5AMFA

Crystal structure of the bromodomain of human surface epitope engineered brd1a in complex with 3d consortium fragment ethyl 4,5,6,7- tetrahydro-1h-indazole-5-carboxylate (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
121
structure length
121
Chain Sequence
SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histone-binding protein
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 1
publication title Crystal Structure of the Bromodomain of Human Surface Epitope Engineered Brd1A in Complex with 3D Consortium Fragment Ethyl 4,5,6,7-Tetrahydro-1H-Indazole-5-Carboxylate
rcsb
source organism Homo sapiens
total genus 45
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5amfA00
5KTUA 5EICA 5EVAA 4IR5A 5I40A 5FFWA 5E9MA 5D3LA 5ENEA 5H1UA 3MQMA 5CQ5A 3G0LA 4QSQA 5CP5A 4J1PA 5F36A 3GG3A 4MENA 4WHWA 5ACYA 5HJCA 4C66A 5FE2A 4E96A 5LJ0A 5EGUA 4QSUA 5IGMA 4QSXA 4IR3A 5DLZA 3S92A 4TU4A 5II1A 5CQ8A 2WP2A 5CGPA 4CUTA 5I7XA 4QSTA 2DKWA 5DW1A 3IU5A 5E9VA 5F5ZA 4HXPA 3P1EA 5II2A 4KV4A 5CQ4A 5L8TA 5A85A 5FB1A 4CFLA 5DKHA 2RS9B 4QSWA 5E3DA 4UYHA 5ENGA 4MEOA 3U5PA 3O37A 4A9OA 4YYKA 4RVRA 2L85A 4KV1A 4QR4A 5ENJA 4YBTA 2R10A 4HXOA 5FG5A 5D26A 5HQ5A 4Z6HA 1X0JA 5DLXA 5IBNA 5A5NA 5C89A 4QEWA 5LKXA 4LRGA 4LC2A 4MR4A 4N3WA 5FG4A 5LKTA 4O7BA 4HXMA 3MUKA 4O75A 5EI4A 5EWDA 4QSRA 5H1VA 3UV5A 4QR5A 4QC1A 5F3AA 5CQ3A 5DBMA 2N9GA 4YYGA 5CS8A 5J0DA 4A9IA 5D3TA 5D25A 4YYMA 5EQ1A 1EQFA 4QSPA 5HFRA 5CZGA 5LUUA 4FLPA 4NR8A 5I29A 3UVYA 3QZTA 2YYNA 5CUEA 5JWMA 4QYDA 4XUAA 4NQMA 5CY9A 3LXJA 4A9EA 5C4QA 1JM4B 4CL9A 4XY9A 5CFWA 5D7XA 3G0JA 5HRWA 3AQAA 2RFJA 3P1FA 5EWVA 5KHMA 2RNWA 5HEMA 3U5NA 1WUGA 5HRXA 5CQ7A 5DYUA 4HBWA 2OSSA 4DONA 5E9YA 5FE9A 4J0SA 4BHWA 4UYDA 4YYHA 3TLPA 5FFYA 4NQNA 4CURA 4YYNA 3SVHA 4HBXA 4TU6A 4PS5A 4TZ2A 5HFQA 4A9FA 5CRMA 5C87A 4HXNA 2H60A 5DW2A 4NR7A 4J0RA 4Q0NA 2I8NA 4PTBA 5A5PA 5C85A 4UIUA 4NYXA 4UYEA 4TYLA 3QZVA 4UYFA 5L98A 3U5MA 2DVRA 4KCXA 5DYXA 5I1QA 3JVLA 5F63A 4TT6A 4YYIA 5AMFA 5FH7A 5DYAA 2R0YA 4MEQA 5CUDA 5D3RA 5E74A 4WHUA 5A5RA 3ONIA 4OUFA 4BW4A 4LYSA 4NR9A 4NYVA 5IGKA 4UIZA 5LKUA 4MR5A 4O7FA 3MB3A 5A82A 3Q2FA 4QEUA 5L99A 4QR3A 4TT4A 2OUOA 4TTEA 3UVXA 5EPBA 5DX4A 4NR4A 2F6NA 4LZSA 4QBMA 4Z6IA 5HRVA 5CTLA 5FE5A 2D9EA 2F6JA 3LJWA 4Z93A 4YABA 2YQDA 4IOQA 5CUCA 5HENA 5KO4A 4XY8A 5EWCA 5CUGA 4Z1SA 4O77A 4N4HA 5FE8A 1JSPB 4A9HA 3P1CA 3ZYUA 5A7CA 5I7YA 2YDWA 3JVMA 3LQJA 4O7AA 5LVQA 5ENCA 4O7EA 5AMEA 5I86A 3U5OA 5IGNA 4NR5A 5EV9A 4C67A 4BW3A 5ETBA 4IR6A 4HBVA 4XUBA 5ENHA 3U5KA 5F25A 2R0VA 2RI7A 5DFCA 4Z1QA 4BW1A 5E9IA 5HCLA 2G4AA 4N4GA 5HELA 4CFKA 5D3SA 5FE0A 5L8UA 4HBYA 4LDFA 2NXBA 1WUMA 3UW9A 3HMHA 5I88A 4YH3A 4LR6A 4A9JA 5HQ6A 2DVVA 5EU1A 1ZS5A 5DFBA 4QUUA 4MR6A 2DVQA 4CUUA 3SVFA 4UYFB 3K2JA 2L84A 4CLBA 3D7CA 4X2IA 3LQIA 4O7CA 5AD2A 4LZ2A 5KTWA 4YY6A 4YAXA 5DY7A 3JVJA 4MR3A 4QSSA 3UVWA 5D0CA 5E9LA 4A9MA 3O34A 3DWYA 4LYIA 3O36A 3NXBA 5ENIA 4QUTA 4XYAA 5HQ7A 3HMEA 2LSPB 4NUCA 1E6IA 4TS8A 5F62A 2GRCA 5BT4A 4YADA 4QNSA 4YC9A 3S91A 4HXLA 4A9NA 4CUQA 4HXKA 2YEMA 2L5EA 2MJVB 5A81A 4MEPA 5COIA 5A5SA 5IG6A 5CRZA 5E73A 4YBMA 5HLSA 4PCIA 4IR4A 5CQ6A 4F3IA 4QYLA 5D3JA 3O33A 3UV2A 4NRBA 3MXFA 5EWHA 5D3NA 4OGIA 4O71A 4UIWA 5G4SA 2RNYA 5F1LA 5E9KA 5D3HA 5EPRA 3U5JA 5A5QA 3RCWA 4UIYA 4UITA 5C8GA 4YK0A 4PKLA 4BJXA 4NRAA 5FE3A 5ENBA 5G4RA 3MULA 5DYCA 5TB6A 4Q0OA 5L97A 5CUAA 5FBXA 3P1DA 4O78A 4NXJA 4N4FA 4A9LA 5E3GA 4LYWA 5EM3A 2R0SA 5JI8A 3UVDA 4CUPA 5CPEA 5CQAA 5A83A 3UV4A 2DVSA 4NR6A 5D24A 5LKZA 5AD3A 4UIXA 5EISA 4IORA 4ZQLA 5EWWA 