1JSPB

Nmr structure of cbp bromodomain in complex with p53 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
b'GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords tumor protein p53
publication title Structural mechanism of the bromodomain of the coactivator CBP in p53 transcriptional activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2001-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1jspB00
4CURA 4O78A 4QC1A 4TTEA 3U5MA 5A5NA 3UV2A 5IGKA 4XUAA 4N3WA 4CUSA 1JM4B 5HFQA 5F36A 5KHMA 4CFLA 4KCXA 5E9LA 5FDZA 3U5PA 5K29A 3JVMA 5EU1A 4TT4A 5F2PA 5LJ1A 5ENJA 4CL9A 4TS8A 4YH4A 1N72A 5IGLA 5CUAA 5CTLA 2D9EA 4QSSA 2GRCA 5DW2A 2E7OA 4QSRA 5CS8A 4YYMA 2DWWA 5EPRA 4ZC9A 4O75A 4NR7A 4MENA 2RI7A 5EICA 3MULA 4PCEA 5FE6A 5D3SA 4F3IA 3MB4A 4XUBA 5EI4A 5HEMA 4QSXA 2L85A 2DVRA 4QYLA 4QSUA 4NS5A 4A9EA 4WHWA 2F6NA 4TT6A 5FFWA 5CU8A 3IU6A 5G4RA 3NXBA 5FE3A 2E7NA 4QSTA 4YY6A 5HCLA 5EWVA 4NR8A 5DFBA 4TU4A 5A7CA 5KU3A 3AADA 3MB3A 4QC3A 4LZ2A 4CLBA 5H1TA 4CFKA 3LQHA 4O74A 4WHUA 5BT5A 5IGMA 4O72A 4LZRA 5E9YA 5DLZA 5ENIA 4A9OA 4C66A 5COIA 3LQJA 4IORA 4C67A 3IU5A 4IR5A 3ZYUA 3RCWA 5EWHA 4YYNA 3JVKA 4HXOA 5DYAA 5HLSA 2YYNA 3O33A 3HMHA 5A5PA 2OO1A 4QUTA 4QEWA 2DATA 2L5EA 5EP7A 5F61A 3HMFA 4YH3A 4UIXA 5F1HA 5FFYA 5I29A 3D7CA 4GPJA 4KV4A 5KO4A 2YQDA 5G4SA 5C8GA 4NR9A 2OSSA 3SVHA 5TB6A 2H60A 5F63A 4LRGA 4A9MA 2DKWA 4O7FA 5FBXA 4NXJA 5EVAA 2DVQA 4O7BA 4A9FA 5CZGA 3AQAA 5C4QA 5EA1A 4O76A 5EK9A 5BT4A 5DKDA 4CUQA 2WP2A 4UYFA 5ENEA 5L98A 5HQ5A 3U5NA 2E3KA 4MEQA 4N4FA 5E74A 5HENA 2MJVB 5HQ6A 4IOQA 3JVJA 5FFVA 5CUBA 5ENCA 5CGPA 2RS9B 4YAXA 4A9NA 4YBMA 3I3JA 5FB1A 3O37A 4N4HA 3P1DA 5L96A 5A81A 5F60A 2RNWA 5FE7A 3U5JA 5HRVA 5CUGA 3DAIA 5DYXA 5EISA 5D26A 5I80A 5FH7A 5CQ7A 5EGUA 3U5LA 4J0SA 4QEVA 5FG6A 3Q2FA 5D3RA 4YYHA 4IOOA 5CQ3A 3SVFA 4YABA 5EWWA 4HBXA 4QSQA 4YATA 2WP1A 4QUUA 4BW4A 5F1LA 5EQ1A 5ENBA 1EQFA 2RO1A 4UIZA 5I40A 5DKCA 4UYHA 4O71A 5AD3A 3ONIA 2RNYA 4BW2A 5D3TA 5F3AA 5E73A 5HQ7A 5A5RA 3O34A 5D3LA 3UVDA 5IBNA 4UYEA 5CRMA 2R10A 4NRBA 2R0YA 5CQ5A 4YYDA 5FE0A 5FH8A 4OGIA 4A9KA 4E96A 4QSPA 4RVRA 4IR6A 4TYLA 5CQAA 5JI8A 5C89A 5CUCA 4KV1A 5IIDA 5EWCA 4O70A 4HXRA 4UYGA 3Q2EA 5KTXA 5HELA 5FE2A 5I89A 5LVQA 3G0LA 5FB0A 4CUPA 4NQNA 5LKUA 5CFWA 2DVSA 5L97A 1E6IA 5EV9A 4NUDA 2YEMA 4Z1SA 4J1PA 5ENFA 5LVRA 4MR5A 5BT3A 1JSPB 4MR6A 4QY4A 5FE9A 5ETBA 5HRWA 3MUKA 5E3GA 5F5ZA 4XYAA 4NRCA 2G4AA 4QSWA 4TZ8A 4LC2A 5CPEA 5D3HA 3U5OA 4N4GA 5CQ4A 4A9JA 1WUMA 3P1EA 5DW1A 4Z6IA 4QZSA 5KTUA 4YK0A 5LUUA 5II1A 4QNSA 2D82A 2DVVA 4YADA 5FE8A 5D24A 5E9VA 5I7YA 5H1UA 5LKTA 4NUCA 5D3NA 3K2JA 2KTBB 4NR4A 5CUDA 5DLXA 5FE5A 5CP5A 5LKXA 5FG5A 4UYDA 3LQIA 5E9IA 5D7XA 4LYWA 4PTBA 5HJCA 3MQMA 4IR4A 4MR3A 5CRZA 4UITA 3UVYA 4PCIA 4QSVA 5D3JA 5ETDA 3S92A 5J0DA 4NR5A 4A9HA 4MR4A 4Q0OA 4J0RA 5LJ2A 4HXNA 4UYFB 4YC9A 4TU6A 4TT2A 3MXFA 4UIWA 4HBYA 5L8TA 2YEKA 4LZSA 5A82A 4IR3A 5HFRA 5C7NA 4NR6A 5CY9A 4NQMA 3P1CA 4TZ2A 3HMEA 2I8NA 4BHWA 4BW3A 4UIUA 4YYJA 5E3DA 3O36A 5LJ0A 5JWMA 4X2IA 1WUGA 5F25A 5KTWA 1X0JA 3SVGA 3UV4A 4ZQLA 3QZSA 4CUUA 4YYIA 4O7CA 5H1VA 5AMEA 4MEPA 3TLPA 4QYDA 5CQTA 5FG4A 5E0RA 2LSPB 3UW9A 5DY7A 4LYSA 5AMFA 5A5OA 5D3PA 5E9KA 5EM3A 5AD2A 4ALGA 3JVLA 2YDWA 4YYKA 4A9IA 3S91A 3LJWA 4HXMA 5H85A 1F68A 2NXBA 5IG6A 3G0JA 2R0VA 5C85A 5DYCA 4O7EA 5ENHA 4MEOA 5EPBA 3GG3A 5DBMA 4BJXA 5C87A 4AKNA 4UIVA 5EWDA 4UIYA 5DKHA 4HXSA 5A85A 5I7XA 4CUTA 5II2A 5IGNA 5I86A 4LYIA 4YYGA 5TCMA 5E9MA 5A5QA 4YY4A 4HBWA 4O77A 4N4IA 3P5OA 5A5SA 4QR5A 3UVWA 2YW5A 