1JSPB

Nmr structure of cbp bromodomain in complex with p53 peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords tumor protein p53
publication title Structural mechanism of the bromodomain of the coactivator CBP in p53 transcriptional activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2001-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1jspB00
5CQ6A 2GRCA 4HXLA 4IOOA 2LSPB 4YC9A 3U5OA 5KTWA 4UYEA 5D24A 4N4FA 4TU4A 3O33A 4QSVA 5C89A 2DATA 4YBTA 4PCEA 4N4GA 2YQDA 4HXMA 4J3IA 4DONA 5F3AA 3ZYUA 4A9LA 5FE5A 5E9MA 2E7OA 5I29A 1ZS5A 5CUEA 5E3GA 2WP2A 4LYIA 3QZVA 3SVGA 5E3DA 2YEMA 5AD3A 5F25A 3HMFA 4HBVA 1WUGA 4UIXA 2WP1A 4IR5A 5E9IA 2H60A 4QR5A 2MJVB 5HFQA 3Q2EA 4MEOA 4NS5A 4ALGA 3SVHA 5EGUA 4CUQA 3TLPA 4QSTA 5F63A 4XUBA 4WHUA 4BW1A 4OGIA 5EISA 5E0RA 5CY9A 5JI8A 1N72A 5G4SA 5EWDA 4Z1SA 5BT3A 3U5PA 5EPRA 5H1VA 5HQ7A 4C66A 5DLXA 2YW5A 4YY6A 5L96A 5CQ5A 4Z93A 4O72A 5D3RA 5II2A 3U5NA 4XUAA 4QBMA 4UYGA 5FFVA 3U5KA 4O7BA 5F60A 4QSSA 5FE9A 5II1A 3LJWA 5H85A 4ZC9A 4PY6A 5I80A 2DKWA 4IR3A 3HMEA 4GPJA 5FH7A 5E9KA 3D7CA 5CTLA 5DY7A 4HXOA 4MEPA 2RNYA 4UYDA 5HEMA 5D3PA 5HJCA 5LVRA 4IR6A 4QUTA 5I89A 5FG5A 5A81A 3AQAA 5EVAA 4Z1QA 5I40A 3MQMA 4A9EA 2N9GA 4NRBA 4YY4A 4NR5A 5EPBA 5DKHA 5AMEA 4QSXA 4UYHA 3P1DA 4QR4A 4YATA 4O7FA 4NUDA 2D82A 5IBNA 5G4RA 4YYKA 4NYXA 5HM0A 3P1EA 4YADA 4TYLA 5ENJA 3S91A 3Q2FA 5DFBA 2DVQA 4KV4A 3U5MA 3P1CA 2F6NA 4YH3A 1X0JA 5LKUA 5A5NA 4IOQA 4CL9A 4HXSA 5CUAA 5FB1A 5FBXA 5EM3A 5A82A 5CUGA 4O7AA 3ONIA 5FE2A 4O77A 3O35A 2FSAA 5CQ4A 5I86A 4HXNA 5D3SA 4N4HA 4TT2A 5ENFA 5CQ3A 5E9VA 3UV5A 5LKZA 5A85A 4X2IA 3MB3A 4UIUA 5FE4A 4TZ8A 2KTBB 3QZSA 4QB3A 4MENA 3DAIA 3AADA 4QNSA 5D7XA 4Y03A 4LZ2A 5DFDA 5FG6A 4NUCA 4C67A 5DYUA 5DYXA 4QC1A 4QZSA 4MR3A 4LYWA 5K29A 4MR6A 2D9EA 4QEWA 5FDZA 4FLPA 3JVLA 3P1FA 4TT4A 5D3NA 4YYMA 5L8TA 5D0CA 5I88A 2RS9B 4YK0A 5LJ0A 5E7DA 5EK9A 5EWHA 2I8NA 5DKCA 5LKTA 4J1PA 5FH6A 4NR4A 4QEUA 2OSSA 5L99A 5IIDA 5FE1A 5HFRA 2G4AA 5EP7A 5BT5A 4NR8A 5ENCA 5HRWA 5L8UA 4KCXA 4NR6A 5AD2A 4O7CA 4O74A 5D3TA 5COIA 4O75A 5F1LA 3UW9A 4ALHA 5FE3A 2RFJA 3HMHA 5ENGA 5A5QA 5E73A 5A7CA 5BT4A 4YYDA 3IU5A 2OO1A 4PCIA 5H1TA 4Q0NA 5EQ1A 1E6IA 4Q0OA 2R10A 3UV2A 4TZ2A 2YEKA 5CUDA 2DVRA 2F6JA 5CPEA 5CQ8A 4IORA 4XYAA 5DYCA 5A5PA 2I7KA 4KV1A 5EICA 4CLBA 2E7NA 5HLSA 4HXRA 4CUTA 5DBMA 4BW4A 5LJ1A 4YBSA 5EPSA 4PS5A 5F1HA 5FH8A 3NXBA 4CUSA 4QUUA 5L97A 5CRZA 4HBXA 5EWWA 5D3JA 4YYJA 4A9KA 3FKMX 3SVFA 5IGMA 5E9LA 4MR4A 3O34A 4YYNA 4QYDA 4IR4A 2YDWA 4J0RA 4NQNA 4F3IA 3I3JA 4A9JA 5DLZA 2R0SA 4Z6HA 5I7XA 4QY4A 3UVDA 5F5ZA 5CZGA 5HRVA 3LQJA 4LDFA 4BW3A 1F68A 5F36A 5CQ7A 4AKNA 3LQIA 3MXFA 4UIZA 3JVJA 4UIYA 5IGLA 5IGKA 3GG3A 5CQAA 4YABA 2L84A 2RNWA 5KTXA 4QSRA 5EA1A 5E9YA 5ETBA 4UYFA 2R0VA 4UIWA 2RI7A 3O37A 5FE7A 5EI4A 5HQ6A 4NUEA 5D26A 5EWCA 4NR7A 4HXKA 5FFWA 4HXPA 4HBYA 4TT6A 4J0SA 4CUUA 4QEVA 5A83A 4LR6A 4A9OA 4XY8A 5ENEA 3QZTA 5FB0A 5ENHA 5EWVA 5CUCA 5F62A 5ENIA 4NYVA 5D25A 4MEQA 4N4IA 2DVVA 4A9HA 3G0LA 3MULA 4BJXA 5CS8A 5EU1A 3RCWA 3S92A 2RO1A 3G0JA 4WIVA 4CFLA 4QSPA 3DWYA 5CP5A 4XY9A 4TQNA 5CU8A 5C7NA 3U5JA 4NYWA 5CFWA 5LUUA 4QSWA 4TU6A 3UV4A 5I1QA 4O71A 4CUPA 5L98A 4LZSA 2L85A 4YYGA 