1F68A 4Y03A 5DKDA 4PY6A 3Q2EA 5LJ1A 4J3IA 4YY4A 2RNXA 2DATA 5H85A 4TT2A 4NYWA 4PCEA 4QZSA 4YH4A 3SVGA 4GPJA 4YYDA 2OO1A 5LJ2A 5HM0A 5EA1A 5TCMA 2E3KA 2WP1A 4TZ8A 2YEKA 5FFVA 3LQHA 4LZRA 4HXRA 5A5OA 4QC3A 4NRCA 5ENFA 5I83A 5FG6A 2YELA 3AADA 5EPSA 5I89A 5EK9A 2D82A 5E0RA 2RO1A 5KTXA 4ALHA 5F61A 2FSAA 2KTBB 2DWWA 4UYGA 5D3PA 4UIVA 5FE4A 4CUSA 5FDZA 3QZSA 5FE7A 4AKNA 4QEVA 4IOOA 5IGLA 5C7NA 5FE1A 5I80A 4N4IA 4QY4A 4QSVA 3DAIA 5F2PA 5KU3A 4WIVA 4NUDA 3U5LA 3P5OA 5BT5A 4TQNA 3I3JA 5E7DA 5LVRA 4YBSA 4ALGA 5BT3A 2E7NA 4A9KA 4O70A 3O35A 5DKCA 5K29A 3JVKA 3MB4A 5CUBA 4YATA 3IU6A 5F1HA 4ZW1A 4HXSA 4ZC9A 5FB0A 4O74A 4YYJA 5H1TA 5EP7A 5CU8A 3FKMX 4O72A 5ETDA 4QB3A 2E7OA 5L96A 2I7KA 5IIDA 2YW5A 3HMFA 5FH8A 4NUEA 5CQTA 5F60A 4OGJA 4BW2A 1N72A 5FE6A 4O76A 4NS5A 5DFDA 5FH6A
chains in the Genus database with same CATH superfamily
5KTUA 5EICA 5EVAA 4IR5A 5I40A 5FFWA 5E9MA 5D3LA 5ENEA 5H1UA 3MQMA 5CQ5A 3G0LA 4QSQA 5CP5A 4J1PA 5F36A 3GG3A 4MENA 4WHWA 5ACYA 5HJCA 4C66A 5FE2A 4E96A 5LJ0A 5EGUA 4QSUA 5IGMA 4QSXA 4IR3A 5DLZA 3S92A 4TU4A 5II1A 5CQ8A 2WP2A 5CGPA 4CUTA 5I7XA 4QSTA 2DKWA 5DW1A 3IU5A 5E9VA 5F5ZA 4HXPA 3P1EA 5II2A 4KV4A 5CQ4A 5L8TA 5A85A 5FB1A 4CFLA 5DKHA 3ERRA 2RS9B 4QSWA 5E3DA 4UYHA 5ENGA 4MEOA 3U5PA 3O37A 4A9OA 4YYKA 4RVRA 2L85A 4KV1A 4QR4A 5ENJA 4YBTA 2R10A 4HXOA 5FG5A 5D26A 5HQ5A 4Z6HA 1X0JA 5DLXA 5IBNA 5A5NA 5C89A 4QEWA 5LKXA 4LRGA 4LC2A 4MR4A 4N3WA 5FG4A 5LKTA 4O7BA 4HXMA 3MUKA 4O75A 5EI4A 5EWDA 4QSRA 5H1VA 3UV5A 4QR5A 4QC1A 5F3AA 5CQ3A 5DBMA 2N9GA 4YYGA 5CS8A 5J0DA 4A9IA 5D3TA 5D25A 4YYMA 5EQ1A 1EQFA 4QSPA 5HFRA 5CZGA 5LUUA 4FLPA 4NR8A 5I29A 3UVYA 3QZTA 2YYNA 5CUEA 5JWMA 4QYDA 4XUAA 4NQMA 5CY9A 3LXJA 4A9EA 5C4QA 1JM4B 4CL9A 4XY9A 5CFWA 5D7XA 3G0JA 5HRWA 3AQAA 2RFJA 3P1FA 5EWVA 5KHMA 2RNWA 5HEMA 3U5NA 1WUGA 5HRXA 5CQ7A 5DYUA 4HBWA 2OSSA 4DONA 5E9YA 5FE9A 4J0SA 4BHWA 4UYDA 4AKHA 4YYHA 2EJNA 3TLPA 5FFYA 4NQNA 4CURA 4YYNA 3SVHA 4HBXA 4TU6A 4PS5A 4TZ2A 5HFQA 4A9FA 5CRMA 5C87A 4HXNA 2H60A 5DW2A 4NR7A 4J0RA 4Q0NA 2I8NA 4PTBA 5A5PA 5C85A 4UIUA 4NYXA 4UYEA 4TYLA 3QZVA 4UYFA 5L98A 3U5MA 2DVRA 4KCXA 5DYXA 5I1QA 3JVLA 5F63A 4TT6A 4YYIA 5AMFA 5FH7A 5DYAA 1ZKRA 2R0YA 4MEQA 5CUDA 5D3RA 5E74A 4WHUA 5A5RA 3ONIA 4OUFA 4BW4A 4LYSA 4NR9A 4NYVA 5IGKA 4UIZA 5LKUA 4MR5A 4O7FA 3MB3A 5A82A 3Q2FA 4QEUA 5L99A 4QR3A 4TT4A 2OUOA 4TTEA 3UVXA 5EPBA 5DX4A 4NR4A 2F6NA 4LZSA 4QBMA 4Z6IA 5HRVA 5CTLA 5FE5A 2D9EA 2F6JA 3LJWA 4Z93A 4YABA 2YQDA 4IOQA 5CUCA 5HENA 5KO4A 4XY8A 5EWCA 5CUGA 4Z1SA 4O77A 4N4HA 5FE8A 1JSPB 4A9HA 3P1CA 3ZYUA 5A7CA 5I7YA 2YDWA 3JVMA 3LQJA 4O7AA 5LVQA 5ENCA 4O7EA 5AMEA 5I86A 3U5OA 5IGNA 4NR5A 5EV9A 4C67A 4BW3A 5ETBA 4IR6A 4HBVA 4XUBA 5ENHA 3U5KA 3VKGA 5F25A 2R0VA 2RI7A 5DFCA 4Z1QA 4BW1A 5E9IA 5HCLA 2G4AA 4N4GA 5HELA 4CFKA 5D3SA 5FE0A 5L8UA 4HBYA 4LDFA 2NXBA 1WUMA 3UW9A 3HMHA 5I88A 4YH3A 3VKHA 4LR6A 4A9JA 5HQ6A 2DVVA 5EU1A 1ZS5A 5DFBA 4QUUA 4MR6A 2DVQA 4CUUA 3SVFA 4UYFB 3K2JA 2L84A 4CLBA 3D7CA 4X2IA 3LQIA 4O7CA 5AD2A 4LZ2A 5KTWA 3D1DA 4YY6A 4YAXA 5DY7A 3JVJA 4MR3A 4QSSA 3UVWA 5D0CA 5E9LA 4A9MA 3O34A 3DWYA 4LYIA 3O36A 3NXBA 5ENIA 4QUTA 4XYAA 5HQ7A 3HMEA 2LSPB 4NUCA 1E6IA 4TS8A 5F62A 2GRCA 5BT4A 4YADA 4QNSA 4YC9A 3S91A 4HXLA 4A9NA 4CUQA 4HXKA 2YEMA 2L5EA 2MJVB 5A81A 4MEPA 5COIA 5A5SA 5IG6A 5CRZA 5E73A 4YBMA 5HLSA 4PCIA 4IR4A 5CQ6A 4F3IA 4QYLA 5D3JA 3O33A 3UV2A 4NRBA 4AI6A 3MXFA 5EWHA 5D3NA 4OGIA 4O71A 4UIWA 5G4SA 2RNYA 5F1LA 5E9KA 5D3HA 5EPRA 3U5JA 5A5QA 3RCWA 4UIYA 3D1BA 4UITA 5C8GA 4YK0A 4PKLA 4BJXA 4NRAA 5FE3A 5ENBA 5G4RA 3MULA 5DYCA 5TB6A 4Q0OA 