3DWYA 2OUOA 4HXKA 5I1QA 4A9LA 2FSAA 2N9GA 4HXPA 4Z93A 4NUEA 4WIVA 4YBSA 5CUEA 5CQ8A 5FH6A 4HXLA 4QEUA 4OUFA 4ALHA 2RFJA 2I7KA 3P1FA 5L99A 5HM0A 4XY9A 4O7AA 2RNXA 4NRAA 5CQ6A 5A83A 4XY8A 4Z1QA 4LDFA 4QB3A 4NYVA 3O35A 3LXJA 4QR4A 4DONA 2F6JA 4HBVA 4Q0NA 4LR6A 5I83A 2R0SA 3QZTA 4TQNA 3QZVA 4NYWA 5DFDA 4Z6HA 5L8UA 5DYUA 4OGJA 5EPSA 4PKLA 4FLPA 4PY6A 2L84A 3FKMX 5ENGA 5F62A 3UVXA 4Y03A 5FE4A 3UV5A 1ZS5A 5I88A 4NYXA 4J3IA 5HRXA 4QR3A 5DX4A 4BW1A 3U5KA 4QBMA 5FE1A 4ZW1A 5ACYA 2YELA 4YBTA 5D25A 5LKZA 5DFCA 5D0CA 4PS5A 5E7DA
chains in the Genus database with same CATH superfamily
4CURA 4O78A 4QC1A 4TTEA 3U5MA 5A5NA 3UV2A 5IGKA 4XUAA 4N3WA 4CUSA 1JM4B 5HFQA 5F36A 5KHMA 4CFLA 4KCXA 5E9LA 5FDZA 3U5PA 5K29A 3JVMA 5EU1A 4TT4A 5F2PA 5LJ1A 5ENJA 4CL9A 4TS8A 4YH4A 1N72A 5IGLA 5CUAA 5CTLA 4AKIA 2D9EA 4QSSA 2GRCA 5DW2A 2E7OA 4QSRA 5CS8A 4YYMA 2DWWA 5EPRA 4ZC9A 4O75A 4NR7A 4MENA 2RI7A 5EICA 3MULA 4PCEA 5FE6A 5D3SA 4F3IA 3MB4A 4XUBA 5EI4A 5HEMA 4QSXA 2L85A 2DVRA 4QYLA 4QSUA 4NS5A 4A9EA 4WHWA 2F6NA 4TT6A 5FFWA 5CU8A 3IU6A 5G4RA 3NXBA 5FE3A 2E7NA 4QSTA 4YY6A 5HCLA 5EWVA 4NR8A 5DFBA 4TU4A 5A7CA 5KU3A 3VKHA 3AADA 3MB3A 4QC3A 4LZ2A 4CLBA 5H1TA 4CFKA 3LQHA 4O74A 4WHUA 5BT5A 5IGMA 4O72A 4LZRA 5E9YA 5DLZA 5ENIA 4A9OA 4C66A 5COIA 3LQJA 4IORA 4C67A 3IU5A 4IR5A 3ZYUA 3RCWA 5EWHA 4YYNA 3ERRA 3JVKA 4HXOA 5DYAA 5HLSA 2YYNA 3O33A 3HMHA 5A5PA 2OO1A 4QUTA 4QEWA 2DATA 2L5EA 5EP7A 5F61A 3HMFA 4YH3A 4UIXA 3D1DA 5F1HA 5FFYA 5I29A 3D7CA 4GPJA 4KV4A 5KO4A 2YQDA 5G4SA 5C8GA 4NR9A 2OSSA 3SVHA 5TB6A 2H60A 5F63A 4LRGA 4A9MA 2DKWA 4O7FA 5FBXA 4NXJA 5EVAA 2DVQA 4O7BA 4A9FA 5CZGA 3AQAA 5C4QA 5EA1A 4O76A 5EK9A 5BT4A 5DKDA 4CUQA 2WP2A 4UYFA 5ENEA 5L98A 5HQ5A 3U5NA 2E3KA 4MEQA 4N4FA 5E74A 5HENA 2MJVB 5HQ6A 4IOQA 3JVJA 5FFVA 5CUBA 5ENCA 5CGPA 2RS9B 4YAXA 4A9NA 4YBMA 3I3JA 5FB1A 3O37A 4N4HA 3P1DA 5L96A 5A81A 5F60A 2RNWA 5FE7A 3U5JA 5HRVA 5CUGA 3DAIA 5DYXA 5EISA 5D26A 5I80A 5FH7A 5CQ7A 5EGUA 3U5LA 4J0SA 4QEVA 5FG6A 3Q2FA 5D3RA 4YYHA 4IOOA 5CQ3A 3SVFA 4YABA 5EWWA 4HBXA 4QSQA 4YATA 2WP1A 4QUUA 4BW4A 5F1LA 5EQ1A 5ENBA 1EQFA 2RO1A 4UIZA 5I40A 5DKCA 4UYHA 4O71A 5AD3A 3ONIA 2RNYA 4BW2A 5D3TA 5F3AA 5E73A 5HQ7A 5A5RA 3O34A 5D3LA 3UVDA 5IBNA 4UYEA 5CRMA 2R10A 4NRBA 2R0YA 5CQ5A 4YYDA 5FE0A 5FH8A 4OGIA 4A9KA 4E96A 4QSPA 4RVRA 4IR6A 4TYLA 5CQAA 5JI8A 5C89A 4AI6A 5CUCA 4KV1A 5IIDA 5EWCA 4O70A 4HXRA 4UYGA 3Q2EA 5KTXA 5HELA 5FE2A 5I89A 5LVQA 3G0LA 5FB0A 4CUPA 4NQNA 5LKUA 5CFWA 2DVSA 5L97A 1E6IA 5EV9A 4NUDA 2YEMA 4Z1SA 4J1PA 5ENFA 5LVRA 4MR5A 5BT3A 1JSPB 4MR6A 4QY4A 5FE9A 5ETBA 5HRWA 3MUKA 5E3GA 5F5ZA 4XYAA 4NRCA 2G4AA 4QSWA 4TZ8A 4LC2A 5CPEA 5D3HA 3U5OA 4N4GA 5CQ4A 4A9JA 1WUMA 3P1EA 5DW1A 4Z6IA 4QZSA 5KTUA 4YK0A 5LUUA 5II1A 4QNSA 2D82A 2DVVA 4YADA 5FE8A 5D24A 5E9VA 5I7YA 5H1UA 5LKTA 4NUCA 5D3NA 3K2JA 2KTBB 4NR4A 5CUDA 5DLXA 5FE5A 5CP5A 5LKXA 5FG5A 4UYDA 3LQIA 5E9IA 5D7XA 4LYWA 4PTBA 5HJCA 3MQMA 4IR4A 4MR3A 5CRZA 3VKGA 4UITA 3UVYA 4PCIA 4QSVA 5D3JA 5ETDA 3S92A 5J0DA 4NR5A 4A9HA 4MR4A 4AKGA 4Q0OA 4J0RA 5LJ2A 4HXNA 3D1BA 4UYFB 4YC9A 4TU6A 4TT2A 3MXFA 4UIWA 4HBYA 5L8TA 2YEKA 4LZSA 5A82A 4IR3A 5HFRA 5C7NA 4NR6A 5CY9A 4NQMA 3P1CA 4TZ2A 3HMEA 2I8NA 4BHWA 4BW3A 4UIUA 4YYJA 5E3DA 3O36A 5LJ0A 5JWMA 4X2IA 1WUGA 5F25A 5KTWA 1X0JA 3SVGA 3UV4A 4ZQLA 3QZSA 4CUUA 4YYIA 4O7CA 5H1VA 5AMEA 4MEPA 3TLPA 4QYDA 5CQTA 5FG4A 5E0RA 2LSPB 3UW9A 5DY7A 4LYSA 5AMFA 5A5OA 5D3PA 5E9KA 5EM3A 5AD2A 4ALGA 3JVLA 2YDWA 4YYKA 4A9IA 3S91A 3LJWA 4HXMA 5H85A 1F68A 2NXBA 5IG6A 1ZKRA 3G0JA 2R0VA 5C85A 