1JSPB

Nmr structure of cbp bromodomain in complex with p53 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords tumor protein p53
publication title Structural mechanism of the bromodomain of the coactivator CBP in p53 transcriptional activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2001-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1jspB00
2R10A 4O70A 3Q2EA 5ENJA 3MB4A 5AMFA 5FE5A 5J0DA 3UV2A 4QYLA 5CQ8A 4MEPA 5E9KA 3O34A 5H1TA 4NQNA 5EU1A 2L84A 4NR6A 3FKMX 3O37A 4XUBA 5A85A 4YAXA 3UVDA 4A9LA 4TYLA 3JVJA 2R0YA 2OSSA 5DKCA 4LZRA 4YBTA 5I89A 4BW4A 4IR5A 5G4SA 4UYFA 5EK9A 5D3LA 4A9HA 4NYWA 3SVHA 3AQAA 5A5NA 2FSAA 5D3PA 2YQDA 3TLPA 4HBXA 4LZSA 4HXKA 5EWCA 3S92A 4MR4A 4N4HA 5ENCA 4O7AA 5EPSA 4QB3A 5FH6A 4UIXA 3U5LA 4CUPA 4CUQA 4LDFA 5A5QA 5A5SA 4CURA 4N4IA 1N72A 3JVMA 4HXLA 4LYWA 5LKTA 5I86A 4UIZA 5ENGA 4NRBA 5D26A 5D3JA 4PTBA 2GRCA 4YY4A 3ONIA 4C67A 4A9EA 5H85A 5HCLA 3LQJA 4CUTA 4HXSA 5CQTA 5DYAA 5FE4A 2LSPB 4NQMA 2RFJA 5C87A 5E9LA 4C66A 5F5ZA 2L85A 4WIVA 1JSPB 3UV5A 5II2A 5F2PA 5I83A 4A9IA 4CUUA 5CUAA 3O36A 5ENFA 5IGMA 4NYVA 5HFRA 4A9OA 4QC3A 4QSPA 4YYJA 5D3SA 5FG4A 4TU6A 5LKZA 5CQ6A 5HEMA 4NR4A 5COIA 4PCIA 5C4QA 3LJWA 5ETBA 4UYDA 5FH7A 5FE9A 4HXRA 5HLSA 5FB1A 2MJVB 5DFCA 5H1UA 2E3KA 4LYSA 4TT4A 3IU6A 3QZVA 5FE1A 5EA1A 4NR5A 4QSSA 3U5KA 5CGPA 4NUDA 3DWYA 3JVKA 4UYHA 5CFWA 5I7XA 1WUMA 3QZSA 4ZQLA 4HXPA 3RCWA 5F3AA 4QR3A 5F60A 5E7DA 5FE0A 4HXNA 5KTXA 5LKXA 5E9IA 4BW1A 4CFLA 5FH8A 5F36A 4NRCA 5DLXA 2WP1A 5A5RA 2KTBB 5BT4A 3UVXA 4X2IA 2F6JA 4MR5A 5E0RA 3D7CA 4MR6A 5DFBA 4O77A 2RNWA 4IR6A 3O33A 3Q2FA 1X0JA 4LC2A 4NR7A 5DYXA 5F62A 5FE6A 3U5OA 3DAIA 5D25A 3U5MA 4QNSA 4IOOA 5L99A 5EWWA 5HFQA 4HBVA 4UIWA 2DKWA 4YC9A 5CQAA 5IGKA 5FE8A 5F1LA 3I3JA 5LJ2A 1WUGA 2RS9B 4A9FA 4Z93A 4KV1A 5IIDA 4TT2A 4YYDA 5CRMA 2YYNA 5CUEA 5A7CA 5E9YA 3ZYUA 4F3IA 5HM0A 3MQMA 4E96A 5A83A 5CQ5A 5D7XA 5ENIA 4A9NA 4WHWA 4O7EA 5D3TA 5CUGA 4UYEA 5FFVA 2YEKA 2DVRA 5E9MA 5FE3A 4IR3A 2H60A 2WP2A 5JI8A 3HMHA 4LRGA 5AD2A 3K2JA 5EI4A 4OGJA 2G4AA 4IORA 4QSQA 5DKDA 4HBYA 4IOQA 5DYUA 4BW3A 5HRXA 5LVRA 5JWMA 4MEQA 3U5NA 5E3GA 5A5OA 5HQ5A 4LYIA 5A5PA 3O35A 3HMFA 5CP5A 5IBNA 5CS8A 4DONA 4Z1SA 2DWWA 1JM4B 5D24A 4QEVA 2OO1A 4XY8A 4N4FA 4O7BA 5I80A 4XUAA 1ZS5A 4O72A 4PKLA 5KU3A 4QR5A 2F6NA 5KTUA 4WHUA 5F61A 5FFWA 3UVWA 2I8NA 5D3HA 5I7YA 3UVYA 5L96A 5AD3A 5I88A 1F68A 5CUCA 5E3DA 5E9VA 4YADA 5EWHA 5A81A 4O78A 5ETDA 3LQHA 5CQ3A 3P1EA 4YYHA 2E7OA 2YDWA 4TU4A 4PY6A 5EGUA 2YELA 4YBMA 5FB0A 3U5PA 4GPJA 2D82A 4PS5A 5EWDA 2R0VA 1E6IA 2I7KA 3P1DA 3MB3A 4BHWA 4TQNA 5HRVA 4Y03A 2R0SA 5IGLA 4QEUA 4OUFA 2N9GA 5EP7A 4YH3A 4A9JA 5L8UA 4TT6A 4NYXA 5LJ0A 3NXBA 5FDZA 5FFYA 5EPBA 4O7CA 5FE2A 4QSWA 2DVQA 5DYCA 5F1HA 3UV4A 2OUOA 4UIYA 5AMEA 5C7NA 4HXOA 2D9EA 5EISA 5L98A 4UYFB 3P5OA 5C89A 3UW9A 5LKUA 5LUUA 3QZTA 5CUBA 4LR6A 4J0RA 2DATA 5DX4A 4IR4A 5E73A 2NXBA 4J1PA 5FE7A 5LVQA 4TZ2A 4YY6A 4A9KA 5DKHA 4XYAA 3LXJA 4QSVA 5CZGA 5TCMA 4QEWA 4BW2A 4UYGA 5I40A 4QYDA 4Z6IA 5ACYA 2E7NA 4ALGA 4NUEA 4QSUA 5II1A 5HELA 3HMEA 4Q0NA 5IGNA 5CU8A 5EICA 4MR3A 5ENHA 4NS5A 4NUCA 4J3IA 4CFKA 4YABA 5F63A 4NXJA 5E74A 4QUTA 4QY4A 3MUKA 5CRZA 4Z6HA 4QSTA 4YYKA 3G0LA 4Q0OA 4NR8A 5IG6A 5EM3A 5HJCA 5I1QA 5DLZA 5L97A 5D3NA 4O7FA 4UITA 4MEOA 4NRAA 5FG5A 5G4RA 5HQ6A 3U5JA 4O76A 3G0JA 4HBWA 4QSRA 4YYNA 5H1VA 4QC1A 4MENA 4RVRA 5CQ7A 5L8TA 5CTLA 4XY9A 5EPRA 4YYIA 3AADA 5D3RA 5DW1A 5DY7A 2DVVA 2RNXA 5C85A 4QZSA 4TTEA 5HRWA 5FBXA 4A9MA 4CLBA 4Z1QA 3GG3A 5EVAA 2RI7A 5DFDA 4TZ8A 4YATA 4BJXA 2L5EA 5CPEA 5C8GA 4YYGA 3MULA 5EWVA 5KTWA 5K29A 4N4GA 5F25A 5LJ1A 4UIVA 4YH4A 4UIUA 5BT3A 4QSXA 2YEMA 4TS8A 3SVFA 4O74A 4QR4A 4YK0A 3S91A 2DVSA 5BT5A 4ZC9A 4KV4A 5EV9A 1EQFA 5A82A 2RO1A 4PCEA 5HENA 4KCXA 4OGIA 5D0CA 4YBSA 4O75A 3MXFA 4NR9A 5I29A 4J0SA 4QUUA 5CY9A 4AKNA 4YYMA 3LQIA 4FLPA 5KO4A 4QBMA 5CQ4A 5ENEA 5EQ1A 5CUDA 3P1CA 3P1FA 5HQ7A 5FG6A 4O71A 4LZ2A 5KHMA 5DW2A 4CL9A 4HXMA 2YW5A 4ZW1A 5TB6A 4ALHA 3JVLA 3IU5A 2RNYA 5DBMA 3SVGA 4N3WA 5ENBA 4CUSA