4CURA 4A9NA 5FE8A 4QSQA 3P5OA 4LRGA 4Z6IA 2DWWA 4CFKA 4YAXA 2NXBA 5CGPA 2YELA 2DVSA 4UIVA 5TB6A 1JSPB 5H1UA 5EV9A 5LKXA 5FG4A 5DYAA 5KTUA 3UVYA 5A5OA 5I83A 1WUMA 3O36A 5F61A 5I7YA 4OUFA 1EQFA 5KO4A 4ZW1A 4BW2A 3MB4A 5DW2A 5LVQA 4A9MA 4MR5A 5AMFA 4UYFB 3K2JA 5FE6A 5C87A 5C4QA 3UVXA 5A5SA 2RNXA 5CUBA 5HELA 4O78A 5ENBA 4NRCA 4PKLA 5DW1A 4HBWA 4QC3A 4YYIA 5CQTA 5TCMA 4TS8A 5DFCA 4N3WA 4BHWA 4OGJA 3LXJA 5D3HA 4LC2A 3U5LA 4QR3A 5C8GA 4QSUA 4LZRA 4QYLA 4WHWA 4O7EA 4YYHA 5LJ2A 5DX4A 4A9IA 2OUOA 4A9FA 2R0YA 2L5EA 4YBMA 5DKDA 4O76A 4PTBA 5J0DA 5D3LA 3JVKA 4NRAA 3LQHA 5IGNA 1JM4B 3UVWA 4E96A 4LYSA 3IU6A 5E74A 5F2PA 5KU3A 5FE0A 5FFYA 5HQ5A 5ACYA 5HENA 5C85A 2YYNA 4NR9A 4O70A 5JWMA 4YH4A 4RVRA 2E3KA 5KHMA 5ETDA 5A5RA 3JVMA 3MUKA 4ZQLA 4UITA 4TTEA 5CRMA 4NXJA 5IG6A 5HRXA 4NQMA 5HCLA
chains in the Genus database with same CATH superfamily
5CQ6A 2GRCA 4HXLA 4IOOA 2LSPB 4YC9A 3U5OA 5KTWA 4UYEA 5D24A 4N4FA 4TU4A 3O33A 4QSVA 5C89A 2DATA 4YBTA 4PCEA 4N4GA 2YQDA 4HXMA 4J3IA 4DONA 5F3AA 3ZYUA 4A9LA 5FE5A 5E9MA 2E7OA 5I29A 1ZS5A 5CUEA 5E3GA 2WP2A 4LYIA 3QZVA 3SVGA 5E3DA 2YEMA 5AD3A 3VKGA 5F25A 3HMFA 4HBVA 1WUGA 4UIXA 2WP1A 4IR5A 5E9IA 2H60A 4QR5A 2MJVB 5HFQA 3Q2EA 4MEOA 4NS5A 4ALGA 3SVHA 5EGUA 4CUQA 3TLPA 4QSTA 5F63A 4XUBA 4WHUA 4BW1A 4OGIA 5EISA 1PUOA 5E0RA 5CY9A 5JI8A 1N72A 5G4SA 5EWDA 4Z1SA 5BT3A 3U5PA 5EPRA 5H1VA 5HQ7A 4C66A 5DLXA 2YW5A 4YY6A 5L96A 5CQ5A 4Z93A 4O72A 5D3RA 5II2A 3U5NA 4XUAA 4QBMA 4UYGA 5FFVA 3U5KA 4O7BA 5F60A 4QSSA 5FE9A 5II1A 3LJWA 5H85A 4ZC9A 4PY6A 5I80A 2DKWA 4IR3A 3HMEA 4GPJA 5FH7A 5E9KA 3D7CA 5CTLA 5DY7A 4HXOA 4MEPA 2RNYA 4UYDA 5HEMA 5D3PA 5HJCA 5LVRA 4IR6A 4QUTA 5I89A 5FG5A 5A81A 3AQAA 5EVAA 4Z1QA 5I40A 3MQMA 4A9EA 2N9GA 4NRBA 4YY4A 4NR5A 5EPBA 5DKHA 5AMEA 4QSXA 4AI6A 4UYHA 3P1DA 4QR4A 4YATA 4O7FA 4NUDA 2D82A 5IBNA 5G4RA 4YYKA 4NYXA 5HM0A 3P1EA 4YADA 4TYLA 5ENJA 3S91A 3Q2FA 5DFBA 2DVQA 4KV4A 3U5MA 3P1CA 2F6NA 4YH3A 1X0JA 5LKUA 5A5NA 4IOQA 4CL9A 4HXSA 5CUAA 5FB1A 5FBXA 5EM3A 5A82A 5CUGA 4O7AA 3ONIA 5FE2A 4O77A 3O35A 2FSAA 5CQ4A 5I86A 4HXNA 5D3SA 4N4HA 4TT2A 5ENFA 5CQ3A 5E9VA 3UV5A 5LKZA 5A85A 4X2IA 3MB3A 4UIUA 5FE4A 4TZ8A 2KTBB 3QZSA 4QB3A 4MENA 3DAIA 3AADA 4QNSA 5D7XA 4Y03A 4LZ2A 5DFDA 5FG6A 4NUCA 4C67A 5DYUA 5DYXA 4QC1A 4QZSA 4MR3A 4LYWA 5K29A 4MR6A 2D9EA 4QEWA 5FDZA 4FLPA 3JVLA 3P1FA 4TT4A 5D3NA 4YYMA 5L8TA 5D0CA 5I88A 2RS9B 4YK0A 5LJ0A 5E7DA 5EK9A 5EWHA 2I8NA 5DKCA 5LKTA 4J1PA 5FH6A 4NR4A 4QEUA 2OSSA 5L99A 5IIDA 3ERRA 5FE1A 2EJNA 5HFRA 2G4AA 5EP7A 4AKHA 5BT5A 4NR8A 5ENCA 5HRWA 5L8UA 4KCXA 4NR6A 5AD2A 4O7CA 4O74A 5D3TA 5COIA 4O75A 5F1LA 3UW9A 4ALHA 5FE3A 2RFJA 3HMHA 5ENGA 5A5QA 5E73A 5A7CA 5BT4A 4YYDA 3IU5A 2OO1A 4PCIA 5H1TA 4Q0NA 5EQ1A 1E6IA 4Q0OA 2R10A 3UV2A 4TZ2A 2YEKA 5CUDA 2DVRA 2F6JA 5CPEA 5CQ8A 4IORA 4XYAA 5DYCA 5A5PA 2I7KA 4KV1A 5EICA 4CLBA 2E7NA 5HLSA 4HXRA 4CUTA 5DBMA 4BW4A 5LJ1A 4YBSA 5EPSA 4PS5A 5F1HA 5FH8A 3NXBA 4CUSA 4QUUA 5L97A 5CRZA 4HBXA 5EWWA 5D3JA 4YYJA 4A9KA 3FKMX 3SVFA 5IGMA 5E9LA 4MR4A 3O34A 4YYNA 4QYDA 4IR4A 2YDWA 4J0RA 4NQNA 4F3IA 3I3JA 4A9JA 5DLZA 2R0SA 4Z6HA 5I7XA 4QY4A 3UVDA 5F5ZA 5CZGA 5HRVA 3LQJA 4LDFA 4BW3A 1F68A 5F36A 5CQ7A 4AKNA 3LQIA 3MXFA 4UIZA 3JVJA 4UIYA 5IGLA 5IGKA 3GG3A 5CQAA 4YABA 2L84A 2RNWA 5KTXA 4QSRA 5EA1A 5E9YA 5ETBA 4UYFA 2R0VA 4UIWA 2RI7A 3O37A 5FE7A 5EI4A 5HQ6A 4NUEA 5D26A 5EWCA 4NR7A 4HXKA 5FFWA 4HXPA 4HBYA 4TT6A 4J0SA 4CUUA 4QEVA 5A83A 4LR6A 4A9OA 4XY8A 5ENEA 3QZTA 5FB0A 5ENHA 5EWVA 5CUCA 5F62A 5ENIA 4NYVA 5D25A 4MEQA 4N4IA 2DVVA 4A9HA 3G0LA 3MULA 4BJXA 5CS8A 5EU1A 3RCWA 3S92A 1ZKRA 2RO1A 3G0JA 4WIVA 4CFLA 4QSPA 3DWYA 5CP5A 4XY9A 4TQNA 5CU8A 5C7NA 3U5JA 4NYWA 5CFWA 5LUUA 4QSWA 4TU6A 3UV4A 5I1QA 4O71A 4CUPA 5L98A 4LZSA 2L85A 4YYGA 4CURA 4A9NA 5FE8A 4QSQA 3P5OA 4LRGA 4Z6IA 2DWWA 4CFKA 4YAXA 2NXBA 5CGPA 2YELA 2DVSA 4UIVA 5TB6A 1JSPB 5H1UA 5EV9A 5LKXA 5FG4A 5DYAA 5KTUA 3UVYA 5A5OA 5I83A 1WUMA 3O36A 5F61A 5I7YA 4OUFA 1EQFA 5KO4A 4ZW1A 4BW2A 3MB4A 5DW2A 5LVQA 4A9MA 4MR5A 5AMFA 4UYFB 3K2JA 5FE6A 5C87A 5C4QA 3UVXA 5A5SA 2RNXA 4AKIA 5CUBA 5HELA 4O78A 5ENBA 3VKHA 4NRCA 4PKLA 5DW1A 4HBWA 4QC3A 4YYIA 5CQTA 5TCMA 4TS8A 5DFCA 4N3WA 4BHWA 4OGJA 3LXJA 5D3HA 4LC2A 3U5LA 4QR3A 3D1DA 5C8GA 4QSUA 4LZRA 4QYLA 4WHWA 4O7EA 4YYHA 5LJ2A 5DX4A 4A9IA 2OUOA 4A9FA 2R0YA 2L5EA 4YBMA 5DKDA 4O76A 4PTBA 5J0DA 4AKGA 5D3LA 3JVKA 4NRAA 3LQHA 3D1BA 5IGNA 1JM4B 3UVWA 4E96A 4LYSA 3IU6A 5E74A 5F2PA 5KU3A 5FE0A 5FFYA 5HQ5A 5ACYA 5HENA 5C85A 2YYNA 4NR9A 4O70A 5JWMA 4YH4A 4RVRA 2E3KA 5KHMA 5ETDA 5A5RA 3JVMA 3MUKA 4ZQLA 4UITA 4TTEA 5CRMA 4NXJA 5IG6A 5HRXA 4NQMA 5HCLA
chains in the Genus database with same CATH topology
5CQ6A 2GRCA 4HXLA 4IOOA 2LSPB 4YC9A 3U5OA 5KTWA 4UYEA 5D24A 4N4FA 4TU4A 3O33A 4QSVA 5C89A 2DATA 4YBTA 4PCEA 4N4GA 2YQDA 4HXMA 4J3IA 4DONA 5F3AA 3ZYUA 4A9LA 5FE5A 5E9MA 2E7OA 5I29A 1ZS5A 5CUEA 5E3GA 2WP2A 4LYIA 3QZVA 3SVGA 5E3DA 2YEMA 5AD3A 5F25A 3HMFA 4HBVA 1WUGA 4UIXA 2WP1A 4IR5A 5E9IA 2H60A 4QR5A 2MJVB 5HFQA 3Q2EA 4MEOA 4NS5A 4ALGA 3SVHA 5EGUA 4CUQA 3TLPA 4QSTA 5F63A 4XUBA 4WHUA 4BW1A 4OGIA 5EISA 5E0RA 5CY9A 5JI8A 1N72A 5G4SA 5EWDA 4Z1SA 5BT3A 3U5PA 5EPRA 5H1VA 5HQ7A 4C66A 5DLXA 2YW5A 4YY6A 5L96A 5CQ5A 4Z93A 4O72A 5D3RA 5II2A 3U5NA 4XUAA 4QBMA 4UYGA 5FFVA 3U5KA 4O7BA 5F60A 4QSSA 5FE9A 5II1A 3LJWA 5H85A 4ZC9A 4PY6A 5I80A 2DKWA 4IR3A 3HMEA 4GPJA 5FH7A 5E9KA 3D7CA 5CTLA 5DY7A 4HXOA 4MEPA 2RNYA 4UYDA 5HEMA 5D3PA 5HJCA 5LVRA 4IR6A 4QUTA 5I89A 5FG5A 5A81A 3AQAA 5EVAA 4Z1QA 5I40A 3MQMA 4A9EA 2N9GA 4NRBA 4YY4A 4NR5A 5EPBA 5DKHA 5AMEA 4QSXA 4UYHA 3P1DA 4QR4A 4YATA 4O7FA 4NUDA 2D82A 5IBNA 5G4RA 4YYKA 4NYXA 5HM0A 3P1EA 4YADA 4TYLA 5ENJA 3S91A 3Q2FA 5DFBA 2DVQA 4KV4A 3U5MA 3P1CA 2F6NA 4YH3A 1X0JA 5LKUA 5A5NA 4IOQA 4CL9A 4HXSA 5CUAA 5FB1A 5FBXA 5EM3A 5A82A 5CUGA 4O7AA 3ONIA 5FE2A 4O77A 3O35A 2FSAA 5CQ4A 5I86A 4HXNA 5D3SA 4N4HA 4TT2A 5ENFA 5CQ3A 5E9VA 3UV5A 5LKZA 5A85A 4X2IA 3MB3A 4UIUA 5FE4A 4TZ8A 2KTBB 3QZSA 4QB3A 4MENA 3DAIA 3AADA 4QNSA 5D7XA 4Y03A 4LZ2A 5DFDA 5FG6A 4NUCA 4C67A 5DYUA 5DYXA 4QC1A 4QZSA 4MR3A 4LYWA 5K29A 4MR6A 2D9EA 4QEWA 5FDZA 4FLPA 3JVLA 3P1FA 4TT4A 5D3NA 4YYMA 5L8TA 5D0CA 5I88A 2RS9B 4YK0A 5LJ0A 5E7DA 5EK9A 5EWHA 2I8NA 5DKCA 5LKTA 4J1PA 5FH6A 4NR4A 4QEUA 2OSSA 5L99A 5IIDA 5FE1A 5HFRA 2G4AA 5EP7A 5BT5A 4NR8A 5ENCA 5HRWA 5L8UA 4KCXA 4NR6A 5AD2A 4O7CA 4O74A 5D3TA 5COIA 4O75A 5F1LA 3UW9A 4ALHA 5FE3A 2RFJA 3HMHA 5ENGA 5A5QA 