5L97A 5CUAA 5FBXA 3P1DA 4O78A 4NXJA 4N4FA 4A9LA 5E3GA 4LYWA 5EM3A 2R0SA 5JI8A 3UVDA 4CUPA 5CPEA 5CQAA 5A83A 3UV4A 2DVSA 4NR6A 5D24A 5LKZA 4AKGA 5AD3A 4UIXA 5EISA 4IORA 4ZQLA 5EWWA 1F68A 4Y03A 5DKDA 4PY6A 3Q2EA 5LJ1A 4J3IA 4YY4A 2RNXA 2DATA 5H85A 4TT2A 4NYWA 4PCEA 4QZSA 4YH4A 3SVGA 4GPJA 4YYDA 2OO1A 5LJ2A 5HM0A 5EA1A 5TCMA 2E3KA 2WP1A 4TZ8A 2YEKA 5FFVA 3LQHA 4LZRA 4HXRA 5A5OA 4QC3A 4NRCA 5ENFA 5I83A 5FG6A 2YELA 3AADA 5EPSA 5I89A 5EK9A 2D82A 5E0RA 2RO1A 5KTXA 4ALHA 5F61A 2FSAA 2KTBB 2DWWA 4UYGA 5D3PA 4UIVA 5FE4A 4CUSA 5FDZA 3QZSA 5FE7A 4AKNA 4QEVA 4IOOA 5IGLA 5C7NA 5FE1A 5I80A 4N4IA 4QY4A 4QSVA 3DAIA 5F2PA 5KU3A 4WIVA 4NUDA 3U5LA 3P5OA 5BT5A 4TQNA 3I3JA 5E7DA 5LVRA 4AKIA 4YBSA 4ALGA 5BT3A 2E7NA 4A9KA 4O70A 3O35A 5DKCA 5K29A 3JVKA 3MB4A 5CUBA 4YATA 3IU6A 5F1HA 4ZW1A 4HXSA 4ZC9A 5FB0A 4O74A 4YYJA 5H1TA 5EP7A 5CU8A 3FKMX 4O72A 5ETDA 4QB3A 2E7OA 5L96A 2I7KA 5IIDA 2YW5A 3HMFA 5FH8A 4NUEA 1PUOA 5CQTA 5F60A 4OGJA 4BW2A 1N72A 5FE6A 4O76A 4NS5A 5DFDA 5FH6A
chains in the Genus database with same CATH topology
5KTUA 5EICA 5EVAA 4IR5A 5I40A 5FFWA 5E9MA 5D3LA 5ENEA 5H1UA 3MQMA 5CQ5A 3G0LA 4QSQA 5CP5A 4J1PA 5F36A 3GG3A 4MENA 4WHWA 5ACYA 5HJCA 4C66A 5FE2A 4E96A 5LJ0A 5EGUA 4QSUA 5IGMA 4QSXA 4IR3A 5DLZA 3S92A 4TU4A 5II1A 5CQ8A 2WP2A 5CGPA 4CUTA 5I7XA 4QSTA 2DKWA 5DW1A 3IU5A 5E9VA 5F5ZA 4HXPA 3P1EA 5II2A 4KV4A 5CQ4A 5L8TA 5A85A 5FB1A 4CFLA 5DKHA 2RS9B 4QSWA 5E3DA 4UYHA 5ENGA 4MEOA 3U5PA 3O37A 4A9OA 4YYKA 4RVRA 2L85A 4KV1A 4QR4A 5ENJA 4YBTA 2R10A 4HXOA 5FG5A 5D26A 5HQ5A 4Z6HA 1X0JA 5DLXA 5IBNA 5A5NA 5C89A 4QEWA 5LKXA 4LRGA 4LC2A 4MR4A 4N3WA 5FG4A 5LKTA 4O7BA 4HXMA 3MUKA 4O75A 5EI4A 5EWDA 4QSRA 5H1VA 3UV5A 4QR5A 4QC1A 5F3AA 5CQ3A 5DBMA 2N9GA 4YYGA 5CS8A 5J0DA 4A9IA 5D3TA 5D25A 4YYMA 5EQ1A 1EQFA 4QSPA 5HFRA 5CZGA 5LUUA 4FLPA 4NR8A 5I29A 3UVYA 3QZTA 2YYNA 5CUEA 5JWMA 4QYDA 4XUAA 4NQMA 5CY9A 3LXJA 4A9EA 5C4QA 1JM4B 4CL9A 4XY9A 5CFWA 5D7XA 3G0JA 5HRWA 3AQAA 2RFJA 3P1FA 5EWVA 5KHMA 2RNWA 5HEMA 3U5NA 1WUGA 5HRXA 5CQ7A 5DYUA 4HBWA 2OSSA 4DONA 5E9YA 5FE9A 4J0SA 4BHWA 4UYDA 4YYHA 3TLPA 5FFYA 4NQNA 4CURA 4YYNA 3SVHA 4HBXA 4TU6A 4PS5A 4TZ2A 5HFQA 4A9FA 5CRMA 5C87A 4HXNA 2H60A 5DW2A 4NR7A 4J0RA 4Q0NA 2I8NA 4PTBA 5A5PA 5C85A 4UIUA 4NYXA 4UYEA 4TYLA 3QZVA 4UYFA 5L98A 3U5MA 2DVRA 4KCXA 5DYXA 5I1QA 3JVLA 5F63A 4TT6A 4YYIA 5AMFA 5FH7A 5DYAA 2R0YA 4MEQA 5CUDA 5D3RA 5E74A 4WHUA 5A5RA 3ONIA 4OUFA 4BW4A 4LYSA 4NR9A 4NYVA 5IGKA 4UIZA 5LKUA 4MR5A 4O7FA 3MB3A 5A82A 3Q2FA 4QEUA 5L99A 4QR3A 4TT4A 2OUOA 4TTEA 3UVXA 5EPBA 5DX4A 4NR4A 2F6NA 4LZSA 4QBMA 4Z6IA 5HRVA 5CTLA 5FE5A 2D9EA 2F6JA 3LJWA 4Z93A 4YABA 2YQDA 4IOQA 5CUCA 5HENA 5KO4A 4XY8A 5EWCA 5CUGA 4Z1SA 4O77A 4N4HA 5FE8A 1JSPB 4A9HA 3P1CA 3ZYUA 5A7CA 5I7YA 2YDWA 3JVMA 3LQJA 4O7AA 5LVQA 5ENCA 4O7EA 5AMEA 5I86A 3U5OA 5IGNA 4NR5A 5EV9A 4C67A 4BW3A 5ETBA 4IR6A 4HBVA 4XUBA 5ENHA 3U5KA 5F25A 2R0VA 2RI7A 5DFCA 4Z1QA 4BW1A 5E9IA 5HCLA 2G4AA 4N4GA 5HELA 4CFKA 5D3SA 5FE0A 5L8UA 4HBYA 4LDFA 2NXBA 1WUMA 3UW9A 3HMHA 5I88A 4YH3A 4LR6A 4A9JA 5HQ6A 2DVVA 5EU1A 1ZS5A 5DFBA 4QUUA 4MR6A 2DVQA 4CUUA 3SVFA 4UYFB 3K2JA 2L84A 4CLBA 3D7CA 4X2IA 3LQIA 4O7CA 5AD2A 4LZ2A 5KTWA 4YY6A 4YAXA 5DY7A 3JVJA 4MR3A 4QSSA 3UVWA 5D0CA 5E9LA 4A9MA 3O34A 3DWYA 4LYIA 3O36A 3NXBA 5ENIA 4QUTA 4XYAA 5HQ7A 3HMEA 2LSPB 4NUCA 1E6IA 4TS8A 5F62A 2GRCA 5BT4A 4YADA 4QNSA 4YC9A 3S91A 4HXLA 4A9NA 4CUQA 4HXKA 2YEMA 2L5EA 2MJVB 5A81A 4MEPA 5COIA 5A5SA 5IG6A 5CRZA 5E73A 4YBMA 5HLSA 4PCIA 4IR4A 5CQ6A 4F3IA 4QYLA 5D3JA 3O33A 3UV2A 4NRBA 3MXFA 5EWHA 5D3NA 4OGIA 4O71A 4UIWA 