chains in the Genus database with same CATH superfamily
2R10A 4O70A 3Q2EA 5ENJA 3MB4A 5AMFA 5FE5A 5J0DA 3UV2A 4QYLA 5CQ8A 4MEPA 5E9KA 3O34A 5H1TA 4NQNA 5EU1A 2L84A 4NR6A 3FKMX 3O37A 4XUBA 5A85A 4YAXA 3UVDA 4A9LA 4TYLA 3JVJA 2R0YA 2OSSA 5DKCA 4LZRA 4YBTA 5I89A 4BW4A 4IR5A 5G4SA 4UYFA 5EK9A 5D3LA 4A9HA 4NYWA 3SVHA 3AQAA 5A5NA 2FSAA 5D3PA 2YQDA 3TLPA 4HBXA 4LZSA 4HXKA 5EWCA 3S92A 4MR4A 4N4HA 5ENCA 4O7AA 5EPSA 4QB3A 5FH6A 4UIXA 3U5LA 4CUPA 4CUQA 4LDFA 4AKGA 5A5QA 5A5SA 4CURA 4N4IA 1N72A 3JVMA 4HXLA 4LYWA 5LKTA 5I86A 4UIZA 5ENGA 4NRBA 5D26A 5D3JA 4PTBA 2GRCA 4YY4A 3ONIA 4C67A 4A9EA 5H85A 5HCLA 3LQJA 4CUTA 4HXSA 5CQTA 5DYAA 5FE4A 2LSPB 4NQMA 2RFJA 5C87A 5E9LA 4C66A 5F5ZA 2L85A 4WIVA 1JSPB 3UV5A 5II2A 5F2PA 5I83A 4A9IA 4CUUA 5CUAA 3O36A 5ENFA 5IGMA 4NYVA 5HFRA 4A9OA 4QC3A 4QSPA 4YYJA 5D3SA 5FG4A 4TU6A 5LKZA 5CQ6A 5HEMA 4NR4A 5COIA 4PCIA 5C4QA 3LJWA 5ETBA 4UYDA 5FH7A 5FE9A 4HXRA 5HLSA 5FB1A 2MJVB 5DFCA 5H1UA 2E3KA 1PUOA 4AKIA 4LYSA 4TT4A 3IU6A 3QZVA 5FE1A 5EA1A 4NR5A 4QSSA 3U5KA 5CGPA 4NUDA 3DWYA 3JVKA 4UYHA 5CFWA 5I7XA 1WUMA 3QZSA 4ZQLA 4HXPA 3RCWA 5F3AA 4QR3A 5F60A 5E7DA 5FE0A 4HXNA 5KTXA 5LKXA 5E9IA 4BW1A 4CFLA 5FH8A 5F36A 4NRCA 5DLXA 2WP1A 5A5RA 2KTBB 5BT4A 3UVXA 4X2IA 2F6JA 4MR5A 5E0RA 3D7CA 4MR6A 5DFBA 4O77A 2RNWA 4IR6A 3O33A 3Q2FA 1X0JA 4LC2A 4NR7A 5DYXA 5F62A 5FE6A 3U5OA 3DAIA 5D25A 3U5MA 4QNSA 4IOOA 5L99A 5EWWA 5HFQA 4HBVA 4UIWA 2DKWA 4YC9A 5CQAA 5IGKA 5FE8A 5F1LA 3I3JA 5LJ2A 1WUGA 2RS9B 4A9FA 4Z93A 4KV1A 5IIDA 4TT2A 4YYDA 5CRMA 2YYNA 5CUEA 5A7CA 5E9YA 3ZYUA 4F3IA 5HM0A 3MQMA 4E96A 5A83A 5CQ5A 5D7XA 5ENIA 4A9NA 4WHWA 4O7EA 5D3TA 5CUGA 4UYEA 5FFVA 2YEKA 2EJNA 2DVRA 5E9MA 5FE3A 4IR3A 2H60A 2WP2A 5JI8A 3HMHA 4LRGA 5AD2A 3K2JA 5EI4A 4OGJA 2G4AA 4IORA 4QSQA 5DKDA 4HBYA 4IOQA 5DYUA 4BW3A 5HRXA 5LVRA 5JWMA 4MEQA 3U5NA 5E3GA 5A5OA 5HQ5A 4LYIA 5A5PA 3O35A 3HMFA 5CP5A 5IBNA 5CS8A 4DONA 4Z1SA 2DWWA 1JM4B 5D24A 4QEVA 2OO1A 4XY8A 4N4FA 4O7BA 5I80A 4XUAA 1ZS5A 4O72A 4PKLA 5KU3A 4QR5A 2F6NA 5KTUA 4WHUA 5F61A 5FFWA 3UVWA 2I8NA 5D3HA 5I7YA 3UVYA 5L96A 5AD3A 5I88A 1F68A 5CUCA 5E3DA 5E9VA 4YADA 5EWHA 5A81A 4O78A 5ETDA 3LQHA 5CQ3A 3P1EA 4YYHA 2E7OA 2YDWA 4TU4A 4PY6A 5EGUA 2YELA 4YBMA 5FB0A 3U5PA 4GPJA 4AKHA 2D82A 4PS5A 5EWDA 2R0VA 1E6IA 2I7KA 3P1DA 3MB3A 4BHWA 4TQNA 5HRVA 4Y03A 2R0SA 5IGLA 4QEUA 4OUFA 2N9GA 5EP7A 4YH3A 4A9JA 5L8UA 4TT6A 4NYXA 5LJ0A 3NXBA 5FDZA 5FFYA 5EPBA 4O7CA 5FE2A 4QSWA 2DVQA 5DYCA 5F1HA 3UV4A 2OUOA 4UIYA 5AMEA 5C7NA 4HXOA 2D9EA 5EISA 5L98A 3VKHA 4UYFB 3P5OA 4AI6A 5C89A 3UW9A 5LKUA 5LUUA 3QZTA 5CUBA 4LR6A 3D1BA 4J0RA 2DATA 5DX4A 4IR4A 5E73A 2NXBA 4J1PA 5FE7A 5LVQA 4TZ2A 4YY6A 4A9KA 5DKHA 4XYAA 3LXJA 4QSVA 5CZGA 5TCMA 4QEWA 4BW2A 4UYGA 5I40A 4QYDA 4Z6IA 5ACYA 2E7NA 4ALGA 4NUEA 4QSUA 5II1A 5HELA 3HMEA 4Q0NA 5IGNA 5CU8A 5EICA 4MR3A 5ENHA 4NS5A 4NUCA 4J3IA 4CFKA 4YABA 5F63A 4NXJA 5E74A 4QUTA 4QY4A 3MUKA 5CRZA 4Z6HA 4QSTA 4YYKA 3G0LA 4Q0OA 4NR8A 5IG6A 5EM3A 5HJCA 5I1QA 5DLZA 5L97A 5D3NA 4O7FA 4UITA 4MEOA 4NRAA 5FG5A 5G4RA 