5DYCA 4O7EA 5ENHA 4MEOA 5EPBA 3GG3A 5DBMA 4BJXA 5C87A 4AKNA 4UIVA 5EWDA 4UIYA 5DKHA 4HXSA 5A85A 5I7XA 4CUTA 5II2A 1PUOA 5IGNA 5I86A 4LYIA 4YYGA 5TCMA 5E9MA 5A5QA 4YY4A 4HBWA 4O77A 4N4IA 3P5OA 5A5SA 4QR5A 3UVWA 2YW5A 4AKHA 3DWYA 2OUOA 4HXKA 5I1QA 4A9LA 2FSAA 2N9GA 4HXPA 4Z93A 4NUEA 4WIVA 4YBSA 5CUEA 5CQ8A 5FH6A 4HXLA 4QEUA 4OUFA 4ALHA 2RFJA 2I7KA 3P1FA 5L99A 5HM0A 4XY9A 4O7AA 2RNXA 4NRAA 5CQ6A 5A83A 4XY8A 4Z1QA 4LDFA 4QB3A 4NYVA 3O35A 3LXJA 4QR4A 4DONA 2F6JA 4HBVA 4Q0NA 4LR6A 5I83A 2R0SA 3QZTA 4TQNA 3QZVA 2EJNA 4NYWA 5DFDA 4Z6HA 5L8UA 5DYUA 4OGJA 5EPSA 4PKLA 4FLPA 4PY6A 2L84A 3FKMX 5ENGA 5F62A 3UVXA 4Y03A 5FE4A 3UV5A 1ZS5A 5I88A 4NYXA 4J3IA 5HRXA 4QR3A 5DX4A 4BW1A 3U5KA 4QBMA 5FE1A 4ZW1A 5ACYA 2YELA 4YBTA 5D25A 5LKZA 5DFCA 5D0CA 4PS5A 5E7DA
chains in the Genus database with same CATH topology
4CURA 4O78A 4QC1A 4TTEA 3U5MA 5A5NA 3UV2A 5IGKA 4XUAA 4N3WA 4CUSA 1JM4B 5HFQA 5F36A 5KHMA 4CFLA 4KCXA 5E9LA 5FDZA 3U5PA 5K29A 3JVMA 5EU1A 4TT4A 5F2PA 5LJ1A 5ENJA 4CL9A 4TS8A 4YH4A 1N72A 5IGLA 5CUAA 5CTLA 2D9EA 4QSSA 2GRCA 5DW2A 2E7OA 4QSRA 5CS8A 4YYMA 2DWWA 5EPRA 4ZC9A 4O75A 4NR7A 4MENA 2RI7A 5EICA 3MULA 4PCEA 5FE6A 5D3SA 4F3IA 3MB4A 4XUBA 5EI4A 5HEMA 4QSXA 2L85A 2DVRA 4QYLA 4QSUA 4NS5A 4A9EA 4WHWA 2F6NA 4TT6A 5FFWA 5CU8A 3IU6A 5G4RA 3NXBA 5FE3A 2E7NA 4QSTA 4YY6A 5HCLA 5EWVA 4NR8A 5DFBA 4TU4A 5A7CA 5KU3A 3AADA 3MB3A 4QC3A 4LZ2A 4CLBA 5H1TA 4CFKA 3LQHA 4O74A 4WHUA 5BT5A 5IGMA 4O72A 4LZRA 5E9YA 5DLZA 5ENIA 4A9OA 4C66A 5COIA 3LQJA 4IORA 4C67A 3IU5A 4IR5A 3ZYUA 3RCWA 5EWHA 4YYNA 3JVKA 4HXOA 5DYAA 5HLSA 2YYNA 3O33A 3HMHA 5A5PA 2OO1A 4QUTA 4QEWA 2DATA 2L5EA 5EP7A 5F61A 3HMFA 4YH3A 4UIXA 5F1HA 5FFYA 5I29A 3D7CA 4GPJA 4KV4A 5KO4A 2YQDA 5G4SA 5C8GA 4NR9A 2OSSA 3SVHA 5TB6A 2H60A 5F63A 4LRGA 4A9MA 2DKWA 4O7FA 5FBXA 4NXJA 5EVAA 2DVQA 4O7BA 4A9FA 5CZGA 3AQAA 5C4QA 5EA1A 4O76A 5EK9A 5BT4A 5DKDA 4CUQA 2WP2A 4UYFA 5ENEA 5L98A 5HQ5A 3U5NA 2E3KA 4MEQA 4N4FA 5E74A 5HENA 2MJVB 5HQ6A 4IOQA 3JVJA 5FFVA 5CUBA 5ENCA 5CGPA 2RS9B 4YAXA 4A9NA 4YBMA 3I3JA 5FB1A 3O37A 4N4HA 3P1DA 5L96A 5A81A 5F60A 2RNWA 5FE7A 3U5JA 5HRVA 5CUGA 3DAIA 5DYXA 5EISA 5D26A 5I80A 5FH7A 5CQ7A 5EGUA 3U5LA 4J0SA 4QEVA 5FG6A 3Q2FA 5D3RA 4YYHA 4IOOA 5CQ3A 3SVFA 4YABA 5EWWA 4HBXA 4QSQA 4YATA 2WP1A 4QUUA 4BW4A 5F1LA 5EQ1A 5ENBA 1EQFA 2RO1A 4UIZA 5I40A 5DKCA 4UYHA 4O71A 5AD3A 3ONIA 2RNYA 4BW2A 5D3TA 5F3AA 5E73A 5HQ7A 5A5RA 3O34A 5D3LA 3UVDA 5IBNA 4UYEA 5CRMA 2R10A 4NRBA 2R0YA 5CQ5A 4YYDA 5FE0A 5FH8A 4OGIA 4A9KA 4E96A 4QSPA 4RVRA 4IR6A 4TYLA 5CQAA 5JI8A 5C89A 5CUCA 4KV1A 5IIDA 5EWCA 4O70A 4HXRA 4UYGA 3Q2EA 5KTXA 5HELA 5FE2A 5I89A 5LVQA 3G0LA 5FB0A 4CUPA 4NQNA 5LKUA 5CFWA 2DVSA 5L97A 1E6IA 5EV9A 4NUDA 2YEMA 4Z1SA 4J1PA 5ENFA 5LVRA 4MR5A 5BT3A 1JSPB 4MR6A 4QY4A 5FE9A 5ETBA 5HRWA 3MUKA 5E3GA 5F5ZA 4XYAA 4NRCA 2G4AA 4QSWA 4TZ8A 4LC2A 5CPEA 5D3HA 3U5OA 4N4GA 5CQ4A 4A9JA 1WUMA 3P1EA 5DW1A 4Z6IA 4QZSA 5KTUA 4YK0A 5LUUA 5II1A 4QNSA 2D82A 2DVVA 4YADA 5FE8A 5D24A 5E9VA 5I7YA 5H1UA 5LKTA 4NUCA 5D3NA 3K2JA 2KTBB 4NR4A 5CUDA 5DLXA 5FE5A 5CP5A 5LKXA 5FG5A 4UYDA 3LQIA 5E9IA 5D7XA 4LYWA 4PTBA 5HJCA 3MQMA 4IR4A 4MR3A 5CRZA 4UITA 3UVYA 4PCIA 4QSVA 5D3JA 5ETDA 3S92A 5J0DA 4NR5A 4A9HA 4MR4A 4Q0OA 4J0RA 5LJ2A 4HXNA 4UYFB 4YC9A 4TU6A 4TT2A 3MXFA 4UIWA 4HBYA 5L8TA 2YEKA 4LZSA 5A82A 4IR3A 5HFRA 5C7NA 4NR6A 5CY9A 4NQMA 3P1CA 4TZ2A 3HMEA 2I8NA 4BHWA 4BW3A 4UIUA 4YYJA 5E3DA 3O36A 5LJ0A 5JWMA 4X2IA 1WUGA 5F25A 5KTWA 1X0JA 3SVGA 3UV4A 4ZQLA 3QZSA 4CUUA 4YYIA 4O7CA 5H1VA 5AMEA 4MEPA 3TLPA 