UIV A;  5E9I A;  4RVR A;  3UV2 A;  4O77 A;  5JI8 A;  1ZS5 A;  5AMF A;  4TTE A;  3HMF A;  5E9V A;  3U5K A;  5FB0 A;  5E0R A;  4BHW A;  5LVQ A;  5EWW A;  5II1 A;  4O7C A;  5FE7 A;  5I40 A;  4YYD A;  4ZC9 A;  3S92 A;  5KTX A;  3UV5 A;  4N4I A;  4HXN A;  5E74 A;  5A5S A;  5CQ4 A;  4A9O A;  4OGJ A;  2YEK A;  4O7E A;  4TS8 A;  4LR6 A;  2WP1 A;  2RS9 B;  4Y03 A;  5EU1 A;  4BJX A;  3JVL A;  5AD2 A;  1EQF A;  5TB6 A;  5HCL A;  3UVD A;  5DKH A;  5DX4 A;  1F68 A;  5CZG A;  5A83 A;  2H60 A;  5LJ1 A;  3MQM A;  5FE6 A;  4QUT A;  4MEP A;  4A9K A;  3O33 A;  4MEQ A;  5HFR A;  4HXM A;  4PCI A;  5LKU A;  4YYG A;  4YYI A;  3K2J A;  4TT2 A;  3O37 A;  4QSS A;  2E7O A;  4PS5 A;  5D3S A;  5IG6 A;  4Q0O A;  5ENJ A;  5DYU A;  4LYS A;  4QZS A;  4KV1 A;  5H1U A;  4LC2 A;  2RNW A;  4HXL A;  3ZYU A;  4IOQ A;  5CQ3 A;  4O7A A;  5FE5 A;  4PKL A;  5LVR A;  4QSR A;  3U5M A;  5C7N A;  5A7C A;  4CUS A;  4XUB A;  4XY8 A;  1WUG A;  5CFW A;  5E3D A;  5IGK A;  4YY4 A;  4TU4 A;  3DWY A;  3UVX A;  5A5Q A;  2N9G A;  5EWV A;  3D7C A;  5EWC A;  4GPJ A;  4C67 A;  4A9N A;  4QR5 A;  4MR6 A;  4YH4 A;  4YC9 A;  5H85 A;  5CRZ A;  5AD3 A;  2OUO A;  2FSA A;  2YW5 A;  4QST A;  5D3J A;  2OO1 A;  3JVK A;  4QSP A;  4CUU A;  4QSQ A;  4Z1Q A;  5DKC A;  5D3R A;  5I89 A;  5EP7 A;  4A9L A;  3MUL A;  2L84 A;  4NXJ A;  2E7N A;  4J0S A;  4NR5 A;  4ALH A;  4J3I A;  4TU6 A;  4IR5 A;  2KTB B;  4ZQL A;  4YYM A;  4A9I A;  4Z1S A;  4YAT A;  5L96 A;  3ONI A;  4QY4 A;  4YAX A;  5D7X A;  4PTB A;  5LKT A;  5KO4 A;  2DVV A;  5E73 A;  2F6J A;  4LYW A;  5CPE A;  5I80 A;  3JVM A;  4F3I A;  5IID A;  4YYJ A;  5L8U A;  5F61 A;  5IGL A;  5FH7 A;  4HXS A;  5D3H A;  4LDF A;  5FBX A;  1JM4 B;  4QR3 A;  5I7X A;  3NXB A;  5ETD A;  4YAB A;  4QSV A;  3U5J A;  2YDW A;  4AKN A;  5CQA A;  5C85 A;  5COI A;  4O70 A;  5G4R A;  4WIV A;  4YYH A;  5K29 A;  4E96 A;  5C87 A;  5CS8 A;  5EK9 A;  4BW4 A;  5HEM A;  3SVH A;  5FG4 A;  5DKD A;  5I7Y A;  4KCX A;  5J0D A;  4UIT A;  1JSP B;  4UYF B;  5L8T A;  5CQ7 A;  5FB1 A;  3O35 A;  4CL9 A;  5DFB A;  5E9M A;  5A5R A;  4Z93 A;  4J1P A;  5C4Q A;  4IOO A;  4QYD A;  3LQH A;  2RI7 A;  3I3J A;  5HFQ A;  4NR4 A;  4CLB A;  5ENI A;  4NQN A;  3S91 A;  2YEM A;  2RFJ A;  4UIU A;  5E9K A;  5FFY A;  4PY6 A;  5EVA A;  2G4A A;  4IR4 A;  4TYL A;  3FKM X;  4QC1 A;  5EQ1 A;  3UW9 A;  5HEN A;  4HBY A;  1WUM A;  5ENB A;  4YYN A;  4QEW A;  1E6I A;  5HJC A;  2YEL A;  2D82 A;  4QEV A;  4QR4 A;  5EV9 A;  4O74 A;  2WP2 A;  5A85 A;  4CFK A;  4WHW A;  5DW2 A;  3LXJ A;  2YQD A;  5F63 A;  5CGP A;  2RO1 A;  4HXP A;  5HRX A;  5A81 A;  5ENC A;  5ENH A;  4NRC A;  5F1H A;  4QB3 A;  5F1L