5HQ6A 3U5JA 4O76A 3G0JA 4HBWA 4QSRA 4YYNA 5H1VA 4QC1A 4MENA 4RVRA 5CQ7A 5L8TA 5CTLA 4XY9A 5EPRA 4YYIA 3AADA 5D3RA 5DW1A 5DY7A 2DVVA 2RNXA 5C85A 4QZSA 4TTEA 5HRWA 5FBXA 4A9MA 4CLBA 4Z1QA 3GG3A 5EVAA 2RI7A 5DFDA 4TZ8A 4YATA 4BJXA 3D1DA 2L5EA 5CPEA 5C8GA 4YYGA 3MULA 5EWVA 5KTWA 5K29A 4N4GA 5F25A 5LJ1A 4UIVA 4YH4A 4UIUA 5BT3A 4QSXA 2YEMA 4TS8A 3SVFA 4O74A 4QR4A 4YK0A 3S91A 2DVSA 5BT5A 4ZC9A 4KV4A 5EV9A 1EQFA 5A82A 2RO1A 4PCEA 3ERRA 3VKGA 5HENA 4KCXA 4OGIA 5D0CA 4YBSA 4O75A 3MXFA 4NR9A 5I29A 4J0SA 4QUUA 5CY9A 4AKNA 4YYMA 3LQIA 1ZKRA 4FLPA 5KO4A 4QBMA 5CQ4A 5ENEA 5EQ1A 5CUDA 3P1CA 3P1FA 5HQ7A 5FG6A 4O71A 4LZ2A 5KHMA 5DW2A 4CL9A 4HXMA 2YW5A 4ZW1A 5TB6A 4ALHA 3JVLA 3IU5A 2RNYA 5DBMA 3SVGA 4N3WA 5ENBA 4CUSA
chains in the Genus database with same CATH topology
2R10A 4O70A 3Q2EA 5ENJA 3MB4A 5AMFA 5FE5A 5J0DA 3UV2A 4QYLA 5CQ8A 4MEPA 5E9KA 3O34A 5H1TA 4NQNA 5EU1A 2L84A 4NR6A 3FKMX 3O37A 4XUBA 5A85A 4YAXA 3UVDA 4A9LA 4TYLA 3JVJA 2R0YA 2OSSA 5DKCA 4LZRA 4YBTA 5I89A 4BW4A 4IR5A 5G4SA 4UYFA 5EK9A 5D3LA 4A9HA 4NYWA 3SVHA 3AQAA 5A5NA 2FSAA 5D3PA 2YQDA 3TLPA 4HBXA 4LZSA 4HXKA 5EWCA 3S92A 4MR4A 4N4HA 5ENCA 4O7AA 5EPSA 4QB3A 5FH6A 4UIXA 3U5LA 4CUPA 4CUQA 4LDFA 5A5QA 5A5SA 4CURA 4N4IA 1N72A 3JVMA 4HXLA 4LYWA 5LKTA 5I86A 4UIZA 5ENGA 4NRBA 5D26A 5D3JA 4PTBA 2GRCA 4YY4A 3ONIA 4C67A 4A9EA 5H85A 5HCLA 3LQJA 4CUTA 4HXSA 5CQTA 5DYAA 5FE4A 2LSPB 4NQMA 2RFJA 5C87A 5E9LA 4C66A 5F5ZA 2L85A 4WIVA 1JSPB 3UV5A 5II2A 5F2PA 5I83A 4A9IA 4CUUA 5CUAA 3O36A 5ENFA 5IGMA 4NYVA 5HFRA 4A9OA 4QC3A 4QSPA 4YYJA 5D3SA 5FG4A 4TU6A 5LKZA 5CQ6A 5HEMA 4NR4A 5COIA 4PCIA 5C4QA 3LJWA 5ETBA 4UYDA 5FH7A 5FE9A 4HXRA 5HLSA 5FB1A 2MJVB 5DFCA 5H1UA 2E3KA 4LYSA 4TT4A 3IU6A 3QZVA 5FE1A 5EA1A 4NR5A 4QSSA 3U5KA 5CGPA 4NUDA 3DWYA 3JVKA 4UYHA 5CFWA 5I7XA 1WUMA 3QZSA 4ZQLA 4HXPA 3RCWA 5F3AA 4QR3A 5F60A 5E7DA 5FE0A 4HXNA 5KTXA 5LKXA 5E9IA 4BW1A 4CFLA 5FH8A 5F36A 4NRCA 5DLXA 2WP1A 5A5RA 2KTBB 5BT4A 3UVXA 4X2IA 2F6JA 4MR5A 5E0RA 3D7CA 4MR6A 5DFBA 4O77A 2RNWA 4IR6A 3O33A 3Q2FA 1X0JA 4LC2A 4NR7A 5DYXA 5F62A 5FE6A 3U5OA 3DAIA 5D25A 3U5MA 4QNSA 4IOOA 5L99A 5EWWA 5HFQA 4HBVA 4UIWA 2DKWA 4YC9A 5CQAA 5IGKA 5FE8A 5F1LA 3I3JA 5LJ2A 1WUGA 2RS9B 4A9FA 4Z93A 4KV1A 5IIDA 4TT2A 4YYDA 5CRMA 2YYNA 5CUEA 5A7CA 5E9YA 3ZYUA 4F3IA 5HM0A 3MQMA 4E96A 5A83A 5CQ5A 5D7XA 5ENIA 4A9NA 4WHWA 4O7EA 5D3TA 5CUGA 4UYEA 5FFVA 2YEKA 2DVRA 5E9MA 5FE3A 4IR3A 2H60A 2WP2A 5JI8A 3HMHA 4LRGA 5AD2A 3K2JA 5EI4A 4OGJA 2G4AA 4IORA 4QSQA 5DKDA 4HBYA 4IOQA 5DYUA 4BW3A 5HRXA 5LVRA 5JWMA 4MEQA 3U5NA 5E3GA 5A5OA 5HQ5A 4LYIA 5A5PA 3O35A 3HMFA 5CP5A 5IBNA 5CS8A 4DONA 4Z1SA 2DWWA 1JM4B 5D24A 4QEVA 2OO1A 4XY8A 4N4FA 4O7BA 5I80A 4XUAA 1ZS5A 4O72A 4PKLA 5KU3A 4QR5A 2F6NA 5KTUA 4WHUA 5F61A 5FFWA 3UVWA 2I8NA 5D3HA 5I7YA 3UVYA 5L96A 5AD3A 5I88A 1F68A 5CUCA 5E3DA 5E9VA 4YADA 5EWHA 5A81A 4O78A 5ETDA 3LQHA 5CQ3A 3P1EA 4YYHA 2E7OA 2YDWA 4TU4A 4PY6A 5EGUA 2YELA 4YBMA 5FB0A 3U5PA 4GPJA 2D82A 4PS5A 5EWDA 2R0VA 1E6IA 2I7KA 3P1DA 3MB3A 4BHWA 4TQNA 5HRVA 4Y03A 2R0SA 5IGLA 4QEUA 4OUFA 2N9GA 5EP7A 4YH3A 4A9JA 5L8UA 4TT6A 4NYXA 5LJ0A 3NXBA 5FDZA 5FFYA 5EPBA 4O7CA 5FE2A 4QSWA 2DVQA 5DYCA 5F1HA 3UV4A 2OUOA 4UIYA 5AMEA 5C7NA 4HXOA 2D9EA 5EISA 5L98A 4UYFB 3P5OA 5C89A 3UW9A 5LKUA 5LUUA 3QZTA 5CUBA 4LR6A 4J0RA 2DATA 5DX4A 4IR4A 5E73A 2NXBA 4J1PA 5FE7A 5LVQA 4TZ2A 4YY6A 4A9KA 5DKHA 4XYAA 3LXJA 4QSVA 5CZGA 5TCMA 4QEWA 4BW2A 4UYGA 5I40A 4QYDA 4Z6IA 5ACYA 2E7NA 4ALGA 4NUEA 4QSUA 5II1A 5HELA 3HMEA 4Q0NA 5IGNA 5CU8A 5EICA 4MR3A 5ENHA 