4QYDA 5CQTA 5FG4A 5E0RA 2LSPB 3UW9A 5DY7A 4LYSA 5AMFA 5A5OA 5D3PA 5E9KA 5EM3A 5AD2A 4ALGA 3JVLA 2YDWA 4YYKA 4A9IA 3S91A 3LJWA 4HXMA 5H85A 1F68A 2NXBA 5IG6A 3G0JA 2R0VA 5C85A 5DYCA 4O7EA 5ENHA 4MEOA 5EPBA 3GG3A 5DBMA 4BJXA 5C87A 4AKNA 4UIVA 5EWDA 4UIYA 5DKHA 4HXSA 5A85A 5I7XA 4CUTA 5II2A 5IGNA 5I86A 4LYIA 4YYGA 5TCMA 5E9MA 5A5QA 4YY4A 4HBWA 4O77A 4N4IA 3P5OA 5A5SA 4QR5A 3UVWA 2YW5A 3DWYA 2OUOA 4HXKA 5I1QA 4A9LA 2FSAA 2N9GA 4HXPA 4Z93A 4NUEA 4WIVA 4YBSA 5CUEA 5CQ8A 5FH6A 4HXLA 4QEUA 4OUFA 4ALHA 2RFJA 2I7KA 3P1FA 5L99A 5HM0A 4XY9A 4O7AA 2RNXA 4NRAA 5CQ6A 5A83A 4XY8A 4Z1QA 4LDFA 4QB3A 4NYVA 3O35A 3LXJA 4QR4A 4DONA 2F6JA 4HBVA 4Q0NA 4LR6A 5I83A 2R0SA 3QZTA 4TQNA 3QZVA 4NYWA 5DFDA 4Z6HA 5L8UA 5DYUA 4OGJA 5EPSA 4PKLA 4FLPA 4PY6A 2L84A 3FKMX 5ENGA 5F62A 3UVXA 4Y03A 5FE4A 3UV5A 1ZS5A 5I88A 4NYXA 4J3IA 5HRXA 4QR3A 5DX4A 4BW1A 3U5KA 4QBMA 5FE1A 4ZW1A 5ACYA 2YELA 4YBTA 5D25A 5LKZA 5DFCA 5D0CA 4PS5A 5E7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUR A;  4O78 A;  4QC1 A;  4TTE A;  3U5M A;  5A5N A;  3UV2 A;  5IGK A;  4XUA A;  4N3W A;  4CUS A;  1JM4 B;  5HFQ A;  5F36 A;  5KHM A;  4CFL A;  4KCX A;  5E9L A;  5FDZ A;  3U5P A;  5K29 A;  3JVM A;  5EU1 A;  4TT4 A;  5F2P A;  5LJ1 A;  5ENJ A;  4CL9 A;  4TS8 A;  4YH4 A;  1N72 A;  5IGL A;  5CUA A;  5CTL A;  2D9E A;  4QSS A;  2GRC A;  5DW2 A;  2E7O A;  4QSR A;  5CS8 A;  4YYM A;  2DWW A;  5EPR A;  4ZC9 A;  4O75 A;  4NR7 A;  4MEN A;  2RI7 A;  5EIC A;  3MUL A;  4PCE A;  5FE6 A;  5D3S A;  4F3I A;  3MB4 A;  4XUB A;  5EI4 A;  5HEM A;  4QSX A;  2L85 A;  2DVR A;  4QYL A;  4QSU A;  4NS5 A;  4A9E A;  4WHW A;  2F6N A;  4TT6 A;  5FFW A;  5CU8 A;  3IU6 A;  5G4R A;  3NXB A;  5FE3 A;  2E7N A;  4QST A;  4YY6 A;  5HCL A;  5EWV A;  4NR8 A;  5DFB A;  4TU4 A;  5A7C A;  5KU3 A;  3AAD A;  3MB3 A;  4QC3 A;  4LZ2 A;  4CLB A;  5H1T A;  4CFK A;  3LQH A;  4O74 A;  4WHU A;  5BT5 A;  5IGM A;  4O72 A;  4LZR A;  5E9Y A;  5DLZ A;  5ENI A;  4A9O A;  4C66 A;  5COI A;  3LQJ A;  4IOR A;  4C67 A;  3IU5 A;  4IR5 A;  3ZYU A;  3RCW A;  5EWH A;  4YYN A;  3JVK A;  4HXO A;  5DYA A;  5HLS A;  2YYN A;  3O33 A;  3HMH A;  5A5P A;  2OO1 A;  4QUT A;  4QEW A;  2DAT A;  2L5E A;  5EP7 A;  5F61 A;  3HMF A;  4YH3 A;  4UIX A;  5F1H A;  5FFY A;  5I29 A;  3D7C A;  4GPJ A;  4KV4 A;  5KO4 A;  2YQD A;  5G4S A;  5C8G A;  4NR9 A;  2OSS A;  3SVH A;  5TB6 A;  2H60 A;  5F63 A;  4LRG A;  4A9M A;  2DKW A;  4O7F A;  5FBX A;  4NXJ A;  5EVA A;  2DVQ A;  4O7B A;  4A9F A;  5CZG A;  3AQA A;  5C4Q A;  5EA1 A;  4O76 A;  5EK9 A;  5BT4 A;  5DKD A;  4CUQ A;  2WP2 A;  4UYF A;  5ENE A;  5L98 A;  5HQ5 A;  3U5N A;  2E3K A;  4MEQ A;  4N4F A;  5E74 A;  5HEN A;  2MJV B;  5HQ6 A;  4IOQ A;  3JVJ A;  5FFV A;  5CUB A;  5ENC A;  5CGP A;  2RS9 B;  4YAX A;  4A9N A;  4YBM A;  3I3J A;  5FB1 A;  3O37 A;  4N4H A;  3P1D A;  5L96 A;  5A81 A;  5F60 A;  2RNW A;  5FE7 A;  3U5J A;  5HRV A;  5CUG A;  3DAI A;  5DYX A;  5EIS A;  5D26 A;  5I80 A;  5FH7 A;  5CQ7 A;  5EGU A;  3U5L A;  4J0S A;  4QEV A;  5FG6 A;  3Q2F A;  5D3R A;  4YYH A;  4IOO A;  5CQ3 A;  3SVF A;  4YAB A;  5EWW A;  4HBX A;  4QSQ A;  4YAT A;  2WP1 A;  4QUU A;  4BW4 A;  5F1L A;  5EQ1 A;  5ENB A;  1EQF A;  2RO1 A;  4UIZ A;  5I40 A;  5DKC A;  4UYH A;  4O71 A;  5AD3 A;  3ONI A;  2RNY A;  4BW2 A;  5D3T A;  5F3A A;  5E73 A;  5HQ7 A;  5A5R A;  3O34 A;  5D3L A;  3UVD A;  5IBN A;  4UYE A;  5CRM A;  2R10 A;  4NRB A;  2R0Y A;  5CQ5 A;  4YYD A;  5FE0 A;  5FH8 A;  4OGI A;  4A9K A;  4E96 A;  4QSP A;  4RVR A;  