A;  4XY9 A;  5EM3 A;  4NYX A;  4MEN A;  5FE0 A;  5HRW A;  5A5P A;  4UYE A;  3AQA A;  4CUP A;  4UIY A;  5E3G A;  5FE4 A;  4A9J A;  2L85 A;  4YBS A;  5KHM A;  3P5O A;  5ENG A;  3SVG A;  4NUE A;  5DYA A;  5FFW A;  5I86 A;  5EIS A;  5EI4 A;  5BT5 A;  4MR5 A;  5F60 A;  5CY9 A;  5F62 A;  5DYC A;  4QSX A;  5HQ7 A;  3GG3 A;  4HXR A;  5L97 A;  4TT4 A;  4UYF A;  4Z6H A;  4NQM A;  4TZ2 A;  3P1D A;  5FH6 A;  5D24 A;  3DAI A;  4LZ2 A;  5LKZ A;  3UV4 A;  4OGI A;  5JWM A;  5CQ8 A;  4TQN A;  4X2I A;  4XUA A;  4BW2 A;  5HQ6 A;  2RNY A;  2MJV B;  5C8G A;  4N4F A;  5LUU A;  4ALG A;  5A82 A;  5KTW A;  4HXK A;  3LQJ A;  5L98 A;  4N3W A;  3IU5 A;  5F3A A;  5CRM A;  4YAD A;  5DLX A;  5FE1 A;  3O36 A;  4UYD A;  4NRB A;  2D9E A;  5DBM A;  5FE9 A;  4O76 A;  5C89 A;  4DON A;  5CUG A;  5KTU A;  4NYW A;  5I83 A;  4NUD A;  2R0S A;  3SVF A;  4NRA A;  5I1Q A;  5KU3 A;  4YYK A;  4FLP A;  4UIX A;  4J0R A;  5EGU A;  4IR6 A;  4NR8 A;  5D3N A;  3MUK A;  5DYX A;  5ENE A;  5D0C A;  3QZS A;  4O7F A;  5EA1 A;  4QUU A;  4IOR A;  4CUT A;  4CUQ A;  5D25 A;  5A5O A;  4NR7 A;  5DFC A;  4XYA A;  4OUF A;  5F25 A;  1N72 A;  5FG5 A;  5CUA A;  4LRG A;  5CU8 A;  4LZS A;  2GRC A;  2OSS A;  4HBW A;  2R0Y A;  4A9M A;  4TT6 A;  4WHU A;  3G0J A;  4HXO A;  4UYG A;  5DLZ A;  2YYN A;  4NS5 A;  2F6N A;  5FE3 A;  3HME A;  5ENF A;  3G0L A;  5G4S A;  5H1T A;  3U5N A;  3U5P A;  3IU6 A;  5E9L A;  5IBN A;  3P1E A;  4LYI A;  2I7K A;  3QZV A;  4C66 A;  4BW1 A;  4YK0 A;  5FH8 A;  5E7D A;  3Q2F A;  5ACY A;  5IGN A;  5FE2 A;  5CTL A;  4IR3 A;  3U5O A;  2L5E A;  5CUE A;  5D26 A;  2DWW A;  4UIW A;  4O71 A;  4QSW A;  4NUC A;  3JVJ A;  3P1C A;  4O78 A;  5CUD A;  4O7B A;  5IGM A;  5L99 A;  4MR3 A;  4ZW1 A;  2R0V A;  4NR6 A;  4QSU A;  4O72 A;  4BW3 A;  2DVR A;  4A9E A;  4CUR A;  3U5L A;  4QEU A;  5F5Z A;  4CFL A;  5F2P A;  2RNX A;  4NR9 A;  3MXF A;  2DVQ A;  5F36 A;  5FG6 A;  3RCW A;  5D3P A;  5FDZ A;  5TCM A;  5CUC A;  3P1F A;  4YBT A;  4QYL A;  4UYH A;  4A9F A;  5CUB A;  4QBM A;  5CQT A;  5DW1 A;  4Z6I A;  5FE8 A;  3LJW A;  4N4H A;  4N4G A;  5CQ6 A;  5HM0 A;  5LJ0 A;  3LQI A;  5EPS A;  3O34 A;  5D3T A;  5E9Y A;  5DFD A;  2R10 A;  4MR4 A;  4MEO A;  2LSP B;  5CQ5 A;  5BT4 A;  4O75 A;  4A9H A;  5CP5 A;  1X0J A;  3UVW A;  5EPR A;  5HEL A;  5LJ2 A;  2I8N A;  5EPB A;  3MB4 A;  5FFV A;  4UIZ A;  5I29 A;  4TZ8 A;  5A5N A;  5EIC A;  4HBV A;  5HLS A;  5II2 A;  4KV4 A;  2DAT A;  2DKW A;  3MB3 A;  5DY7 A;  5BT3 A;  5H1V A;  2NXB A;  4YH3 A;  4PCE A;  3Q2E A;  3HMH A;  4YBM A;  3QZT A;  5LKX A;  4YY6 A;  5I88 A;  5HQ5 A;  5D3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...