4NS5A 4NUCA 4J3IA 4CFKA 4YABA 5F63A 4NXJA 5E74A 4QUTA 4QY4A 3MUKA 5CRZA 4Z6HA 4QSTA 4YYKA 3G0LA 4Q0OA 4NR8A 5IG6A 5EM3A 5HJCA 5I1QA 5DLZA 5L97A 5D3NA 4O7FA 4UITA 4MEOA 4NRAA 5FG5A 5G4RA 5HQ6A 3U5JA 4O76A 3G0JA 4HBWA 4QSRA 4YYNA 5H1VA 4QC1A 4MENA 4RVRA 5CQ7A 5L8TA 5CTLA 4XY9A 5EPRA 4YYIA 3AADA 5D3RA 5DW1A 5DY7A 2DVVA 2RNXA 5C85A 4QZSA 4TTEA 5HRWA 5FBXA 4A9MA 4CLBA 4Z1QA 3GG3A 5EVAA 2RI7A 5DFDA 4TZ8A 4YATA 4BJXA 2L5EA 5CPEA 5C8GA 4YYGA 3MULA 5EWVA 5KTWA 5K29A 4N4GA 5F25A 5LJ1A 4UIVA 4YH4A 4UIUA 5BT3A 4QSXA 2YEMA 4TS8A 3SVFA 4O74A 4QR4A 4YK0A 3S91A 2DVSA 5BT5A 4ZC9A 4KV4A 5EV9A 1EQFA 5A82A 2RO1A 4PCEA 5HENA 4KCXA 4OGIA 5D0CA 4YBSA 4O75A 3MXFA 4NR9A 5I29A 4J0SA 4QUUA 5CY9A 4AKNA 4YYMA 3LQIA 4FLPA 5KO4A 4QBMA 5CQ4A 5ENEA 5EQ1A 5CUDA 3P1CA 3P1FA 5HQ7A 5FG6A 4O71A 4LZ2A 5KHMA 5DW2A 4CL9A 4HXMA 2YW5A 4ZW1A 5TB6A 4ALHA 3JVLA 3IU5A 2RNYA 5DBMA 3SVGA 4N3WA 5ENBA 4CUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R10 A;  4O70 A;  3Q2E A;  5ENJ A;  3MB4 A;  5AMF A;  5FE5 A;  5J0D A;  3UV2 A;  4QYL A;  5CQ8 A;  4MEP A;  5E9K A;  3O34 A;  5H1T A;  4NQN A;  5EU1 A;  2L84 A;  4NR6 A;  3FKM X;  3O37 A;  4XUB A;  5A85 A;  4YAX A;  3UVD A;  4A9L A;  4TYL A;  3JVJ A;  2R0Y A;  2OSS A;  5DKC A;  4LZR A;  4YBT A;  5I89 A;  4BW4 A;  4IR5 A;  5G4S A;  4UYF A;  5EK9 A;  5D3L A;  4A9H A;  4NYW A;  3SVH A;  3AQA A;  5A5N A;  2FSA A;  5D3P A;  2YQD A;  3TLP A;  4HBX A;  4LZS A;  4HXK A;  5EWC A;  3S92 A;  4MR4 A;  4N4H A;  5ENC A;  4O7A A;  5EPS A;  4QB3 A;  5FH6 A;  4UIX A;  3U5L A;  4CUP A;  4CUQ A;  4LDF A;  5A5Q A;  5A5S A;  4CUR A;  4N4I A;  1N72 A;  3JVM A;  4HXL A;  4LYW A;  5LKT A;  5I86 A;  4UIZ A;  5ENG A;  4NRB A;  5D26 A;  5D3J A;  4PTB A;  2GRC A;  4YY4 A;  3ONI A;  4C67 A;  4A9E A;  5H85 A;  5HCL A;  3LQJ A;  4CUT A;  4HXS A;  5CQT A;  5DYA A;  5FE4 A;  2LSP B;  4NQM A;  2RFJ A;  5C87 A;  5E9L A;  4C66 A;  5F5Z A;  2L85 A;  4WIV A;  1JSP B;  3UV5 A;  5II2 A;  5F2P A;  5I83 A;  4A9I A;  4CUU A;  5CUA A;  3O36 A;  5ENF A;  5IGM A;  4NYV A;  5HFR A;  4A9O A;  4QC3 A;  4QSP A;  4YYJ A;  5D3S A;  5FG4 A;  4TU6 A;  5LKZ A;  5CQ6 A;  5HEM A;  4NR4 A;  5COI A;  4PCI A;  5C4Q A;  3LJW A;  5ETB A;  4UYD A;  5FH7 A;  5FE9 A;  4HXR A;  5HLS A;  5FB1 A;  2MJV B;  5DFC A;  5H1U A;  2E3K A;  4LYS A;  4TT4 A;  3IU6 A;  3QZV A;  5FE1 A;  5EA1 A;  4NR5 A;  4QSS A;  3U5K A;  5CGP A;  4NUD A;  3DWY A;  3JVK A;  4UYH A;  5CFW A;  5I7X A;  1WUM A;  3QZS A;  4ZQL A;  4HXP A;  3RCW A;  5F3A A;  4QR3 A;  5F60 A;  5E7D A;  5FE0 A;  4HXN A;  5KTX A;  5LKX A;  5E9I A;  4BW1 A;  4CFL A;  5FH8 A;  5F36 A;  4NRC A;  5DLX A;  2WP1 A;  5A5R A;  2KTB B;  5BT4 A;  3UVX A;  4X2I A;  2F6J A;  4MR5 A;  5E0R A;  3D7C A;  4MR6 A;  5DFB A;  4O77 A;  2RNW A;  4IR6 A;  3O33 A;  3Q2F A;  1X0J A;  4LC2 A;  4NR7 A;  5DYX A;  5F62 A;  5FE6 A;  3U5O A;  3DAI A;  5D25 A;  3U5M A;  4QNS A;  4IOO A;  5L99 A;  5EWW A;  5HFQ A;  4HBV A;  4UIW A;  2DKW A;  4YC9 A;  5CQA A;  5IGK A;  5FE8 A;  5F1L A;  3I3J A;  5LJ2 A;  1WUG A;  2RS9 B;  4A9F A;  4Z93 A;  4KV1 A;  5IID A;  4TT2 A;  4YYD A;  5CRM A;  2YYN A;  5CUE A;  5A7C A;  5E9Y A;  3ZYU A;  4F3I A;  5HM0 A;  3MQM A;  4E96 A;  5A83 A;  5CQ5 A;  5D7X A;  5ENI A;  4A9N A;  4WHW A;  4O7E A;  5D3T A;  5CUG A;  4UYE A;  5FFV A;  2YEK A;  2DVR A;  5E9M A;  5FE3 A;  4IR3 A;  2H60 A;  2WP2 A;  5JI8 A;  3HMH A;  4LRG A;  5AD2 A;  3K2J A;  5EI4 A;  4OGJ A;  2G4A A;  4IOR A;  4QSQ A;  5DKD A;  4HBY A;  4IOQ A;  5DYU A;  4BW3 A;  5HRX A;  5LVR A;  5JWM A;  4MEQ A;  3U5N A;  5E3G A;  5A5O A;  5HQ5 A;  4LYI A;  5A5P A;  3O35 A;  3HMF A;  5CP5 A;  5IBN A;  5CS8 A;  4DON A;  4Z1S A;  2DWW A;  1JM4 B;  5D24 A;  4QEV A;  2OO1 A;  4XY8 A;  4N4F A;  4O7B A;  5I80 A;  4XUA A;  1ZS5 A;  4O72 A;  4PKL A;  5KU3 A;  4QR5 A;  2F6N A;  5KTU A;  4WHU A;  5F61 A;  5FFW A;  3UVW A;  2I8N A;  5D3H A;  5I7Y A;  3UVY A;  5L96 A;  5AD3 A;  5I88 A;  1F68 A;  5CUC A;  5E3D A;  5E9V A;  4YAD A;  5EWH A;  5A81 A;  4O78 A;  5ETD A;  3LQH A;  5CQ3 A;  3P1E A;  4YYH A;  2E7O A;  2YDW A;  4TU4 A;  4PY6 A;  5EGU A;  2YEL A;  4YBM A;  5FB0 A;  3U5P A;  4GPJ A;  2D82 A;  4PS5 A;  5EWD A;  2R0V A;  1E6I A;  2I7K A;  3P1D A;  3MB3 A;  4BHW A;  4TQN A;  5HRV A;  4Y03 A;  2R0S A;  5IGL A;  4QEU A;  4OUF A;  2N9G A;  5EP7 A;  4YH3 A;  4A9J A;  5L8U A;  4TT6 A;  4NYX A;  5LJ0 A;  3NXB A;  5FDZ A;  5FFY A;  5EPB A;  4O7C A;  5FE2 A;  4QSW A;  2DVQ A;  5DYC A;  5F1H A;  3UV4 A;  2OUO A;  4UIY A;  5AME A;  5C7N A;  4HXO A;  2D9E A;  5EIS A;  5L98 A;  4UYF B;  3P5O A;  5C89 A;  3UW9 A;  5LKU A;  5LUU A;  3QZT A;  5CUB A;  4LR6 A;  4J0R A;  2DAT A;  5DX4 A;  4IR4 A;  5E73 A;  2NXB A;  4J1P A;  5FE7 A;  5LVQ A;  4TZ2 A;  4YY6 A;  4A9K A;  5DKH A;  4XYA A;  3LXJ A;  4QSV A;  5CZG A;  5TCM A;  4QEW A;  4BW2 A;  4UYG A;  5I40 A;  4QYD A;  4Z6I A;  5ACY A;  2E7N A;  4ALG A;  4NUE A;  4QSU A;  5II1 A;  5HEL A;  3HME A;  4Q0N A;  5IGN A;  5CU8 A;  5EIC A;  4MR3 A;  5ENH A;  4NS5 A;  4NUC A;  4J3I A;  4CFK A;  4YAB A;  5F63 A;  4NXJ A;  5E74 A;  4QUT A;  4QY4 A;  3MUK A;  5CRZ A;  4Z6H A;  4QST A;  4YYK A;  3G0L A;  4Q0O A;  4NR8 A;  5IG6 A;  5EM3 A;  5HJC A;  5I1Q A;  5DLZ A;  5L97 A;  5D3N A;  4O7F A;  4UIT A;  4MEO A;  4NRA A;  5FG5 A;  5G4R A;  5HQ6 A;  3U5J A;  4O76 A;  3G0J A;  4HBW A;  4QSR A;  4YYN A;  5H1V A;  4QC1 A;  4MEN A;  4RVR A;  5CQ7 A;  5L8T A;  5CTL A;  4XY9 A;  5EPR A;  4YYI A;  3AAD A;  5D3R A;  5DW1 A;  5DY7 A;  2DVV A;  2RNX A;  5C85 A;  4QZS A;  4TTE A;  5HRW A;  5FBX A;  4A9M A;  4CLB A;  4Z1Q A;  3GG3 A;  5EVA A;  2RI7 A;  5DFD A;  4TZ8 A;  4YAT A;  4BJX A;  2L5E A;  5CPE A;  5C8G A;  4YYG A;  3MUL A;  5EWV A;  5KTW A;  5K29 A;  4N4G A;  5F25 A;  5LJ1 A;  4UIV A;  4YH4 A;  4UIU A;  5BT3 A;  4QSX A;  2YEM A;  4TS8 A;  3SVF A;  4O74 A;  4QR4 A;  4YK0 A;  3S91 A;  2DVS A;  5BT5 A;  4ZC9 A;  4KV4 A;  5EV9 A;  1EQF A;  5A82 A;  2RO1 A;  4PCE A;  5HEN A;  4KCX A;  4OGI A;  5D0C A;  4YBS A;  4O75 A;  3MXF A;  4NR9 A;  5I29 A;  4J0S A;  4QUU A;  5CY9 A;  4AKN A;  4YYM A;  3LQI A;  4FLP A;  5KO4 A;  4QBM A;  5CQ4 A;  5ENE A;  5EQ1 A;  5CUD A;  3P1C A;  3P1F A;  5HQ7 A;  5FG6 A;  4O71 A;  4LZ2 A;  5KHM A;  5DW2 A;  4CL9 A;  4HXM A;  2YW5 A;  4ZW1 A;  5TB6 A;  4ALH A;  3JVL A;  3IU5 A;  2RNY A;  5DBM A;  3SVG A;  4N3W A;  5ENB A;  4CUS A; 
#chains in the Genus database with same CATH topology
 2R10 A;  4O70 A;  3Q2E A;  5ENJ A;  3MB4 A;  5AMF A;  5FE5 A;  5J0D A;  3UV2 A;  4QYL A;  5CQ8 A;  4MEP A;  5E9K A;  3O34 A;  5H1T A;  4NQN A;  5EU1 A;  2L84 A;  4NR6 A;  3FKM X;  3O37 A;  4XUB A;  5A85 A;  4YAX A;  3UVD A;  4A9L A;  4TYL A;  3JVJ A;  2R0Y A;  2OSS A;  5DKC A;  4LZR A;  4YBT A;  5I89 A;  4BW4 A;  4IR5 A;  5G4S A;  4UYF A;  5EK9 A;  5D3L A;  4A9H A;  4NYW A;  3SVH A;  3AQA A;  5A5N A;  2FSA A;  5D3P A;  2YQD A;  3TLP A;  4HBX A;  4LZS A;  4HXK A;  5EWC A;  3S92 A;  4MR4 A;  4N4H A;  5ENC A;  4O7A A;  5EPS A;  4QB3 