4IR6 A;  4TYL A;  5CQA A;  5JI8 A;  5C89 A;  5CUC A;  4KV1 A;  5IID A;  5EWC A;  4O70 A;  4HXR A;  4UYG A;  3Q2E A;  5KTX A;  5HEL A;  5FE2 A;  5I89 A;  5LVQ A;  3G0L A;  5FB0 A;  4CUP A;  4NQN A;  5LKU A;  5CFW A;  2DVS A;  5L97 A;  1E6I A;  5EV9 A;  4NUD A;  2YEM A;  4Z1S A;  4J1P A;  5ENF A;  5LVR A;  4MR5 A;  5BT3 A;  1JSP B;  4MR6 A;  4QY4 A;  5FE9 A;  5ETB A;  5HRW A;  3MUK A;  5E3G A;  5F5Z A;  4XYA A;  4NRC A;  2G4A A;  4QSW A;  4TZ8 A;  4LC2 A;  5CPE A;  5D3H A;  3U5O A;  4N4G A;  5CQ4 A;  4A9J A;  1WUM A;  3P1E A;  5DW1 A;  4Z6I A;  4QZS A;  5KTU A;  4YK0 A;  5LUU A;  5II1 A;  4QNS A;  2D82 A;  2DVV A;  4YAD A;  5FE8 A;  5D24 A;  5E9V A;  5I7Y A;  5H1U A;  5LKT A;  4NUC A;  5D3N A;  3K2J A;  2KTB B;  4NR4 A;  5CUD A;  5DLX A;  5FE5 A;  5CP5 A;  5LKX A;  5FG5 A;  4UYD A;  3LQI A;  5E9I A;  5D7X A;  4LYW A;  4PTB A;  5HJC A;  3MQM A;  4IR4 A;  4MR3 A;  5CRZ A;  4UIT A;  3UVY A;  4PCI A;  4QSV A;  5D3J A;  5ETD A;  3S92 A;  5J0D A;  4NR5 A;  4A9H A;  4MR4 A;  4Q0O A;  4J0R A;  5LJ2 A;  4HXN A;  4UYF B;  4YC9 A;  4TU6 A;  4TT2 A;  3MXF A;  4UIW A;  4HBY A;  5L8T A;  2YEK A;  4LZS A;  5A82 A;  4IR3 A;  5HFR A;  5C7N A;  4NR6 A;  5CY9 A;  4NQM A;  3P1C A;  4TZ2 A;  3HME A;  2I8N A;  4BHW A;  4BW3 A;  4UIU A;  4YYJ A;  5E3D A;  3O36 A;  5LJ0 A;  5JWM A;  4X2I A;  1WUG A;  5F25 A;  5KTW A;  1X0J A;  3SVG A;  3UV4 A;  4ZQL A;  3QZS A;  4CUU A;  4YYI A;  4O7C A;  5H1V A;  5AME A;  4MEP A;  3TLP A;  4QYD A;  5CQT A;  5FG4 A;  5E0R A;  2LSP B;  3UW9 A;  5DY7 A;  4LYS A;  5AMF A;  5A5O A;  5D3P A;  5E9K A;  5EM3 A;  5AD2 A;  4ALG A;  3JVL A;  2YDW A;  4YYK A;  4A9I A;  3S91 A;  3LJW A;  4HXM A;  5H85 A;  1F68 A;  2NXB A;  5IG6 A;  3G0J A;  2R0V A;  5C85 A;  5DYC A;  4O7E A;  5ENH A;  4MEO A;  5EPB A;  3GG3 A;  5DBM A;  4BJX A;  5C87 A;  4AKN A;  4UIV A;  5EWD A;  4UIY A;  5DKH A;  4HXS A;  5A85 A;  5I7X A;  4CUT A;  5II2 A;  5IGN A;  5I86 A;  4LYI A;  4YYG A;  5TCM A;  5E9M A;  5A5Q A;  4YY4 A;  4HBW A;  4O77 A;  4N4I A;  3P5O A;  5A5S A;  4QR5 A;  3UVW A;  2YW5 A;  3DWY A;  2OUO A;  4HXK A;  5I1Q A;  4A9L A;  2FSA A;  2N9G A;  4HXP A;  4Z93 A;  4NUE A;  4WIV A;  4YBS A;  5CUE A;  5CQ8 A;  5FH6 A;  4HXL A;  4QEU A;  4OUF A;  4ALH A;  2RFJ A;  2I7K A;  3P1F A;  5L99 A;  5HM0 A;  4XY9 A;  4O7A A;  2RNX A;  4NRA A;  5CQ6 A;  5A83 A;  4XY8 A;  4Z1Q A;  4LDF A;  4QB3 A;  4NYV A;  3O35 A;  3LXJ A;  4QR4 A;  4DON A;  2F6J A;  4HBV A;  4Q0N A;  4LR6 A;  5I83 A;  2R0S A;  3QZT A;  4TQN A;  3QZV A;  4NYW A;  5DFD A;  4Z6H A;  5L8U A;  5DYU A;  4OGJ A;  5EPS A;  4PKL A;  4FLP A;  4PY6 A;  2L84 A;  3FKM X;  5ENG A;  5F62 A;  3UVX A;  4Y03 A;  5FE4 A;  3UV5 A;  1ZS5 A;  5I88 A;  4NYX A;  4J3I A;  5HRX A;  4QR3 A;  5DX4 A;  4BW1 A;  3U5K A;  4QBM A;  5FE1 A;  4ZW1 A;  5ACY A;  2YEL A;  4YBT A;  5D25 A;  5LKZ A;  5DFC A;  5D0C A;  4PS5 A;  5E7D A; 
#chains in the Genus database with same CATH topology
 4CUR A;  4O78 A;  4QC1 A;  4TTE A;  3U5M A;  5A5N A;  3UV2 A;  5IGK A;  4XUA A;  4N3W A;  4CUS A;  1JM4 B;  5HFQ A;  5F36 A;  5KHM A;  4CFL A;  4KCX A;  5E9L A;  5FDZ A;  3U5P A;  5K29 A;  3JVM A;  5EU1 A;  4TT4 A;  5F2P A;  5LJ1 A;  5ENJ A;  4CL9 A;  4TS8 A;  4YH4 A;  1N72 A;  5IGL A;  5CUA A;  5CTL A;  4AKI A;  2D9E A;  4QSS A;  2GRC A;  5DW2 A;  2E7O A;  4QSR A;  5CS8 A;  4YYM A;  2DWW A;  5EPR A;  4ZC9 A;  4O75 A;  4NR7 A;  4MEN A;  2RI7 A;  5EIC A;  3MUL A;  4PCE A;  5FE6 A;  5D3S A;  4F3I A;  3MB4 A;  4XUB