5E73A 5A7CA 5BT4A 4YYDA 3IU5A 2OO1A 4PCIA 5H1TA 4Q0NA 5EQ1A 1E6IA 4Q0OA 2R10A 3UV2A 4TZ2A 2YEKA 5CUDA 2DVRA 2F6JA 5CPEA 5CQ8A 4IORA 4XYAA 5DYCA 5A5PA 2I7KA 4KV1A 5EICA 4CLBA 2E7NA 5HLSA 4HXRA 4CUTA 5DBMA 4BW4A 5LJ1A 4YBSA 5EPSA 4PS5A 5F1HA 5FH8A 3NXBA 4CUSA 4QUUA 5L97A 5CRZA 4HBXA 5EWWA 5D3JA 4YYJA 4A9KA 3FKMX 3SVFA 5IGMA 5E9LA 4MR4A 3O34A 4YYNA 4QYDA 4IR4A 2YDWA 4J0RA 4NQNA 4F3IA 3I3JA 4A9JA 5DLZA 2R0SA 4Z6HA 5I7XA 4QY4A 3UVDA 5F5ZA 5CZGA 5HRVA 3LQJA 4LDFA 4BW3A 1F68A 5F36A 5CQ7A 4AKNA 3LQIA 3MXFA 4UIZA 3JVJA 4UIYA 5IGLA 5IGKA 3GG3A 5CQAA 4YABA 2L84A 2RNWA 5KTXA 4QSRA 5EA1A 5E9YA 5ETBA 4UYFA 2R0VA 4UIWA 2RI7A 3O37A 5FE7A 5EI4A 5HQ6A 4NUEA 5D26A 5EWCA 4NR7A 4HXKA 5FFWA 4HXPA 4HBYA 4TT6A 4J0SA 4CUUA 4QEVA 5A83A 4LR6A 4A9OA 4XY8A 5ENEA 3QZTA 5FB0A 5ENHA 5EWVA 5CUCA 5F62A 5ENIA 4NYVA 5D25A 4MEQA 4N4IA 2DVVA 4A9HA 3G0LA 3MULA 4BJXA 5CS8A 5EU1A 3RCWA 3S92A 2RO1A 3G0JA 4WIVA 4CFLA 4QSPA 3DWYA 5CP5A 4XY9A 4TQNA 5CU8A 5C7NA 3U5JA 4NYWA 5CFWA 5LUUA 4QSWA 4TU6A 3UV4A 5I1QA 4O71A 4CUPA 5L98A 4LZSA 2L85A 4YYGA 4CURA 4A9NA 5FE8A 4QSQA 3P5OA 4LRGA 4Z6IA 2DWWA 4CFKA 4YAXA 2NXBA 5CGPA 2YELA 2DVSA 4UIVA 5TB6A 1JSPB 5H1UA 5EV9A 5LKXA 5FG4A 5DYAA 5KTUA 3UVYA 5A5OA 5I83A 1WUMA 3O36A 5F61A 5I7YA 4OUFA 1EQFA 5KO4A 4ZW1A 4BW2A 3MB4A 5DW2A 5LVQA 4A9MA 4MR5A 5AMFA 4UYFB 3K2JA 5FE6A 5C87A 5C4QA 3UVXA 5A5SA 2RNXA 5CUBA 5HELA 4O78A 5ENBA 4NRCA 4PKLA 5DW1A 4HBWA 4QC3A 4YYIA 5CQTA 5TCMA 4TS8A 5DFCA 4N3WA 4BHWA 4OGJA 3LXJA 5D3HA 4LC2A 3U5LA 4QR3A 5C8GA 4QSUA 4LZRA 4QYLA 4WHWA 4O7EA 4YYHA 5LJ2A 5DX4A 4A9IA 2OUOA 4A9FA 2R0YA 2L5EA 4YBMA 5DKDA 4O76A 4PTBA 5J0DA 5D3LA 3JVKA 4NRAA 3LQHA 5IGNA 1JM4B 3UVWA 4E96A 4LYSA 3IU6A 5E74A 5F2PA 5KU3A 5FE0A 5FFYA 5HQ5A 5ACYA 5HENA 5C85A 2YYNA 4NR9A 4O70A 5JWMA 4YH4A 4RVRA 2E3KA 5KHMA 5ETDA 5A5RA 3JVMA 3MUKA 4ZQLA 4UITA 4TTEA 5CRMA 4NXJA 5IG6A 5HRXA 4NQMA 5HCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQ6 A;  2GRC A;  4HXL A;  4IOO A;  2LSP B;  4YC9 A;  3U5O A;  5KTW A;  4UYE A;  5D24 A;  4N4F A;  4TU4 A;  3O33 A;  4QSV A;  5C89 A;  2DAT A;  4YBT A;  4PCE A;  4N4G A;  2YQD A;  4HXM A;  4J3I A;  4DON A;  5F3A A;  3ZYU A;  4A9L A;  5FE5 A;  5E9M A;  2E7O A;  5I29 A;  1ZS5 A;  5CUE A;  5E3G A;  2WP2 A;  4LYI A;  3QZV A;  3SVG A;  5E3D A;  2YEM A;  5AD3 A;  5F25 A;  3HMF A;  4HBV A;  1WUG A;  4UIX A;  2WP1 A;  4IR5 A;  5E9I A;  2H60 A;  4QR5 A;  2MJV B;  5HFQ A;  3Q2E A;  4MEO A;  4NS5 A;  4ALG A;  3SVH A;  5EGU A;  4CUQ A;  3TLP A;  4QST A;  5F63 A;  4XUB A;  4WHU A;  4BW1 A;  4OGI A;  5EIS A;  5E0R A;  5CY9 A;  5JI8 A;  1N72 A;  5G4S A;  5EWD A;  4Z1S A;  5BT3 A;  3U5P A;  5EPR A;  5H1V A;  5HQ7 A;  4C66 A;  5DLX A;  2YW5 A;  4YY6 A;  5L96 A;  5CQ5 A;  4Z93 A;  4O72 A;  5D3R A;  5II2 A;  3U5N A;  4XUA A;  4QBM A;  4UYG A;  5FFV A;  3U5K A;  4O7B A;  5F60 A;  4QSS A;  5FE9 A;  5II1 A;  3LJW A;  5H85 A;  4ZC9 A;  4PY6 A;  5I80 A;  2DKW A;  4IR3 A;  3HME A;  4GPJ A;  5FH7 A;  5E9K A;  3D7C A;  5CTL A;  5DY7 A;  4HXO A;  4MEP A;  2RNY A;  4UYD A;  5HEM A;  5D3P A;  5HJC A;  5LVR A;  4IR6 A;  4QUT A;  5I89 A;  5FG5 A;  5A81 A;  3AQA A;  5EVA A;  4Z1Q A;  5I40 A;  3MQM A;  4A9E