A;  5FH6 A;  4UIX A;  3U5L A;  4CUP A;  4CUQ A;  4LDF A;  4AKG A;  5A5Q A;  5A5S A;  4CUR A;  4N4I A;  1N72 A;  3JVM A;  4HXL A;  4LYW A;  5LKT A;  5I86 A;  4UIZ A;  5ENG A;  4NRB A;  5D26 A;  5D3J A;  4PTB A;  2GRC A;  4YY4 A;  3ONI A;  4C67 A;  4A9E A;  5H85 A;  5HCL A;  3LQJ A;  4CUT A;  4HXS A;  5CQT A;  5DYA A;  5FE4 A;  2LSP B;  4NQM A;  2RFJ A;  5C87 A;  5E9L A;  4C66 A;  5F5Z A;  2L85 A;  4WIV A;  1JSP B;  3UV5 A;  5II2 A;  5F2P A;  5I83 A;  4A9I A;  4CUU A;  5CUA A;  3O36 A;  5ENF A;  5IGM A;  4NYV A;  5HFR A;  4A9O A;  4QC3 A;  4QSP A;  4YYJ A;  5D3S A;  5FG4 A;  4TU6 A;  5LKZ A;  5CQ6 A;  5HEM A;  4NR4 A;  5COI A;  4PCI A;  5C4Q A;  3LJW A;  5ETB A;  4UYD A;  5FH7 A;  5FE9 A;  4HXR A;  5HLS A;  5FB1 A;  2MJV B;  5DFC A;  5H1U A;  2E3K A;  1PUO A;  4AKI A;  4LYS A;  4TT4 A;  3IU6 A;  3QZV A;  5FE1 A;  5EA1 A;  4NR5 A;  4QSS A;  3U5K A;  5CGP A;  4NUD A;  3DWY A;  3JVK A;  4UYH A;  5CFW A;  5I7X A;  1WUM A;  3QZS A;  4ZQL A;  4HXP A;  3RCW A;  5F3A A;  4QR3 A;  5F60 A;  5E7D A;  5FE0 A;  4HXN A;  5KTX A;  5LKX A;  5E9I A;  4BW1 A;  4CFL A;  5FH8 A;  5F36 A;  4NRC A;  5DLX A;  2WP1 A;  5A5R A;  2KTB B;  5BT4 A;  3UVX A;  4X2I A;  2F6J A;  4MR5 A;  5E0R A;  3D7C A;  4MR6 A;  5DFB A;  4O77 A;  2RNW A;  4IR6 A;  3O33 A;  3Q2F A;  1X0J A;  4LC2 A;  4NR7 A;  5DYX A;  5F62 A;  5FE6 A;  3U5O A;  3DAI A;  5D25 A;  3U5M A;  4QNS A;  4IOO A;  5L99 A;  5EWW A;  5HFQ A;  4HBV A;  4UIW A;  2DKW A;  4YC9 A;  5CQA A;  5IGK A;  5FE8 A;  5F1L A;  3I3J A;  5LJ2 A;  1WUG A;  2RS9 B;  4A9F A;  4Z93 A;  4KV1 A;  5IID A;  4TT2 A;  4YYD A;  5CRM A;  2YYN A;  5CUE A;  5A7C A;  5E9Y A;  3ZYU A;  4F3I A;  5HM0 A;  3MQM A;  4E96 A;  5A83 A;  5CQ5 A;  5D7X A;  5ENI A;  4A9N A;  4WHW A;  4O7E A;  5D3T A;  5CUG A;  4UYE A;  5FFV A;  2YEK A;  2EJN A;  2DVR A;  5E9M A;  5FE3 A;  4IR3 A;  2H60 A;  2WP2 A;  5JI8 A;  3HMH A;  4LRG A;  5AD2 A;  3K2J A;  5EI4 A;  4OGJ A;  2G4A A;  4IOR A;  4QSQ A;  5DKD A;  4HBY A;  4IOQ A;  5DYU A;  4BW3 A;  5HRX A;  5LVR A;  5JWM A;  4MEQ A;  3U5N A;  5E3G A;  5A5O A;  5HQ5 A;  4LYI A;  5A5P A;  3O35 A;  3HMF A;  5CP5 A;  5IBN A;  5CS8 A;  4DON A;  4Z1S A;  2DWW A;  1JM4 B;  5D24 A;  4QEV A;  2OO1 A;  4XY8 A;  4N4F A;  4O7B A;  5I80 A;  4XUA A;  1ZS5 A;  4O72 A;  4PKL A;  5KU3 A;  4QR5 A;  2F6N A;  5KTU A;  4WHU A;  5F61 A;  5FFW A;  3UVW A;  2I8N A;  5D3H A;  5I7Y A;  3UVY A;  5L96 A;  5AD3 A;  5I88 A;  1F68 A;  5CUC A;  5E3D A;  5E9V A;  4YAD A;  5EWH A;  5A81 A;  4O78 A;  5ETD A;  3LQH A;  5CQ3 A;  3P1E A;  4YYH A;  2E7O A;  2YDW A;  4TU4 A;  4PY6 A;  5EGU A;  2YEL A;  4YBM A;  5FB0 A;  3U5P A;  4GPJ A;  4AKH A;  2D82 A;  4PS5 A;  5EWD A;  2R0V A;  1E6I A;  2I7K A;  3P1D A;  3MB3 A;  4BHW A;  4TQN A;  5HRV A;  4Y03 A;  2R0S A;  5IGL A;  4QEU A;  4OUF A;  2N9G A;  5EP7 A;  4YH3 A;  4A9J A;  5L8U A;  4TT6 A;  4NYX A;  5LJ0 A;  3NXB A;  5FDZ A;  5FFY A;  5EPB A;  4O7C A;  5FE2 A;  4QSW A;  2DVQ A;  5DYC A;  5F1H A;  3UV4 A;  2OUO A;  4UIY A;  5AME A;  5C7N A;  4HXO A;  2D9E A;  5EIS A;  5L98 A;  3VKH A;  4UYF B;  3P5O A;  4AI6 A;  5C89 A;  3UW9 A;  5LKU A;  5LUU A;  3QZT A;  5CUB A;  4LR6 A;  3D1B A;  4J0R A;  2DAT A;  5DX4 A;  4IR4 A;  5E73 A;  2NXB A;  4J1P A;  5FE7 A;  5LVQ A;  4TZ2 A;  4YY6 A;  4A9K A;  5DKH A;  4XYA A;  3LXJ A;  4QSV A;  5CZG A;  5TCM A;  4QEW A;  4BW2 A;  4UYG A;  5I40 A;  4QYD A;  4Z6I A;  5ACY A;  2E7N A;  4ALG A;  4NUE A;  4QSU A;  5II1 A;  5HEL A;  