A;  5EI4 A;  5HEM A;  4QSX A;  2L85 A;  2DVR A;  4QYL A;  4QSU A;  4NS5 A;  4A9E A;  4WHW A;  2F6N A;  4TT6 A;  5FFW A;  5CU8 A;  3IU6 A;  5G4R A;  3NXB A;  5FE3 A;  2E7N A;  4QST A;  4YY6 A;  5HCL A;  5EWV A;  4NR8 A;  5DFB A;  4TU4 A;  5A7C A;  5KU3 A;  3VKH A;  3AAD A;  3MB3 A;  4QC3 A;  4LZ2 A;  4CLB A;  5H1T A;  4CFK A;  3LQH A;  4O74 A;  4WHU A;  5BT5 A;  5IGM A;  4O72 A;  4LZR A;  5E9Y A;  5DLZ A;  5ENI A;  4A9O A;  4C66 A;  5COI A;  3LQJ A;  4IOR A;  4C67 A;  3IU5 A;  4IR5 A;  3ZYU A;  3RCW A;  5EWH A;  4YYN A;  3ERR A;  3JVK A;  4HXO A;  5DYA A;  5HLS A;  2YYN A;  3O33 A;  3HMH A;  5A5P A;  2OO1 A;  4QUT A;  4QEW A;  2DAT A;  2L5E A;  5EP7 A;  5F61 A;  3HMF A;  4YH3 A;  4UIX A;  3D1D A;  5F1H A;  5FFY A;  5I29 A;  3D7C A;  4GPJ A;  4KV4 A;  5KO4 A;  2YQD A;  5G4S A;  5C8G A;  4NR9 A;  2OSS A;  3SVH A;  5TB6 A;  2H60 A;  5F63 A;  4LRG A;  4A9M A;  2DKW A;  4O7F A;  5FBX A;  4NXJ A;  5EVA A;  2DVQ A;  4O7B A;  4A9F A;  5CZG A;  3AQA A;  5C4Q A;  5EA1 A;  4O76 A;  5EK9 A;  5BT4 A;  5DKD A;  4CUQ A;  2WP2 A;  4UYF A;  5ENE A;  5L98 A;  5HQ5 A;  3U5N A;  2E3K A;  4MEQ A;  4N4F A;  5E74 A;  5HEN A;  2MJV B;  5HQ6 A;  4IOQ A;  3JVJ A;  5FFV A;  5CUB A;  5ENC A;  5CGP A;  2RS9 B;  4YAX A;  4A9N A;  4YBM A;  3I3J A;  5FB1 A;  3O37 A;  4N4H A;  3P1D A;  5L96 A;  5A81 A;  5F60 A;  2RNW A;  5FE7 A;  3U5J A;  5HRV A;  5CUG A;  3DAI A;  5DYX A;  5EIS A;  5D26 A;  5I80 A;  5FH7 A;  5CQ7 A;  5EGU A;  3U5L A;  4J0S A;  4QEV A;  5FG6 A;  3Q2F A;  5D3R A;  4YYH A;  4IOO A;  5CQ3 A;  3SVF A;  4YAB A;  5EWW A;  4HBX A;  4QSQ A;  4YAT A;  2WP1 A;  4QUU A;  4BW4 A;  5F1L A;  5EQ1 A;  5ENB A;  1EQF A;  2RO1 A;  4UIZ A;  5I40 A;  5DKC A;  4UYH A;  4O71 A;  5AD3 A;  3ONI A;  2RNY A;  4BW2 A;  5D3T A;  5F3A A;  5E73 A;  5HQ7 A;  5A5R A;  3O34 A;  5D3L A;  3UVD A;  5IBN A;  4UYE A;  5CRM A;  2R10 A;  4NRB A;  2R0Y A;  5CQ5 A;  4YYD A;  5FE0 A;  5FH8 A;  4OGI A;  4A9K A;  4E96 A;  4QSP A;  4RVR A;  4IR6 A;  4TYL A;  5CQA A;  5JI8 A;  5C89 A;  4AI6 A;  5CUC A;  4KV1 A;  5IID A;  5EWC A;  4O70 A;  4HXR A;  4UYG A;  3Q2E A;  5KTX A;  5HEL A;  5FE2 A;  5I89 A;  5LVQ A;  3G0L A;  5FB0 A;  4CUP A;  4NQN A;  5LKU A;  5CFW A;  2DVS A;  5L97 A;  1E6I A;  5EV9 A;  4NUD A;  2YEM A;  4Z1S A;  4J1P A;  5ENF A;  5LVR A;  4MR5 A;  5BT3 A;  1JSP B;  4MR6 A;  4QY4 A;  5FE9 A;  5ETB A;  5HRW A;  3MUK A;  5E3G A;  5F5Z A;  4XYA A;  4NRC A;  2G4A A;  4QSW A;  4TZ8 A;  4LC2 A;  5CPE A;  5D3H A;  3U5O A;  4N4G A;  5CQ4 A;  4A9J A;  1WUM A;  3P1E A;  5DW1 A;  4Z6I A;  4QZS A;  5KTU A;  4YK0 A;  5LUU A;  5II1 A;  4QNS A;  2D82 A;  2DVV A;  4YAD A;  5FE8 A;  5D24 A;  5E9V A;  5I7Y A;  5H1U A;  5LKT A;  4NUC A;  5D3N A;  3K2J A;  2KTB B;  4NR4 A;  5CUD A;  5DLX A;  5FE5 A;  5CP5 A;  5LKX A;  5FG5 A;  4UYD A;  3LQI A;  5E9I A;  5D7X A;  4LYW A;  4PTB A;  5HJC A;  3MQM A;  4IR4 A;  4MR3 A;  5CRZ A;  3VKG A;  4UIT A;  3UVY A;  4PCI A;  4QSV A;  5D3J A;  5ETD A;  3S92 A;  5J0D A;  4NR5 A;  4A9H A;  4MR4 A;  4AKG A;  4Q0O A;  4J0R A;  5LJ2 A;  4HXN A;  3D1B A;  4UYF B;  4YC9 A;  4TU6 A;  4TT2 A;  3MXF A;  4UIW A;  4HBY A;  5L8T A;  2YEK A;  4LZS A;  5A82 A;  4IR3 A;  5HFR A;  5C7N A;  4NR6 A;  5CY9 A;  4NQM A;  3P1C A;  4TZ2 A;  3HME A;  2I8N A;  4BHW A;  4BW3 A;  4UIU A;  4YYJ A;  5E3D A;  3O36 A;  5LJ0 A;  5JWM A;  4X2I A;  1WUG A;  5F25 A;  5KTW A;  1X0J A;  3SVG A;  3UV4 A;  4ZQL A;  3QZS A;  4CUU A;  4YYI A;  4O7C A;  5H1V A;  5AME