5G4SA 2RNYA 5F1LA 5E9KA 5D3HA 5EPRA 3U5JA 5A5QA 3RCWA 4UIYA 4UITA 5C8GA 4YK0A 4PKLA 4BJXA 4NRAA 5FE3A 5ENBA 5G4RA 3MULA 5DYCA 5TB6A 4Q0OA 5L97A 5CUAA 5FBXA 3P1DA 4O78A 4NXJA 4N4FA 4A9LA 5E3GA 4LYWA 5EM3A 2R0SA 5JI8A 3UVDA 4CUPA 5CPEA 5CQAA 5A83A 3UV4A 2DVSA 4NR6A 5D24A 5LKZA 5AD3A 4UIXA 5EISA 4IORA 4ZQLA 5EWWA 1F68A 4Y03A 5DKDA 4PY6A 3Q2EA 5LJ1A 4J3IA 4YY4A 2RNXA 2DATA 5H85A 4TT2A 4NYWA 4PCEA 4QZSA 4YH4A 3SVGA 4GPJA 4YYDA 2OO1A 5LJ2A 5HM0A 5EA1A 5TCMA 2E3KA 2WP1A 4TZ8A 2YEKA 5FFVA 3LQHA 4LZRA 4HXRA 5A5OA 4QC3A 4NRCA 5ENFA 5I83A 5FG6A 2YELA 3AADA 5EPSA 5I89A 5EK9A 2D82A 5E0RA 2RO1A 5KTXA 4ALHA 5F61A 2FSAA 2KTBB 2DWWA 4UYGA 5D3PA 4UIVA 5FE4A 4CUSA 5FDZA 3QZSA 5FE7A 4AKNA 4QEVA 4IOOA 5IGLA 5C7NA 5FE1A 5I80A 4N4IA 4QY4A 4QSVA 3DAIA 5F2PA 5KU3A 4WIVA 4NUDA 3U5LA 3P5OA 5BT5A 4TQNA 3I3JA 5E7DA 5LVRA 4YBSA 4ALGA 5BT3A 2E7NA 4A9KA 4O70A 3O35A 5DKCA 5K29A 3JVKA 3MB4A 5CUBA 4YATA 3IU6A 5F1HA 4ZW1A 4HXSA 4ZC9A 5FB0A 4O74A 4YYJA 5H1TA 5EP7A 5CU8A 3FKMX 4O72A 5ETDA 4QB3A 2E7OA 5L96A 2I7KA 5IIDA 2YW5A 3HMFA 5FH8A 4NUEA 5CQTA 5F60A 4OGJA 4BW2A 1N72A 5FE6A 4O76A 4NS5A 5DFDA 5FH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTU A;  5EIC A;  5EVA A;  4IR5 A;  5I40 A;  5FFW A;  5E9M A;  5D3L A;  5ENE A;  5H1U A;  3MQM A;  5CQ5 A;  3G0L A;  4QSQ A;  5CP5 A;  4J1P A;  5F36 A;  3GG3 A;  4MEN A;  4WHW A;  5ACY A;  5HJC A;  4C66 A;  5FE2 A;  4E96 A;  5LJ0 A;  5EGU A;  4QSU A;  5IGM A;  4QSX A;  4IR3 A;  5DLZ A;  3S92 A;  4TU4 A;  5II1 A;  5CQ8 A;  2WP2 A;  5CGP A;  4CUT A;  5I7X A;  4QST A;  2DKW A;  5DW1 A;  3IU5 A;  5E9V A;  5F5Z A;  4HXP A;  3P1E A;  5II2 A;  4KV4 A;  5CQ4 A;  5L8T A;  5A85 A;  5FB1 A;  4CFL A;  5DKH A;  2RS9 B;  4QSW A;  5E3D A;  4UYH A;  5ENG A;  4MEO A;  3U5P A;  3O37 A;  4A9O A;  4YYK A;  4RVR A;  2L85 A;  4KV1 A;  4QR4 A;  5ENJ A;  4YBT A;  2R10 A;  4HXO A;  5FG5 A;  5D26 A;  5HQ5 A;  4Z6H A;  1X0J A;  5DLX A;  5IBN A;  5A5N A;  5C89 A;  4QEW A;  5LKX A;  4LRG A;  4LC2 A;  4MR4 A;  4N3W A;  5FG4 A;  5LKT A;  4O7B A;  4HXM A;  3MUK A;  4O75 A;  5EI4 A;  5EWD A;  4QSR A;  5H1V A;  3UV5 A;  4QR5 A;  4QC1 A;  5F3A A;  5CQ3 A;  5DBM A;  2N9G A;  4YYG A;  5CS8 A;  5J0D A;  4A9I A;  5D3T A;  5D25 A;  4YYM A;  5EQ1 A;  1EQF A;  4QSP A;  5HFR A;  5CZG A;  5LUU A;  4FLP A;  4NR8 A;  5I29 A;  3UVY A;  3QZT A;  2YYN A;  5CUE A;  5JWM A;  4QYD A;  4XUA A;  4NQM A;  5CY9 A;  3LXJ A;  4A9E A;  5C4Q A;  1JM4 B;  4CL9 A;  4XY9 A;  5CFW A;  5D7X A;  3G0J A;  5HRW A;  3AQA A;  2RFJ A;  3P1F A;  5EWV A;  5KHM A;  2RNW A;  5HEM A;  3U5N A;  1WUG A;  5HRX A;  5CQ7 A;  5DYU A;  4HBW A;  2OSS A;  4DON A;  5E9Y A;  5FE9 A;  4J0S A;  4BHW A;  4UYD A;  4YYH A;  3TLP A;  5FFY A;  4NQN A;  4CUR A;  4YYN A;  3SVH A;  4HBX A;  4TU6 A;  4PS5 A;  4TZ2 A;  5HFQ A;  4A9F A;  5CRM A;  5C87 A;  4HXN A;  2H60 A;  5DW2 A;  4NR7 A;  4J0R A;  4Q0N A;  2I8N A;  4PTB A;  5A5P A;  5C85 A;  4UIU A;  4NYX A;  4UYE A;  4TYL A;  3QZV A;  4UYF A;  5L98 A;  3U5M A;  2DVR A;  4KCX A;  5DYX A;  5I1Q A;  3JVL A;  5F63 A;  4TT6 A;  4YYI A;  5AMF A;  5FH7 A;  5DYA A;  2R0Y A;  4MEQ A;  5CUD A;  5D3R A;  5E74 A;  4WHU A;  5A5R A;  3ONI A;  4OUF A;  4BW4 A;  4LYS A;  4NR9 A;  4NYV A;  5IGK A;  4UIZ A;  5LKU A;  4MR5 A;  4O7F A;  3MB3 A;  5A82 A;  3Q2F A;  4QEU A;  5L99 A;  4QR3 A;  4TT4 A;  2OUO A;  4TTE A;  3UVX A;  5EPB A;  5DX4 A;  4NR4 A;  2F6N A;  4LZS A;  4QBM A;  4Z6I A;  5HRV A;  5CTL A;  5FE5 A;  2D9E A;  2F6J A;  3LJW A;  4Z93 A;  4YAB A;  2YQD A;  4IOQ A;  5CUC