A;  2N9G A;  4NRB A;  4YY4 A;  4NR5 A;  5EPB A;  5DKH A;  5AME A;  4QSX A;  4UYH A;  3P1D A;  4QR4 A;  4YAT A;  4O7F A;  4NUD A;  2D82 A;  5IBN A;  5G4R A;  4YYK A;  4NYX A;  5HM0 A;  3P1E A;  4YAD A;  4TYL A;  5ENJ A;  3S91 A;  3Q2F A;  5DFB A;  2DVQ A;  4KV4 A;  3U5M A;  3P1C A;  2F6N A;  4YH3 A;  1X0J A;  5LKU A;  5A5N A;  4IOQ A;  4CL9 A;  4HXS A;  5CUA A;  5FB1 A;  5FBX A;  5EM3 A;  5A82 A;  5CUG A;  4O7A A;  3ONI A;  5FE2 A;  4O77 A;  3O35 A;  2FSA A;  5CQ4 A;  5I86 A;  4HXN A;  5D3S A;  4N4H A;  4TT2 A;  5ENF A;  5CQ3 A;  5E9V A;  3UV5 A;  5LKZ A;  5A85 A;  4X2I A;  3MB3 A;  4UIU A;  5FE4 A;  4TZ8 A;  2KTB B;  3QZS A;  4QB3 A;  4MEN A;  3DAI A;  3AAD A;  4QNS A;  5D7X A;  4Y03 A;  4LZ2 A;  5DFD A;  5FG6 A;  4NUC A;  4C67 A;  5DYU A;  5DYX A;  4QC1 A;  4QZS A;  4MR3 A;  4LYW A;  5K29 A;  4MR6 A;  2D9E A;  4QEW A;  5FDZ A;  4FLP A;  3JVL A;  3P1F A;  4TT4 A;  5D3N A;  4YYM A;  5L8T A;  5D0C A;  5I88 A;  2RS9 B;  4YK0 A;  5LJ0 A;  5E7D A;  5EK9 A;  5EWH A;  2I8N A;  5DKC A;  5LKT A;  4J1P A;  5FH6 A;  4NR4 A;  4QEU A;  2OSS A;  5L99 A;  5IID A;  5FE1 A;  5HFR A;  2G4A A;  5EP7 A;  5BT5 A;  4NR8 A;  5ENC A;  5HRW A;  5L8U A;  4KCX A;  4NR6 A;  5AD2 A;  4O7C A;  4O74 A;  5D3T A;  5COI A;  4O75 A;  5F1L A;  3UW9 A;  4ALH A;  5FE3 A;  2RFJ A;  3HMH A;  5ENG A;  5A5Q A;  5E73 A;  5A7C A;  5BT4 A;  4YYD A;  3IU5 A;  2OO1 A;  4PCI A;  5H1T A;  4Q0N A;  5EQ1 A;  1E6I A;  4Q0O A;  2R10 A;  3UV2 A;  4TZ2 A;  2YEK A;  5CUD A;  2DVR A;  2F6J A;  5CPE A;  5CQ8 A;  4IOR A;  4XYA A;  5DYC A;  5A5P A;  2I7K A;  4KV1 A;  5EIC A;  4CLB A;  2E7N A;  5HLS A;  4HXR A;  4CUT A;  5DBM A;  4BW4 A;  5LJ1 A;  4YBS A;  5EPS A;  4PS5 A;  5F1H A;  5FH8 A;  3NXB A;  4CUS A;  4QUU A;  5L97 A;  5CRZ A;  4HBX A;  5EWW A;  5D3J A;  4YYJ A;  4A9K A;  3FKM X;  3SVF A;  5IGM A;  5E9L A;  4MR4 A;  3O34 A;  4YYN A;  4QYD A;  4IR4 A;  2YDW A;  4J0R A;  4NQN A;  4F3I A;  3I3J A;  4A9J A;  5DLZ A;  2R0S A;  4Z6H A;  5I7X A;  4QY4 A;  3UVD A;  5F5Z A;  5CZG A;  5HRV A;  3LQJ A;  4LDF A;  4BW3 A;  1F68 A;  5F36 A;  5CQ7 A;  4AKN A;  3LQI A;  3MXF A;  4UIZ A;  3JVJ A;  4UIY A;  5IGL A;  5IGK A;  3GG3 A;  5CQA A;  4YAB A;  2L84 A;  2RNW A;  5KTX A;  4QSR A;  5EA1 A;  5E9Y A;  5ETB A;  4UYF A;  2R0V A;  4UIW A;  2RI7 A;  3O37 A;  5FE7 A;  5EI4 A;  5HQ6 A;  4NUE A;  5D26 A;  5EWC A;  4NR7 A;  4HXK A;  5FFW A;  4HXP A;  4HBY A;  4TT6 A;  4J0S A;  4CUU A;  4QEV A;  5A83 A;  4LR6 A;  4A9O A;  4XY8 A;  5ENE A;  3QZT A;  5FB0 A;  5ENH A;  5EWV A;  5CUC A;  5F62 A;  5ENI A;  4NYV A;  5D25 A;  4MEQ A;  4N4I A;  2DVV A;  4A9H A;  3G0L A;  3MUL A;  4BJX A;  5CS8 A;  5EU1 A;  3RCW A;  3S92 A;  2RO1 A;  3G0J A;  4WIV A;  4CFL A;  4QSP A;  3DWY A;  5CP5 A;  4XY9 A;  4TQN A;  5CU8 A;  5C7N A;  3U5J A;  4NYW A;  5CFW A;  5LUU A;  4QSW A;  4TU6 A;  3UV4 A;  5I1Q A;  4O71 A;  4CUP A;  5L98 A;  4LZS A;  2L85 A;  4YYG A;  4CUR A;  4A9N A;  5FE8 A;  4QSQ A;  3P5O A;  4LRG A;  4Z6I A;  2DWW A;  4CFK A;  4YAX A;  2NXB A;  5CGP A;  2YEL A;  2DVS A;  4UIV A;  5TB6 A;  1JSP B;  5H1U A;  5EV9 A;  5LKX A;  5FG4 A;  5DYA A;  5KTU A;  3UVY A;  5A5O