3HME A;  4Q0N A;  5IGN A;  5CU8 A;  5EIC A;  4MR3 A;  5ENH A;  4NS5 A;  4NUC A;  4J3I A;  4CFK A;  4YAB A;  5F63 A;  4NXJ A;  5E74 A;  4QUT A;  4QY4 A;  3MUK A;  5CRZ A;  4Z6H A;  4QST A;  4YYK A;  3G0L A;  4Q0O A;  4NR8 A;  5IG6 A;  5EM3 A;  5HJC A;  5I1Q A;  5DLZ A;  5L97 A;  5D3N A;  4O7F A;  4UIT A;  4MEO A;  4NRA A;  5FG5 A;  5G4R A;  5HQ6 A;  3U5J A;  4O76 A;  3G0J A;  4HBW A;  4QSR A;  4YYN A;  5H1V A;  4QC1 A;  4MEN A;  4RVR A;  5CQ7 A;  5L8T A;  5CTL A;  4XY9 A;  5EPR A;  4YYI A;  3AAD A;  5D3R A;  5DW1 A;  5DY7 A;  2DVV A;  2RNX A;  5C85 A;  4QZS A;  4TTE A;  5HRW A;  5FBX A;  4A9M A;  4CLB A;  4Z1Q A;  3GG3 A;  5EVA A;  2RI7 A;  5DFD A;  4TZ8 A;  4YAT A;  4BJX A;  3D1D A;  2L5E A;  5CPE A;  5C8G A;  4YYG A;  3MUL A;  5EWV A;  5KTW A;  5K29 A;  4N4G A;  5F25 A;  5LJ1 A;  4UIV A;  4YH4 A;  4UIU A;  5BT3 A;  4QSX A;  2YEM A;  4TS8 A;  3SVF A;  4O74 A;  4QR4 A;  4YK0 A;  3S91 A;  2DVS A;  5BT5 A;  4ZC9 A;  4KV4 A;  5EV9 A;  1EQF A;  5A82 A;  2RO1 A;  4PCE A;  3ERR A;  3VKG A;  5HEN A;  4KCX A;  4OGI A;  5D0C A;  4YBS A;  4O75 A;  3MXF A;  4NR9 A;  5I29 A;  4J0S A;  4QUU A;  5CY9 A;  4AKN A;  4YYM A;  3LQI A;  1ZKR A;  4FLP A;  5KO4 A;  4QBM A;  5CQ4 A;  5ENE A;  5EQ1 A;  5CUD A;  3P1C A;  3P1F A;  5HQ7 A;  5FG6 A;  4O71 A;  4LZ2 A;  5KHM A;  5DW2 A;  4CL9 A;  4HXM A;  2YW5 A;  4ZW1 A;  5TB6 A;  4ALH A;  3JVL A;  3IU5 A;  2RNY A;  5DBM A;  3SVG A;  4N3W A;  5ENB A;  4CUS A; 
#chains in the Genus database with same CATH homology
 2R10 A;  4O70 A;  3Q2E A;  5ENJ A;  3MB4 A;  5AMF A;  5FE5 A;  5J0D A;  3UV2 A;  4QYL A;  5CQ8 A;  4MEP A;  5E9K A;  3O34 A;  5H1T A;  4NQN A;  5EU1 A;  2L84 A;  4NR6 A;  3FKM X;  3O37 A;  4XUB A;  5A85 A;  4YAX A;  3UVD A;  4A9L A;  4TYL A;  3JVJ A;  2R0Y A;  2OSS A;  5DKC A;  4LZR A;  4YBT A;  5I89 A;  4BW4 A;  4IR5 A;  5G4S A;  4UYF A;  5EK9 A;  5D3L A;  4A9H A;  4NYW A;  3SVH A;  3AQA A;  5A5N A;  2FSA A;  5D3P A;  2YQD A;  3TLP A;  4HBX A;  4LZS A;  4HXK A;  5EWC A;  3S92 A;  4MR4 A;  4N4H A;  5ENC A;  4O7A A;  5EPS A;  4QB3 A;  5FH6 A;  4UIX A;  3U5L A;  4CUP A;  4CUQ A;  4LDF A;  5A5Q A;  5A5S A;  4CUR A;  4N4I A;  1N72 A;  3JVM A;  4HXL A;  4LYW A;  5LKT A;  5I86 A;  4UIZ A;  5ENG A;  4NRB A;  5D26 A;  5D3J A;  4PTB A;  2GRC A;  4YY4 A;  3ONI A;  4C67 A;  4A9E A;  5H85 A;  5HCL A;  3LQJ A;  4CUT A;  4HXS A;  5CQT A;  5DYA A;  5FE4 A;  2LSP B;  4NQM A;  2RFJ A;  5C87 A;  5E9L A;  4C66 A;  5F5Z A;  2L85 A;  4WIV A;  1JSP B;  3UV5 A;  5II2 A;  5F2P A;  5I83 A;  4A9I A;  4CUU A;  5CUA A;  3O36 A;  5ENF A;  5IGM A;  4NYV A;  5HFR A;  4A9O A;  4QC3 A;  4QSP A;  4YYJ A;  5D3S A;  5FG4 A;  4TU6 A;  5LKZ A;  5CQ6 A;  5HEM A;  4NR4 A;  5COI A;  4PCI A;  5C4Q A;  3LJW A;  5ETB A;  4UYD A;  5FH7 A;  5FE9 A;  4HXR A;  5HLS A;  5FB1 A;  2MJV B;  5DFC A;  5H1U A;  2E3K A;  4LYS A;  4TT4 A;  3IU6 A;  3QZV A;  5FE1 A;  5EA1 A;  4NR5 A;  4QSS A;  3U5K A;  5CGP A;  4NUD A;  3DWY A;  3JVK A;  4UYH A;  5CFW A;  5I7X A;  1WUM A;  3QZS A;  4ZQL A;  4HXP A;  3RCW A;  5F3A A;  4QR3 A;  5F60 A;  5E7D A;  5FE0 A;  4HXN A;  5KTX A;  5LKX A;  5E9I A;  4BW1 A;  4CFL A;  5FH8 A;  5F36 A;  4NRC A;  5DLX A;  2WP1 A;  5A5R A;  2KTB B;  5BT4 A;  3UVX A;  4X2I A;  2F6J A;  4MR5 A;  5E0R A;  3D7C A;  4MR6 A;  5DFB A;  4O77 A;  2RNW A;  4IR6 A;  3O33 A;  3Q2F A;  1X0J A;  4LC2 A;  4NR7 A;  5DYX A;  5F62 A;  5FE6 A;  3U5O A;  3DAI A;  5D25 A;  3U5M A;  4QNS A;  4IOO A;  5L99 A;  