A;  5HEN A;  5KO4 A;  4XY8 A;  5EWC A;  5CUG A;  4Z1S A;  4O77 A;  4N4H A;  5FE8 A;  1JSP B;  4A9H A;  3P1C A;  3ZYU A;  5A7C A;  5I7Y A;  2YDW A;  3JVM A;  3LQJ A;  4O7A A;  5LVQ A;  5ENC A;  4O7E A;  5AME A;  5I86 A;  3U5O A;  5IGN A;  4NR5 A;  5EV9 A;  4C67 A;  4BW3 A;  5ETB A;  4IR6 A;  4HBV A;  4XUB A;  5ENH A;  3U5K A;  5F25 A;  2R0V A;  2RI7 A;  5DFC A;  4Z1Q A;  4BW1 A;  5E9I A;  5HCL A;  2G4A A;  4N4G A;  5HEL A;  4CFK A;  5D3S A;  5FE0 A;  5L8U A;  4HBY A;  4LDF A;  2NXB A;  1WUM A;  3UW9 A;  3HMH A;  5I88 A;  4YH3 A;  4LR6 A;  4A9J A;  5HQ6 A;  2DVV A;  5EU1 A;  1ZS5 A;  5DFB A;  4QUU A;  4MR6 A;  2DVQ A;  4CUU A;  3SVF A;  4UYF B;  3K2J A;  2L84 A;  4CLB A;  3D7C A;  4X2I A;  3LQI A;  4O7C A;  5AD2 A;  4LZ2 A;  5KTW A;  4YY6 A;  4YAX A;  5DY7 A;  3JVJ A;  4MR3 A;  4QSS A;  3UVW A;  5D0C A;  5E9L A;  4A9M A;  3O34 A;  3DWY A;  4LYI A;  3O36 A;  3NXB A;  5ENI A;  4QUT A;  4XYA A;  5HQ7 A;  3HME A;  2LSP B;  4NUC A;  1E6I A;  4TS8 A;  5F62 A;  2GRC A;  5BT4 A;  4YAD A;  4QNS A;  4YC9 A;  3S91 A;  4HXL A;  4A9N A;  4CUQ A;  4HXK A;  2YEM A;  2L5E A;  2MJV B;  5A81 A;  4MEP A;  5COI A;  5A5S A;  5IG6 A;  5CRZ A;  5E73 A;  4YBM A;  5HLS A;  4PCI A;  4IR4 A;  5CQ6 A;  4F3I A;  4QYL A;  5D3J A;  3O33 A;  3UV2 A;  4NRB A;  3MXF A;  5EWH A;  5D3N A;  4OGI A;  4O71 A;  4UIW A;  5G4S A;  2RNY A;  5F1L A;  5E9K A;  5D3H A;  5EPR A;  3U5J A;  5A5Q A;  3RCW A;  4UIY A;  4UIT A;  5C8G A;  4YK0 A;  4PKL A;  4BJX A;  4NRA A;  5FE3 A;  5ENB A;  5G4R A;  3MUL A;  5DYC A;  5TB6 A;  4Q0O A;  5L97 A;  5CUA A;  5FBX A;  3P1D A;  4O78 A;  4NXJ A;  4N4F A;  4A9L A;  5E3G A;  4LYW A;  5EM3 A;  2R0S A;  5JI8 A;  3UVD A;  4CUP A;  5CPE A;  5CQA A;  5A83 A;  3UV4 A;  2DVS A;  4NR6 A;  5D24 A;  5LKZ A;  5AD3 A;  4UIX A;  5EIS A;  4IOR A;  4ZQL A;  5EWW A;  1F68 A;  4Y03 A;  5DKD A;  4PY6 A;  3Q2E A;  5LJ1 A;  4J3I A;  4YY4 A;  2RNX A;  2DAT A;  5H85 A;  4TT2 A;  4NYW A;  4PCE A;  4QZS A;  4YH4 A;  3SVG A;  4GPJ A;  4YYD A;  2OO1 A;  5LJ2 A;  5HM0 A;  5EA1 A;  5TCM A;  2E3K A;  2WP1 A;  4TZ8 A;  2YEK A;  5FFV A;  3LQH A;  4LZR A;  4HXR A;  5A5O A;  4QC3 A;  4NRC A;  5ENF A;  5I83 A;  5FG6 A;  2YEL A;  3AAD A;  5EPS A;  5I89 A;  5EK9 A;  2D82 A;  5E0R A;  2RO1 A;  5KTX A;  4ALH A;  5F61 A;  2FSA A;  2KTB B;  2DWW A;  4UYG A;  5D3P A;  4UIV A;  5FE4 A;  4CUS A;  5FDZ A;  3QZS A;  5FE7 A;  4AKN A;  4QEV A;  4IOO A;  5IGL A;  5C7N A;  5FE1 A;  5I80 A;  4N4I A;  4QY4 A;  4QSV A;  3DAI A;  5F2P A;  5KU3 A;  4WIV A;  4NUD A;  3U5L A;  3P5O A;  5BT5 A;  4TQN A;  3I3J A;  5E7D A;  5LVR A;  4YBS A;  4ALG A;  5BT3 A;  2E7N A;  4A9K A;  4O70 A;  3O35 A;  5DKC A;  5K29 A;  3JVK A;  3MB4 A;  5CUB A;  4YAT A;  3IU6 A;  5F1H A;  4ZW1 A;  4HXS A;  4ZC9 A;  5FB0 A;  4O74 A;  4YYJ A;  5H1T A;  5EP7 A;  5CU8 A;  3FKM X;  4O72 A;  5ETD A;  4QB3 A;  2E7O A;  5L96 A;  2I7K A;  5IID A;  2YW5 A;  3HMF A;  5FH8 A;  4NUE A;  5CQT A;  5F60 A;  4OGJ A;  4BW2 A;  1N72 A;  5FE6 A;  4O76 A;  4NS5 A;  5DFD A;  5FH6 A; 
#chains in the Genus database with same CATH topology