A;  5I83 A;  1WUM A;  3O36 A;  5F61 A;  5I7Y A;  4OUF A;  1EQF A;  5KO4 A;  4ZW1 A;  4BW2 A;  3MB4 A;  5DW2 A;  5LVQ A;  4A9M A;  4MR5 A;  5AMF A;  4UYF B;  3K2J A;  5FE6 A;  5C87 A;  5C4Q A;  3UVX A;  5A5S A;  2RNX A;  5CUB A;  5HEL A;  4O78 A;  5ENB A;  4NRC A;  4PKL A;  5DW1 A;  4HBW A;  4QC3 A;  4YYI A;  5CQT A;  5TCM A;  4TS8 A;  5DFC A;  4N3W A;  4BHW A;  4OGJ A;  3LXJ A;  5D3H A;  4LC2 A;  3U5L A;  4QR3 A;  5C8G A;  4QSU A;  4LZR A;  4QYL A;  4WHW A;  4O7E A;  4YYH A;  5LJ2 A;  5DX4 A;  4A9I A;  2OUO A;  4A9F A;  2R0Y A;  2L5E A;  4YBM A;  5DKD A;  4O76 A;  4PTB A;  5J0D A;  5D3L A;  3JVK A;  4NRA A;  3LQH A;  5IGN A;  1JM4 B;  3UVW A;  4E96 A;  4LYS A;  3IU6 A;  5E74 A;  5F2P A;  5KU3 A;  5FE0 A;  5FFY A;  5HQ5 A;  5ACY A;  5HEN A;  5C85 A;  2YYN A;  4NR9 A;  4O70 A;  5JWM A;  4YH4 A;  4RVR A;  2E3K A;  5KHM A;  5ETD A;  5A5R A;  3JVM A;  3MUK A;  4ZQL A;  4UIT A;  4TTE A;  5CRM A;  4NXJ A;  5IG6 A;  5HRX A;  4NQM A;  5HCL A; 
#chains in the Genus database with same CATH topology
 5CQ6 A;  2GRC A;  4HXL A;  4IOO A;  2LSP B;  4YC9 A;  3U5O A;  5KTW A;  4UYE A;  5D24 A;  4N4F A;  4TU4 A;  3O33 A;  4QSV A;  5C89 A;  2DAT A;  4YBT A;  4PCE A;  4N4G A;  2YQD A;  4HXM A;  4J3I A;  4DON A;  5F3A A;  3ZYU A;  4A9L A;  5FE5 A;  5E9M A;  2E7O A;  5I29 A;  1ZS5 A;  5CUE A;  5E3G A;  2WP2 A;  4LYI A;  3QZV A;  3SVG A;  5E3D A;  2YEM A;  5AD3 A;  3VKG A;  5F25 A;  3HMF A;  4HBV A;  1WUG A;  4UIX A;  2WP1 A;  4IR5 A;  5E9I A;  2H60 A;  4QR5 A;  2MJV B;  5HFQ A;  3Q2E A;  4MEO A;  4NS5 A;  4ALG A;  3SVH A;  5EGU A;  4CUQ A;  3TLP A;  4QST A;  5F63 A;  4XUB A;  4WHU A;  4BW1 A;  4OGI A;  5EIS A;  1PUO A;  5E0R A;  5CY9 A;  5JI8 A;  1N72 A;  5G4S A;  5EWD A;  4Z1S A;  5BT3 A;  3U5P A;  5EPR A;  5H1V A;  5HQ7 A;  4C66 A;  5DLX A;  2YW5 A;  4YY6 A;  5L96 A;  5CQ5 A;  4Z93 A;  4O72 A;  5D3R A;  5II2 A;  3U5N A;  4XUA A;  4QBM A;  4UYG A;  5FFV A;  3U5K A;  4O7B A;  5F60 A;  4QSS A;  5FE9 A;  5II1 A;  3LJW A;  5H85 A;  4ZC9 A;  4PY6 A;  5I80 A;  2DKW A;  4IR3 A;  3HME A;  4GPJ A;  5FH7 A;  5E9K A;  3D7C A;  5CTL A;  5DY7 A;  4HXO A;  4MEP A;  2RNY A;  4UYD A;  5HEM A;  5D3P A;  5HJC A;  5LVR A;  4IR6 A;  4QUT A;  5I89 A;  5FG5 A;  5A81 A;  3AQA A;  5EVA A;  4Z1Q A;  5I40 A;  3MQM A;  4A9E A;  2N9G A;  4NRB A;  4YY4 A;  4NR5 A;  5EPB A;  5DKH A;  5AME A;  4QSX A;  4AI6 A;  4UYH A;  3P1D A;  4QR4 A;  4YAT A;  4O7F A;  4NUD A;  2D82 A;  5IBN A;  5G4R A;  4YYK A;  4NYX A;  5HM0 A;  3P1E A;  4YAD A;  4TYL A;  5ENJ A;  3S91 A;  3Q2F A;  5DFB A;  2DVQ A;  4KV4 A;  3U5M A;  3P1C A;  2F6N A;  4YH3 A;  1X0J A;  5LKU A;  5A5N A;  4IOQ A;  4CL9 A;  4HXS A;  5CUA A;  5FB1 A;  5FBX A;  5EM3 A;  5A82 A;  5CUG A;  4O7A A;  3ONI A;  5FE2 A;  4O77 A;  3O35 A;  2FSA A;  5CQ4 A;  5I86 A;  4HXN A;  5D3S A;  4N4H A;  4TT2 A;  5ENF A;  5CQ3 A;  5E9V A;  3UV5 A;  5LKZ A;  5A85 A;  4X2I A;  3MB3 A;  4UIU A;  5FE4 A;  4TZ8 A;  2KTB B;  3QZS A;  4QB3 A;  4MEN A;  3DAI A;  3AAD A;  4QNS A;  5D7X A;  4Y03 A;  4LZ2 A;  5DFD A;  5FG6 A;  4NUC A;  4C67 A;  5DYU A;  5DYX A;  4QC1 A;  4QZS A;  4MR3 A;  4LYW A;  5K29 A;  4MR6 