5EWW A;  5HFQ A;  4HBV A;  4UIW A;  2DKW A;  4YC9 A;  5CQA A;  5IGK A;  5FE8 A;  5F1L A;  3I3J A;  5LJ2 A;  1WUG A;  2RS9 B;  4A9F A;  4Z93 A;  4KV1 A;  5IID A;  4TT2 A;  4YYD A;  5CRM A;  2YYN A;  5CUE A;  5A7C A;  5E9Y A;  3ZYU A;  4F3I A;  5HM0 A;  3MQM A;  4E96 A;  5A83 A;  5CQ5 A;  5D7X A;  5ENI A;  4A9N A;  4WHW A;  4O7E A;  5D3T A;  5CUG A;  4UYE A;  5FFV A;  2YEK A;  2DVR A;  5E9M A;  5FE3 A;  4IR3 A;  2H60 A;  2WP2 A;  5JI8 A;  3HMH A;  4LRG A;  5AD2 A;  3K2J A;  5EI4 A;  4OGJ A;  2G4A A;  4IOR A;  4QSQ A;  5DKD A;  4HBY A;  4IOQ A;  5DYU A;  4BW3 A;  5HRX A;  5LVR A;  5JWM A;  4MEQ A;  3U5N A;  5E3G A;  5A5O A;  5HQ5 A;  4LYI A;  5A5P A;  3O35 A;  3HMF A;  5CP5 A;  5IBN A;  5CS8 A;  4DON A;  4Z1S A;  2DWW A;  1JM4 B;  5D24 A;  4QEV A;  2OO1 A;  4XY8 A;  4N4F A;  4O7B A;  5I80 A;  4XUA A;  1ZS5 A;  4O72 A;  4PKL A;  5KU3 A;  4QR5 A;  2F6N A;  5KTU A;  4WHU A;  5F61 A;  5FFW A;  3UVW A;  2I8N A;  5D3H A;  5I7Y A;  3UVY A;  5L96 A;  5AD3 A;  5I88 A;  1F68 A;  5CUC A;  5E3D A;  5E9V A;  4YAD A;  5EWH A;  5A81 A;  4O78 A;  5ETD A;  3LQH A;  5CQ3 A;  3P1E A;  4YYH A;  2E7O A;  2YDW A;  4TU4 A;  4PY6 A;  5EGU A;  2YEL A;  4YBM A;  5FB0 A;  3U5P A;  4GPJ A;  2D82 A;  4PS5 A;  5EWD A;  2R0V A;  1E6I A;  2I7K A;  3P1D A;  3MB3 A;  4BHW A;  4TQN A;  5HRV A;  4Y03 A;  2R0S A;  5IGL A;  4QEU A;  4OUF A;  2N9G A;  5EP7 A;  4YH3 A;  4A9J A;  5L8U A;  4TT6 A;  4NYX A;  5LJ0 A;  3NXB A;  5FDZ A;  5FFY A;  5EPB A;  4O7C A;  5FE2 A;  4QSW A;  2DVQ A;  5DYC A;  5F1H A;  3UV4 A;  2OUO A;  4UIY A;  5AME A;  5C7N A;  4HXO A;  2D9E A;  5EIS A;  5L98 A;  4UYF B;  3P5O A;  5C89 A;  3UW9 A;  5LKU A;  5LUU A;  3QZT A;  5CUB A;  4LR6 A;  4J0R A;  2DAT A;  5DX4 A;  4IR4 A;  5E73 A;  2NXB A;  4J1P A;  5FE7 A;  5LVQ A;  4TZ2 A;  4YY6 A;  4A9K A;  5DKH A;  4XYA A;  3LXJ A;  4QSV A;  5CZG A;  5TCM A;  4QEW A;  4BW2 A;  4UYG A;  5I40 A;  4QYD A;  4Z6I A;  5ACY A;  2E7N A;  4ALG A;  4NUE A;  4QSU A;  5II1 A;  5HEL A;  3HME A;  4Q0N A;  5IGN A;  5CU8 A;  5EIC A;  4MR3 A;  5ENH A;  4NS5 A;  4NUC A;  4J3I A;  4CFK A;  4YAB A;  5F63 A;  4NXJ A;  5E74 A;  4QUT A;  4QY4 A;  3MUK A;  5CRZ A;  4Z6H A;  4QST A;  4YYK A;  3G0L A;  4Q0O A;  4NR8 A;  5IG6 A;  5EM3 A;  5HJC A;  5I1Q A;  5DLZ A;  5L97 A;  5D3N A;  4O7F A;  4UIT A;  4MEO A;  4NRA A;  5FG5 A;  5G4R A;  5HQ6 A;  3U5J A;  4O76 A;  3G0J A;  4HBW A;  4QSR A;  4YYN A;  5H1V A;  4QC1 A;  4MEN A;  4RVR A;  5CQ7 A;  5L8T A;  5CTL A;  4XY9 A;  5EPR A;  4YYI A;  3AAD A;  5D3R A;  5DW1 A;  5DY7 A;  2DVV A;  2RNX A;  5C85 A;  4QZS A;  4TTE A;  5HRW A;  5FBX A;  4A9M A;  4CLB A;  4Z1Q A;  3GG3 A;  5EVA A;  2RI7 A;  5DFD A;  4TZ8 A;  4YAT A;  4BJX A;  2L5E A;  5CPE A;  5C8G A;  4YYG A;  3MUL A;  5EWV A;  5KTW A;  5K29 A;  4N4G A;  5F25 A;  5LJ1 A;  4UIV A;  4YH4 A;  4UIU A;  5BT3 A;  4QSX A;  2YEM A;  4TS8 A;  3SVF A;  4O74 A;  4QR4 A;  4YK0 A;  3S91 A;  2DVS A;  5BT5 A;  4ZC9 A;  4KV4 A;  5EV9 A;  1EQF A;  5A82 A;  2RO1 A;  4PCE A;  5HEN A;  4KCX A;  4OGI A;  5D0C A;  4YBS A;  4O75 A;  3MXF A;  4NR9 A;  5I29 A;  4J0S A;  4QUU A;  5CY9 A;  4AKN A;  4YYM A;  3LQI A;  4FLP A;  5KO4 A;  4QBM A;  5CQ4 A;  5ENE A;  5EQ1 A;  5CUD A;  3P1C A;  3P1F A;  5HQ7 A;  5FG6 A;  4O71 A;  4LZ2 A;  5KHM A;  5DW2 A;  4CL9 A;  4HXM A;  2YW5 A;  4ZW1 A;  5TB6 A;  4ALH A;  3JVL A;  3IU5 A;  2RNY A;  5DBM A;  3SVG A;  4N3W A;  5ENB A;  4CUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...