 5KTU A;  5EIC A;  5EVA A;  4IR5 A;  5I40 A;  5FFW A;  5E9M A;  5D3L A;  5ENE A;  5H1U A;  3MQM A;  5CQ5 A;  3G0L A;  4QSQ A;  5CP5 A;  4J1P A;  5F36 A;  3GG3 A;  4MEN A;  4WHW A;  5ACY A;  5HJC A;  4C66 A;  5FE2 A;  4E96 A;  5LJ0 A;  5EGU A;  4QSU A;  5IGM A;  4QSX A;  4IR3 A;  5DLZ A;  3S92 A;  4TU4 A;  5II1 A;  5CQ8 A;  2WP2 A;  5CGP A;  4CUT A;  5I7X A;  4QST A;  2DKW A;  5DW1 A;  3IU5 A;  5E9V A;  5F5Z A;  4HXP A;  3P1E A;  5II2 A;  4KV4 A;  5CQ4 A;  5L8T A;  5A85 A;  5FB1 A;  4CFL A;  5DKH A;  3ERR A;  2RS9 B;  4QSW A;  5E3D A;  4UYH A;  5ENG A;  4MEO A;  3U5P A;  3O37 A;  4A9O A;  4YYK A;  4RVR A;  2L85 A;  4KV1 A;  4QR4 A;  5ENJ A;  4YBT A;  2R10 A;  4HXO A;  5FG5 A;  5D26 A;  5HQ5 A;  4Z6H A;  1X0J A;  5DLX A;  5IBN A;  5A5N A;  5C89 A;  4QEW A;  5LKX A;  4LRG A;  4LC2 A;  4MR4 A;  4N3W A;  5FG4 A;  5LKT A;  4O7B A;  4HXM A;  3MUK A;  4O75 A;  5EI4 A;  5EWD A;  4QSR A;  5H1V A;  3UV5 A;  4QR5 A;  4QC1 A;  5F3A A;  5CQ3 A;  5DBM A;  2N9G A;  4YYG A;  5CS8 A;  5J0D A;  4A9I A;  5D3T A;  5D25 A;  4YYM A;  5EQ1 A;  1EQF A;  4QSP A;  5HFR A;  5CZG A;  5LUU A;  4FLP A;  4NR8 A;  5I29 A;  3UVY A;  3QZT A;  2YYN A;  5CUE A;  5JWM A;  4QYD A;  4XUA A;  4NQM A;  5CY9 A;  3LXJ A;  4A9E A;  5C4Q A;  1JM4 B;  4CL9 A;  4XY9 A;  5CFW A;  5D7X A;  3G0J A;  5HRW A;  3AQA A;  2RFJ A;  3P1F A;  5EWV A;  5KHM A;  2RNW A;  5HEM A;  3U5N A;  1WUG A;  5HRX A;  5CQ7 A;  5DYU A;  4HBW A;  2OSS A;  4DON A;  5E9Y A;  5FE9 A;  4J0S A;  4BHW A;  4UYD A;  4AKH A;  4YYH A;  2EJN A;  3TLP A;  5FFY A;  4NQN A;  4CUR A;  4YYN A;  3SVH A;  4HBX A;  4TU6 A;  4PS5 A;  4TZ2 A;  5HFQ A;  4A9F A;  5CRM A;  5C87 A;  4HXN A;  2H60 A;  5DW2 A;  4NR7 A;  4J0R A;  4Q0N A;  2I8N A;  4PTB A;  5A5P A;  5C85 A;  4UIU A;  4NYX A;  4UYE A;  4TYL A;  3QZV A;  4UYF A;  5L98 A;  3U5M A;  2DVR A;  4KCX A;  5DYX A;  5I1Q A;  3JVL A;  5F63 A;  4TT6 A;  4YYI A;  5AMF A;  5FH7 A;  5DYA A;  1ZKR A;  2R0Y A;  4MEQ A;  5CUD A;  5D3R A;  5E74 A;  4WHU A;  5A5R A;  3ONI A;  4OUF A;  4BW4 A;  4LYS A;  4NR9 A;  4NYV A;  5IGK A;  4UIZ A;  5LKU A;  4MR5 A;  4O7F A;  3MB3 A;  5A82 A;  3Q2F A;  4QEU A;  5L99 A;  4QR3 A;  4TT4 A;  2OUO A;  4TTE A;  3UVX A;  5EPB A;  5DX4 A;  4NR4 A;  2F6N A;  4LZS A;  4QBM A;  4Z6I A;  5HRV A;  5CTL A;  5FE5 A;  2D9E A;  2F6J A;  3LJW A;  4Z93 A;  4YAB A;  2YQD A;  4IOQ A;  5CUC A;  5HEN A;  5KO4 A;  4XY8 A;  5EWC A;  5CUG A;  4Z1S A;  4O77 A;  4N4H A;  5FE8 A;  1JSP B;  4A9H A;  3P1C A;  3ZYU A;  5A7C A;  5I7Y A;  2YDW A;  3JVM A;  3LQJ A;  4O7A A;  5LVQ A;  5ENC A;  4O7E A;  5AME A;  5I86 A;  3U5O A;  5IGN A;  4NR5 A;  5EV9 A;  4C67 A;  4BW3 A;  5ETB A;  4IR6 A;  4HBV A;  4XUB A;  5ENH A;  3U5K A;  3VKG A;  5F25 A;  2R0V A;  2RI7 A;  5DFC A;  4Z1Q A;  4BW1 A;  5E9I A;  5HCL A;  2G4A A;  4N4G A;  5HEL A;  4CFK A;  5D3S A;  5FE0 A;  5L8U A;  4HBY A;  4LDF A;  2NXB A;  1WUM A;  3UW9 A;  3HMH A;  5I88 A;  4YH3 A;  3VKH A;  4LR6 A;  4A9J A;  5HQ6 A;  2DVV A;  5EU1 A;  1ZS5 A;  5DFB A;  4QUU A;  4MR6 A;  2DVQ A;  4CUU A;  3SVF A;  4UYF B;  3K2J A;  2L84 A;  4CLB A;  3D7C A;  4X2I A;  3LQI A;  4O7C A;  5AD2 A;  4LZ2 A;  5KTW A;  3D1D A;  4YY6 A;  4YAX A;  5DY7 A;  3JVJ A;  4MR3 A;  4QSS A;  3UVW A;  5D0C A;  5E9L A;  4A9M A;  3O34 A;  3DWY A;  4LYI A;  3O36 A;  3NXB A;  5ENI A;  4QUT A;  4XYA A;  5HQ7 A;  3HME A;  2LSP B;  4NUC A;  1E6I A;  4TS8 A;  5F62 A;  2GRC A;  5BT4 A;  4YAD A;  4QNS A;  4YC9 A;  3S91 A;  4HXL A;  4A9N A;  4CUQ A;  4HXK A;  2YEM A;  2L5E A;  2MJV B;  5A81 A;  4MEP A;  5COI A;  5A5S A;  5IG6 A;  5CRZ A;  5E73 A;  4YBM A;  5HLS A;  4PCI A;  4IR4 A;  5CQ6 A;  4F3I A;  4QYL A;  5D3J A;  3O33 A;  3UV2 A;  4NRB A;  4AI6 A;  3MXF A;  5EWH A;  5D3N A;  4OGI A;  4O71 A;  4UIW A;  5G4S A;  2RNY A;  5F1L A;  5E9K A;  5D3H A;  5EPR A;  3U5J A;  5A5Q A;  3RCW A;  4UIY A;  3D1B A;  4UIT A;  5C8G A;  4YK0 A;  4PKL A;  4BJX A;  4NRA A;  5FE3 A;  5ENB