A;  4MEP A;  3TLP A;  4QYD A;  5CQT A;  5FG4 A;  5E0R A;  2LSP B;  3UW9 A;  5DY7 A;  4LYS A;  5AMF A;  5A5O A;  5D3P A;  5E9K A;  5EM3 A;  5AD2 A;  4ALG A;  3JVL A;  2YDW A;  4YYK A;  4A9I A;  3S91 A;  3LJW A;  4HXM A;  5H85 A;  1F68 A;  2NXB A;  5IG6 A;  1ZKR A;  3G0J A;  2R0V A;  5C85 A;  5DYC A;  4O7E A;  5ENH A;  4MEO A;  5EPB A;  3GG3 A;  5DBM A;  4BJX A;  5C87 A;  4AKN A;  4UIV A;  5EWD A;  4UIY A;  5DKH A;  4HXS A;  5A85 A;  5I7X A;  4CUT A;  5II2 A;  1PUO A;  5IGN A;  5I86 A;  4LYI A;  4YYG A;  5TCM A;  5E9M A;  5A5Q A;  4YY4 A;  4HBW A;  4O77 A;  4N4I A;  3P5O A;  5A5S A;  4QR5 A;  3UVW A;  2YW5 A;  4AKH A;  3DWY A;  2OUO A;  4HXK A;  5I1Q A;  4A9L A;  2FSA A;  2N9G A;  4HXP A;  4Z93 A;  4NUE A;  4WIV A;  4YBS A;  5CUE A;  5CQ8 A;  5FH6 A;  4HXL A;  4QEU A;  4OUF A;  4ALH A;  2RFJ A;  2I7K A;  3P1F A;  5L99 A;  5HM0 A;  4XY9 A;  4O7A A;  2RNX A;  4NRA A;  5CQ6 A;  5A83 A;  4XY8 A;  4Z1Q A;  4LDF A;  4QB3 A;  4NYV A;  3O35 A;  3LXJ A;  4QR4 A;  4DON A;  2F6J A;  4HBV A;  4Q0N A;  4LR6 A;  5I83 A;  2R0S A;  3QZT A;  4TQN A;  3QZV A;  2EJN A;  4NYW A;  5DFD A;  4Z6H A;  5L8U A;  5DYU A;  4OGJ A;  5EPS A;  4PKL A;  4FLP A;  4PY6 A;  2L84 A;  3FKM X;  5ENG A;  5F62 A;  3UVX A;  4Y03 A;  5FE4 A;  3UV5 A;  1ZS5 A;  5I88 A;  4NYX A;  4J3I A;  5HRX A;  4QR3 A;  5DX4 A;  4BW1 A;  3U5K A;  4QBM A;  5FE1 A;  4ZW1 A;  5ACY A;  2YEL A;  4YBT A;  5D25 A;  5LKZ A;  5DFC A;  5D0C A;  4PS5 A;  5E7D A; 
#chains in the Genus database with same CATH homology
 4CUR A;  4O78 A;  4QC1 A;  4TTE A;  3U5M A;  5A5N A;  3UV2 A;  5IGK A;  4XUA A;  4N3W A;  4CUS A;  1JM4 B;  5HFQ A;  5F36 A;  5KHM A;  4CFL A;  4KCX A;  5E9L A;  5FDZ A;  3U5P A;  5K29 A;  3JVM A;  5EU1 A;  4TT4 A;  5F2P A;  5LJ1 A;  5ENJ A;  4CL9 A;  4TS8 A;  4YH4 A;  1N72 A;  5IGL A;  5CUA A;  5CTL A;  2D9E A;  4QSS A;  2GRC A;  5DW2 A;  2E7O A;  4QSR A;  5CS8 A;  4YYM A;  2DWW A;  5EPR A;  4ZC9 A;  4O75 A;  4NR7 A;  4MEN A;  2RI7 A;  5EIC A;  3MUL A;  4PCE A;  5FE6 A;  5D3S A;  4F3I A;  3MB4 A;  4XUB A;  5EI4 A;  5HEM A;  4QSX A;  2L85 A;  2DVR A;  4QYL A;  4QSU A;  4NS5 A;  4A9E A;  4WHW A;  2F6N A;  4TT6 A;  5FFW A;  5CU8 A;  3IU6 A;  5G4R A;  3NXB A;  5FE3 A;  2E7N A;  4QST A;  4YY6 A;  5HCL A;  5EWV A;  4NR8 A;  5DFB A;  4TU4 A;  5A7C A;  5KU3 A;  3AAD A;  3MB3 A;  4QC3 A;  4LZ2 A;  4CLB A;  5H1T A;  4CFK A;  3LQH A;  4O74 A;  4WHU A;  5BT5 A;  5IGM A;  4O72 A;  4LZR A;  5E9Y A;  5DLZ A;  5ENI A;  4A9O A;  4C66 A;  5COI A;  3LQJ A;  4IOR A;  4C67 A;  3IU5 A;  4IR5 A;  3ZYU A;  3RCW A;  5EWH A;  4YYN A;  3JVK A;  4HXO A;  5DYA A;  5HLS A;  2YYN A;  3O33 A;  3HMH A;  5A5P A;  2OO1 A;  4QUT A;  4QEW A;  2DAT A;  2L5E A;  5EP7 A;  5F61 A;  3HMF A;  4YH3 A;  4UIX A;  5F1H A;  5FFY A;  5I29 A;  3D7C A;  4GPJ A;  4KV4 A;  5KO4 A;  2YQD A;  5G4S A;  5C8G A;  4NR9 A;  2OSS A;  3SVH A;  5TB6 A;  2H60 A;  5F63 A;  4LRG A;  4A9M A;  2DKW A;  4O7F A;  5FBX A;  4NXJ A;  5EVA A;  2DVQ A;  4O7B A;  4A9F A;  5CZG A;  3AQA A;  5C4Q A;  5EA1 A;  4O76 A;  5EK9 A;  5BT4 A;  5DKD A;  4CUQ A;  2WP2 A;  4UYF A;  5ENE A;  5L98 A;  5HQ5 A;  3U5N A;  2E3K A;  4MEQ A;  4N4F A;  5E74 A;  5HEN A;  2MJV B;  5HQ6 A;  4IOQ A;  3JVJ A;  5FFV A;  5CUB A;  5ENC A;  5CGP A;  2RS9 B;  4YAX A;  4A9N A;  4YBM A;  3I3J A;  5FB1 A;  3O37 A;  4N4H A;  3P1D A;  5L96 A;  5A81 A;  5F60 A;  2RNW A;  5FE7 A;  3U5J A;  5HRV A;  5CUG A;  3DAI A;  5DYX A;  5EIS A;  5D26 A;  5I80 A;  5FH7 