A;  2D9E A;  4QEW A;  5FDZ A;  4FLP A;  3JVL A;  3P1F A;  4TT4 A;  5D3N A;  4YYM A;  5L8T A;  5D0C A;  5I88 A;  2RS9 B;  4YK0 A;  5LJ0 A;  5E7D A;  5EK9 A;  5EWH A;  2I8N A;  5DKC A;  5LKT A;  4J1P A;  5FH6 A;  4NR4 A;  4QEU A;  2OSS A;  5L99 A;  5IID A;  3ERR A;  5FE1 A;  2EJN A;  5HFR A;  2G4A A;  5EP7 A;  4AKH A;  5BT5 A;  4NR8 A;  5ENC A;  5HRW A;  5L8U A;  4KCX A;  4NR6 A;  5AD2 A;  4O7C A;  4O74 A;  5D3T A;  5COI A;  4O75 A;  5F1L A;  3UW9 A;  4ALH A;  5FE3 A;  2RFJ A;  3HMH A;  5ENG A;  5A5Q A;  5E73 A;  5A7C A;  5BT4 A;  4YYD A;  3IU5 A;  2OO1 A;  4PCI A;  5H1T A;  4Q0N A;  5EQ1 A;  1E6I A;  4Q0O A;  2R10 A;  3UV2 A;  4TZ2 A;  2YEK A;  5CUD A;  2DVR A;  2F6J A;  5CPE A;  5CQ8 A;  4IOR A;  4XYA A;  5DYC A;  5A5P A;  2I7K A;  4KV1 A;  5EIC A;  4CLB A;  2E7N A;  5HLS A;  4HXR A;  4CUT A;  5DBM A;  4BW4 A;  5LJ1 A;  4YBS A;  5EPS A;  4PS5 A;  5F1H A;  5FH8 A;  3NXB A;  4CUS A;  4QUU A;  5L97 A;  5CRZ A;  4HBX A;  5EWW A;  5D3J A;  4YYJ A;  4A9K A;  3FKM X;  3SVF A;  5IGM A;  5E9L A;  4MR4 A;  3O34 A;  4YYN A;  4QYD A;  4IR4 A;  2YDW A;  4J0R A;  4NQN A;  4F3I A;  3I3J A;  4A9J A;  5DLZ A;  2R0S A;  4Z6H A;  5I7X A;  4QY4 A;  3UVD A;  5F5Z A;  5CZG A;  5HRV A;  3LQJ A;  4LDF A;  4BW3 A;  1F68 A;  5F36 A;  5CQ7 A;  4AKN A;  3LQI A;  3MXF A;  4UIZ A;  3JVJ A;  4UIY A;  5IGL A;  5IGK A;  3GG3 A;  5CQA A;  4YAB A;  2L84 A;  2RNW A;  5KTX A;  4QSR A;  5EA1 A;  5E9Y A;  5ETB A;  4UYF A;  2R0V A;  4UIW A;  2RI7 A;  3O37 A;  5FE7 A;  5EI4 A;  5HQ6 A;  4NUE A;  5D26 A;  5EWC A;  4NR7 A;  4HXK A;  5FFW A;  4HXP A;  4HBY A;  4TT6 A;  4J0S A;  4CUU A;  4QEV A;  5A83 A;  4LR6 A;  4A9O A;  4XY8 A;  5ENE A;  3QZT A;  5FB0 A;  5ENH A;  5EWV A;  5CUC A;  5F62 A;  5ENI A;  4NYV A;  5D25 A;  4MEQ A;  4N4I A;  2DVV A;  4A9H A;  3G0L A;  3MUL A;  4BJX A;  5CS8 A;  5EU1 A;  3RCW A;  3S92 A;  1ZKR A;  2RO1 A;  3G0J A;  4WIV A;  4CFL A;  4QSP A;  3DWY A;  5CP5 A;  4XY9 A;  4TQN A;  5CU8 A;  5C7N A;  3U5J A;  4NYW A;  5CFW A;  5LUU A;  4QSW A;  4TU6 A;  3UV4 A;  5I1Q A;  4O71 A;  4CUP A;  5L98 A;  4LZS A;  2L85 A;  4YYG A;  4CUR A;  4A9N A;  5FE8 A;  4QSQ A;  3P5O A;  4LRG A;  4Z6I A;  2DWW A;  4CFK A;  4YAX A;  2NXB A;  5CGP A;  2YEL A;  2DVS A;  4UIV A;  5TB6 A;  1JSP B;  5H1U A;  5EV9 A;  5LKX A;  5FG4 A;  5DYA A;  5KTU A;  3UVY A;  5A5O A;  5I83 A;  1WUM A;  3O36 A;  5F61 A;  5I7Y A;  4OUF A;  1EQF A;  5KO4 A;  4ZW1 A;  4BW2 A;  3MB4 A;  5DW2 A;  5LVQ A;  4A9M A;  4MR5 A;  5AMF A;  4UYF B;  3K2J A;  5FE6 A;  5C87 A;  5C4Q A;  3UVX A;  5A5S A;  2RNX A;  4AKI A;  5CUB A;  5HEL A;  4O78 A;  5ENB A;  3VKH A;  4NRC A;  4PKL A;  5DW1 A;  4HBW A;  4QC3 A;  4YYI A;  5CQT A;  5TCM A;  4TS8 A;  5DFC A;  4N3W A;  4BHW A;  4OGJ A;  3LXJ A;  5D3H A;  4LC2 A;  3U5L A;  4QR3 A;  3D1D A;  5C8G A;  4QSU A;  4LZR A;  4QYL A;  4WHW A;  4O7E A;  4YYH A;  5LJ2 A;  5DX4 A;  4A9I A;  2OUO A;  4A9F A;  2R0Y A;  2L5E A;  4YBM A;  5DKD A;  4O76 A;  4PTB A;  5J0D A;  4AKG A;  5D3L A;  3JVK A;  4NRA A;  3LQH A;  3D1B A;  5IGN A;  1JM4 B;  3UVW A;  4E96 A;  4LYS A;  3IU6 A;  5E74 A;  5F2P A;  5KU3 A;  5FE0 A;  5FFY A;  5HQ5 A;  5ACY A;  5HEN A;  5C85 A;  2YYN A;  4NR9 A;  4O70 A;  5JWM A;  4YH4 A;  4RVR A;  2E3K A;  5KHM A;  5ETD A;  5A5R A;  3JVM A;  3MUK A;  4ZQL A;  4UIT A;  4TTE A;  5CRM A;  4NXJ A;  5IG6 A;  5HRX A;  4NQM A;  5HCL A; 