A;  5G4R A;  3MUL A;  5DYC A;  5TB6 A;  4Q0O A;  5L97 A;  5CUA A;  5FBX A;  3P1D A;  4O78 A;  4NXJ A;  4N4F A;  4A9L A;  5E3G A;  4LYW A;  5EM3 A;  2R0S A;  5JI8 A;  3UVD A;  4CUP A;  5CPE A;  5CQA A;  5A83 A;  3UV4 A;  2DVS A;  4NR6 A;  5D24 A;  5LKZ A;  4AKG A;  5AD3 A;  4UIX A;  5EIS A;  4IOR A;  4ZQL A;  5EWW A;  1F68 A;  4Y03 A;  5DKD A;  4PY6 A;  3Q2E A;  5LJ1 A;  4J3I A;  4YY4 A;  2RNX A;  2DAT A;  5H85 A;  4TT2 A;  4NYW A;  4PCE A;  4QZS A;  4YH4 A;  3SVG A;  4GPJ A;  4YYD A;  2OO1 A;  5LJ2 A;  5HM0 A;  5EA1 A;  5TCM A;  2E3K A;  2WP1 A;  4TZ8 A;  2YEK A;  5FFV A;  3LQH A;  4LZR A;  4HXR A;  5A5O A;  4QC3 A;  4NRC A;  5ENF A;  5I83 A;  5FG6 A;  2YEL A;  3AAD A;  5EPS A;  5I89 A;  5EK9 A;  2D82 A;  5E0R A;  2RO1 A;  5KTX A;  4ALH A;  5F61 A;  2FSA A;  2KTB B;  2DWW A;  4UYG A;  5D3P A;  4UIV A;  5FE4 A;  4CUS A;  5FDZ A;  3QZS A;  5FE7 A;  4AKN A;  4QEV A;  4IOO A;  5IGL A;  5C7N A;  5FE1 A;  5I80 A;  4N4I A;  4QY4 A;  4QSV A;  3DAI A;  5F2P A;  5KU3 A;  4WIV A;  4NUD A;  3U5L A;  3P5O A;  5BT5 A;  4TQN A;  3I3J A;  5E7D A;  5LVR A;  4AKI A;  4YBS A;  4ALG A;  5BT3 A;  2E7N A;  4A9K A;  4O70 A;  3O35 A;  5DKC A;  5K29 A;  3JVK A;  3MB4 A;  5CUB A;  4YAT A;  3IU6 A;  5F1H A;  4ZW1 A;  4HXS A;  4ZC9 A;  5FB0 A;  4O74 A;  4YYJ A;  5H1T A;  5EP7 A;  5CU8 A;  3FKM X;  4O72 A;  5ETD A;  4QB3 A;  2E7O A;  5L96 A;  2I7K A;  5IID A;  2YW5 A;  3HMF A;  5FH8 A;  4NUE A;  1PUO A;  5CQT A;  5F60 A;  4OGJ A;  4BW2 A;  1N72 A;  5FE6 A;  4O76 A;  4NS5 A;  5DFD A;  5FH6 A; 
#chains in the Genus database with same CATH homology
 5KTU A;  5EIC A;  5EVA A;  4IR5 A;  5I40 A;  5FFW A;  5E9M A;  5D3L A;  5ENE A;  5H1U A;  3MQM A;  5CQ5 A;  3G0L A;  4QSQ A;  5CP5 A;  4J1P A;  5F36 A;  3GG3 A;  4MEN A;  4WHW A;  5ACY A;  5HJC A;  4C66 A;  5FE2 A;  4E96 A;  5LJ0 A;  5EGU A;  4QSU A;  5IGM A;  4QSX A;  4IR3 A;  5DLZ A;  3S92 A;  4TU4 A;  5II1 A;  5CQ8 A;  2WP2 A;  5CGP A;  4CUT A;  5I7X A;  4QST A;  2DKW A;  5DW1 A;  3IU5 A;  5E9V A;  5F5Z A;  4HXP A;  3P1E A;  5II2 A;  4KV4 A;  5CQ4 A;  5L8T A;  5A85 A;  5FB1 A;  4CFL A;  5DKH A;  2RS9 B;  4QSW A;  5E3D A;  4UYH A;  5ENG A;  4MEO A;  3U5P A;  3O37 A;  4A9O A;  4YYK A;  4RVR A;  2L85 A;  4KV1 A;  4QR4 A;  5ENJ A;  4YBT A;  2R10 A;  4HXO A;  5FG5 A;  5D26 A;  5HQ5 A;  4Z6H A;  1X0J A;  5DLX A;  5IBN A;  5A5N A;  5C89 A;  4QEW A;  5LKX A;  4LRG A;  4LC2 A;  4MR4 A;  4N3W A;  5FG4 A;  5LKT A;  4O7B A;  4HXM A;  3MUK A;  4O75 A;  5EI4 A;  5EWD A;  4QSR A;  5H1V A;  3UV5 A;  4QR5 A;  4QC1 A;  5F3A A;  5CQ3 A;  5DBM A;  2N9G A;  4YYG A;  5CS8 A;  5J0D A;  4A9I A;  5D3T A;  5D25 A;  4YYM A;  5EQ1 A;  1EQF A;  4QSP A;  5HFR A;  5CZG A;  5LUU A;  4FLP A;  4NR8 A;  5I29 A;  3UVY A;  3QZT A;  2YYN A;  5CUE A;  5JWM A;  4QYD A;  4XUA A;  4NQM A;  5CY9 A;  3LXJ A;  4A9E A;  5C4Q A;  1JM4 B;  4CL9 A;  4XY9 A;  5CFW A;  5D7X A;  3G0J A;  5HRW A;  3AQA A;  2RFJ A;  3P1F A;  5EWV A;  5KHM A;  2RNW A;  5HEM A;  3U5N A;  1WUG A;  5HRX A;  5CQ7 A;  5DYU A;  4HBW A;  2OSS A;  4DON A;  5E9Y A;  5FE9 A;  4J0S A;  4BHW A;  4UYD A;  4YYH A;  3TLP A;  5FFY A;  4NQN A;  4CUR A;  4YYN A;  3SVH A;  4HBX A;  4TU6 A;  4PS5 A;  4TZ2 A;  5HFQ A;  4A9F A;  5CRM A;  5C87 A;  4HXN A;  2H60 A;  5DW2 A;  4NR7 A;  4J0R A;  4Q0N A;  2I8N A;  4PTB A;  5A5P A;  5C85 A;  4UIU A;  4NYX A;  4UYE A;  4TYL A;  3QZV A;  4UYF A;  5L98 A;  3U5M A;  2DVR A;  4KCX A;  5DYX A;  5I1Q A;  3JVL A;  5F63 A;  4TT6 A;  4YYI A;  5AMF A;  5FH7 A;  5DYA