A;  5CQ7 A;  5EGU A;  3U5L A;  4J0S A;  4QEV A;  5FG6 A;  3Q2F A;  5D3R A;  4YYH A;  4IOO A;  5CQ3 A;  3SVF A;  4YAB A;  5EWW A;  4HBX A;  4QSQ A;  4YAT A;  2WP1 A;  4QUU A;  4BW4 A;  5F1L A;  5EQ1 A;  5ENB A;  1EQF A;  2RO1 A;  4UIZ A;  5I40 A;  5DKC A;  4UYH A;  4O71 A;  5AD3 A;  3ONI A;  2RNY A;  4BW2 A;  5D3T A;  5F3A A;  5E73 A;  5HQ7 A;  5A5R A;  3O34 A;  5D3L A;  3UVD A;  5IBN A;  4UYE A;  5CRM A;  2R10 A;  4NRB A;  2R0Y A;  5CQ5 A;  4YYD A;  5FE0 A;  5FH8 A;  4OGI A;  4A9K A;  4E96 A;  4QSP A;  4RVR A;  4IR6 A;  4TYL A;  5CQA A;  5JI8 A;  5C89 A;  5CUC A;  4KV1 A;  5IID A;  5EWC A;  4O70 A;  4HXR A;  4UYG A;  3Q2E A;  5KTX A;  5HEL A;  5FE2 A;  5I89 A;  5LVQ A;  3G0L A;  5FB0 A;  4CUP A;  4NQN A;  5LKU A;  5CFW A;  2DVS A;  5L97 A;  1E6I A;  5EV9 A;  4NUD A;  2YEM A;  4Z1S A;  4J1P A;  5ENF A;  5LVR A;  4MR5 A;  5BT3 A;  1JSP B;  4MR6 A;  4QY4 A;  5FE9 A;  5ETB A;  5HRW A;  3MUK A;  5E3G A;  5F5Z A;  4XYA A;  4NRC A;  2G4A A;  4QSW A;  4TZ8 A;  4LC2 A;  5CPE A;  5D3H A;  3U5O A;  4N4G A;  5CQ4 A;  4A9J A;  1WUM A;  3P1E A;  5DW1 A;  4Z6I A;  4QZS A;  5KTU A;  4YK0 A;  5LUU A;  5II1 A;  4QNS A;  2D82 A;  2DVV A;  4YAD A;  5FE8 A;  5D24 A;  5E9V A;  5I7Y A;  5H1U A;  5LKT A;  4NUC A;  5D3N A;  3K2J A;  2KTB B;  4NR4 A;  5CUD A;  5DLX A;  5FE5 A;  5CP5 A;  5LKX A;  5FG5 A;  4UYD A;  3LQI A;  5E9I A;  5D7X A;  4LYW A;  4PTB A;  5HJC A;  3MQM A;  4IR4 A;  4MR3 A;  5CRZ A;  4UIT A;  3UVY A;  4PCI A;  4QSV A;  5D3J A;  5ETD A;  3S92 A;  5J0D A;  4NR5 A;  4A9H A;  4MR4 A;  4Q0O A;  4J0R A;  5LJ2 A;  4HXN A;  4UYF B;  4YC9 A;  4TU6 A;  4TT2 A;  3MXF A;  4UIW A;  4HBY A;  5L8T A;  2YEK A;  4LZS A;  5A82 A;  4IR3 A;  5HFR A;  5C7N A;  4NR6 A;  5CY9 A;  4NQM A;  3P1C A;  4TZ2 A;  3HME A;  2I8N A;  4BHW A;  4BW3 A;  4UIU A;  4YYJ A;  5E3D A;  3O36 A;  5LJ0 A;  5JWM A;  4X2I A;  1WUG A;  5F25 A;  5KTW A;  1X0J A;  3SVG A;  3UV4 A;  4ZQL A;  3QZS A;  4CUU A;  4YYI A;  4O7C A;  5H1V A;  5AME A;  4MEP A;  3TLP A;  4QYD A;  5CQT A;  5FG4 A;  5E0R A;  2LSP B;  3UW9 A;  5DY7 A;  4LYS A;  5AMF A;  5A5O A;  5D3P A;  5E9K A;  5EM3 A;  5AD2 A;  4ALG A;  3JVL A;  2YDW A;  4YYK A;  4A9I A;  3S91 A;  3LJW A;  4HXM A;  5H85 A;  1F68 A;  2NXB A;  5IG6 A;  3G0J A;  2R0V A;  5C85 A;  5DYC A;  4O7E A;  5ENH A;  4MEO A;  5EPB A;  3GG3 A;  5DBM A;  4BJX A;  5C87 A;  4AKN A;  4UIV A;  5EWD A;  4UIY A;  5DKH A;  4HXS A;  5A85 A;  5I7X A;  4CUT A;  5II2 A;  5IGN A;  5I86 A;  4LYI A;  4YYG A;  5TCM A;  5E9M A;  5A5Q A;  4YY4 A;  4HBW A;  4O77 A;  4N4I A;  3P5O A;  5A5S A;  4QR5 A;  3UVW A;  2YW5 A;  3DWY A;  2OUO A;  4HXK A;  5I1Q A;  4A9L A;  2FSA A;  2N9G A;  4HXP A;  4Z93 A;  4NUE A;  4WIV A;  4YBS A;  5CUE A;  5CQ8 A;  5FH6 A;  4HXL A;  4QEU A;  4OUF A;  4ALH A;  2RFJ A;  2I7K A;  3P1F A;  5L99 A;  5HM0 A;  4XY9 A;  4O7A A;  2RNX A;  4NRA A;  5CQ6 A;  5A83 A;  4XY8 A;  4Z1Q A;  4LDF A;  4QB3 A;  4NYV A;  3O35 A;  3LXJ A;  4QR4 A;  4DON A;  2F6J A;  4HBV A;  4Q0N A;  4LR6 A;  5I83 A;  2R0S A;  3QZT A;  4TQN A;  3QZV A;  4NYW A;  5DFD A;  4Z6H A;  5L8U A;  5DYU A;  4OGJ A;  5EPS A;  4PKL A;  4FLP A;  4PY6 A;  2L84 A;  3FKM X;  5ENG A;  5F62 A;  3UVX A;  4Y03 A;  5FE4 A;  3UV5 A;  1ZS5 A;  5I88 A;  4NYX A;  4J3I A;  5HRX A;  4QR3 A;  5DX4 A;  4BW1 A;  3U5K A;  4QBM A;  5FE1 A;  4ZW1 A;  5ACY A;  2YEL A;  4YBT A;  5D25 A;  5LKZ A;  5DFC A;  5D0C A;  4PS5 A;  5E7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...