A;  2R0Y A;  4MEQ A;  5CUD A;  5D3R A;  5E74 A;  4WHU A;  5A5R A;  3ONI A;  4OUF A;  4BW4 A;  4LYS A;  4NR9 A;  4NYV A;  5IGK A;  4UIZ A;  5LKU A;  4MR5 A;  4O7F A;  3MB3 A;  5A82 A;  3Q2F A;  4QEU A;  5L99 A;  4QR3 A;  4TT4 A;  2OUO A;  4TTE A;  3UVX A;  5EPB A;  5DX4 A;  4NR4 A;  2F6N A;  4LZS A;  4QBM A;  4Z6I A;  5HRV A;  5CTL A;  5FE5 A;  2D9E A;  2F6J A;  3LJW A;  4Z93 A;  4YAB A;  2YQD A;  4IOQ A;  5CUC A;  5HEN A;  5KO4 A;  4XY8 A;  5EWC A;  5CUG A;  4Z1S A;  4O77 A;  4N4H A;  5FE8 A;  1JSP B;  4A9H A;  3P1C A;  3ZYU A;  5A7C A;  5I7Y A;  2YDW A;  3JVM A;  3LQJ A;  4O7A A;  5LVQ A;  5ENC A;  4O7E A;  5AME A;  5I86 A;  3U5O A;  5IGN A;  4NR5 A;  5EV9 A;  4C67 A;  4BW3 A;  5ETB A;  4IR6 A;  4HBV A;  4XUB A;  5ENH A;  3U5K A;  5F25 A;  2R0V A;  2RI7 A;  5DFC A;  4Z1Q A;  4BW1 A;  5E9I A;  5HCL A;  2G4A A;  4N4G A;  5HEL A;  4CFK A;  5D3S A;  5FE0 A;  5L8U A;  4HBY A;  4LDF A;  2NXB A;  1WUM A;  3UW9 A;  3HMH A;  5I88 A;  4YH3 A;  4LR6 A;  4A9J A;  5HQ6 A;  2DVV A;  5EU1 A;  1ZS5 A;  5DFB A;  4QUU A;  4MR6 A;  2DVQ A;  4CUU A;  3SVF A;  4UYF B;  3K2J A;  2L84 A;  4CLB A;  3D7C A;  4X2I A;  3LQI A;  4O7C A;  5AD2 A;  4LZ2 A;  5KTW A;  4YY6 A;  4YAX A;  5DY7 A;  3JVJ A;  4MR3 A;  4QSS A;  3UVW A;  5D0C A;  5E9L A;  4A9M A;  3O34 A;  3DWY A;  4LYI A;  3O36 A;  3NXB A;  5ENI A;  4QUT A;  4XYA A;  5HQ7 A;  3HME A;  2LSP B;  4NUC A;  1E6I A;  4TS8 A;  5F62 A;  2GRC A;  5BT4 A;  4YAD A;  4QNS A;  4YC9 A;  3S91 A;  4HXL A;  4A9N A;  4CUQ A;  4HXK A;  2YEM A;  2L5E A;  2MJV B;  5A81 A;  4MEP A;  5COI A;  5A5S A;  5IG6 A;  5CRZ A;  5E73 A;  4YBM A;  5HLS A;  4PCI A;  4IR4 A;  5CQ6 A;  4F3I A;  4QYL A;  5D3J A;  3O33 A;  3UV2 A;  4NRB A;  3MXF A;  5EWH A;  5D3N A;  4OGI A;  4O71 A;  4UIW A;  5G4S A;  2RNY A;  5F1L A;  5E9K A;  5D3H A;  5EPR A;  3U5J A;  5A5Q A;  3RCW A;  4UIY A;  4UIT A;  5C8G A;  4YK0 A;  4PKL A;  4BJX A;  4NRA A;  5FE3 A;  5ENB A;  5G4R A;  3MUL A;  5DYC A;  5TB6 A;  4Q0O A;  5L97 A;  5CUA A;  5FBX A;  3P1D A;  4O78 A;  4NXJ A;  4N4F A;  4A9L A;  5E3G A;  4LYW A;  5EM3 A;  2R0S A;  5JI8 A;  3UVD A;  4CUP A;  5CPE A;  5CQA A;  5A83 A;  3UV4 A;  2DVS A;  4NR6 A;  5D24 A;  5LKZ A;  5AD3 A;  4UIX A;  5EIS A;  4IOR A;  4ZQL A;  5EWW A;  1F68 A;  4Y03 A;  5DKD A;  4PY6 A;  3Q2E A;  5LJ1 A;  4J3I A;  4YY4 A;  2RNX A;  2DAT A;  5H85 A;  4TT2 A;  4NYW A;  4PCE A;  4QZS A;  4YH4 A;  3SVG A;  4GPJ A;  4YYD A;  2OO1 A;  5LJ2 A;  5HM0 A;  5EA1 A;  5TCM A;  2E3K A;  2WP1 A;  4TZ8 A;  2YEK A;  5FFV A;  3LQH A;  4LZR A;  4HXR A;  5A5O A;  4QC3 A;  4NRC A;  5ENF A;  5I83 A;  5FG6 A;  2YEL A;  3AAD A;  5EPS A;  5I89 A;  5EK9 A;  2D82 A;  5E0R A;  2RO1 A;  5KTX A;  4ALH A;  5F61 A;  2FSA A;  2KTB B;  2DWW A;  4UYG A;  5D3P A;  4UIV A;  5FE4 A;  4CUS A;  5FDZ A;  3QZS A;  5FE7 A;  4AKN A;  4QEV A;  4IOO A;  5IGL A;  5C7N A;  5FE1 A;  5I80 A;  4N4I A;  4QY4 A;  4QSV A;  3DAI A;  5F2P A;  5KU3 A;  4WIV A;  4NUD A;  3U5L A;  3P5O A;  5BT5 A;  4TQN A;  3I3J A;  5E7D A;  5LVR A;  4YBS A;  4ALG A;  5BT3 A;  2E7N A;  4A9K A;  4O70 A;  3O35 A;  5DKC A;  5K29 A;  3JVK A;  3MB4 A;  5CUB A;  4YAT A;  3IU6 A;  5F1H A;  4ZW1 A;  4HXS A;  4ZC9 A;  5FB0 A;  4O74 A;  4YYJ A;  5H1T A;  5EP7 A;  5CU8 A;  3FKM X;  4O72 A;  5ETD A;  4QB3 A;  2E7O A;  5L96 A;  2I7K A;  5IID A;  2YW5 A;  3HMF A;  5FH8 A;  4NUE A;  5CQT A;  5F60 A;  4OGJ A;  4BW2 A;  1N72 A;  5FE6 A;  4O76 A;  4NS5 A;  5DFD A;  5FH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...