#chains in the Genus database with same CATH homology
 5CQ6 A;  2GRC A;  4HXL A;  4IOO A;  2LSP B;  4YC9 A;  3U5O A;  5KTW A;  4UYE A;  5D24 A;  4N4F A;  4TU4 A;  3O33 A;  4QSV A;  5C89 A;  2DAT A;  4YBT A;  4PCE A;  4N4G A;  2YQD A;  4HXM A;  4J3I A;  4DON A;  5F3A A;  3ZYU A;  4A9L A;  5FE5 A;  5E9M A;  2E7O A;  5I29 A;  1ZS5 A;  5CUE A;  5E3G A;  2WP2 A;  4LYI A;  3QZV A;  3SVG A;  5E3D A;  2YEM A;  5AD3 A;  5F25 A;  3HMF A;  4HBV A;  1WUG A;  4UIX A;  2WP1 A;  4IR5 A;  5E9I A;  2H60 A;  4QR5 A;  2MJV B;  5HFQ A;  3Q2E A;  4MEO A;  4NS5 A;  4ALG A;  3SVH A;  5EGU A;  4CUQ A;  3TLP A;  4QST A;  5F63 A;  4XUB A;  4WHU A;  4BW1 A;  4OGI A;  5EIS A;  5E0R A;  5CY9 A;  5JI8 A;  1N72 A;  5G4S A;  5EWD A;  4Z1S A;  5BT3 A;  3U5P A;  5EPR A;  5H1V A;  5HQ7 A;  4C66 A;  5DLX A;  2YW5 A;  4YY6 A;  5L96 A;  5CQ5 A;  4Z93 A;  4O72 A;  5D3R A;  5II2 A;  3U5N A;  4XUA A;  4QBM A;  4UYG A;  5FFV A;  3U5K A;  4O7B A;  5F60 A;  4QSS A;  5FE9 A;  5II1 A;  3LJW A;  5H85 A;  4ZC9 A;  4PY6 A;  5I80 A;  2DKW A;  4IR3 A;  3HME A;  4GPJ A;  5FH7 A;  5E9K A;  3D7C A;  5CTL A;  5DY7 A;  4HXO A;  4MEP A;  2RNY A;  4UYD A;  5HEM A;  5D3P A;  5HJC A;  5LVR A;  4IR6 A;  4QUT A;  5I89 A;  5FG5 A;  5A81 A;  3AQA A;  5EVA A;  4Z1Q A;  5I40 A;  3MQM A;  4A9E A;  2N9G A;  4NRB A;  4YY4 A;  4NR5 A;  5EPB A;  5DKH A;  5AME A;  4QSX A;  4UYH A;  3P1D A;  4QR4 A;  4YAT A;  4O7F A;  4NUD A;  2D82 A;  5IBN A;  5G4R A;  4YYK A;  4NYX A;  5HM0 A;  3P1E A;  4YAD A;  4TYL A;  5ENJ A;  3S91 A;  3Q2F A;  5DFB A;  2DVQ A;  4KV4 A;  3U5M A;  3P1C A;  2F6N A;  4YH3 A;  1X0J A;  5LKU A;  5A5N A;  4IOQ A;  4CL9 A;  4HXS A;  5CUA A;  5FB1 A;  5FBX A;  5EM3 A;  5A82 A;  5CUG A;  4O7A A;  3ONI A;  5FE2 A;  4O77 A;  3O35 A;  2FSA A;  5CQ4 A;  5I86 A;  4HXN A;  5D3S A;  4N4H A;  4TT2 A;  5ENF A;  5CQ3 A;  5E9V A;  3UV5 A;  5LKZ A;  5A85 A;  4X2I A;  3MB3 A;  4UIU A;  5FE4 A;  4TZ8 A;  2KTB B;  3QZS A;  4QB3 A;  4MEN A;  3DAI A;  3AAD A;  4QNS A;  5D7X A;  4Y03 A;  4LZ2 A;  5DFD A;  5FG6 A;  4NUC A;  4C67 A;  5DYU A;  5DYX A;  4QC1 A;  4QZS A;  4MR3 A;  4LYW A;  5K29 A;  4MR6 A;  2D9E A;  4QEW A;  5FDZ A;  4FLP A;  3JVL A;  3P1F A;  4TT4 A;  5D3N A;  4YYM A;  5L8T A;  5D0C A;  5I88 A;  2RS9 B;  4YK0 A;  5LJ0 A;  5E7D A;  5EK9 A;  5EWH A;  2I8N A;  5DKC A;  5LKT A;  4J1P A;  5FH6 A;  4NR4 A;  4QEU A;  2OSS A;  5L99 A;  5IID A;  5FE1 A;  5HFR A;  2G4A A;  5EP7 A;  5BT5 A;  4NR8 A;  5ENC A;  5HRW A;  5L8U A;  4KCX A;  4NR6 A;  5AD2 A;  4O7C A;  4O74 A;  5D3T A;  5COI A;  4O75 A;  5F1L A;  3UW9 A;  4ALH A;  5FE3 A;  2RFJ A;  3HMH A;  5ENG A;  5A5Q A;  5E73 A;  5A7C A;  5BT4 A;  4YYD A;  3IU5 A;  2OO1 A;  4PCI A;  5H1T A;  4Q0N A;  5EQ1 A;  1E6I A;  4Q0O A;  2R10 A;  3UV2 A;  4TZ2 A;  2YEK A;  5CUD A;  2DVR A;  2F6J A;  5CPE A;  5CQ8 A;  4IOR A;  4XYA A;  5DYC A;  5A5P A;  2I7K A;  4KV1 A;  5EIC A;  4CLB A;  2E7N A;  5HLS A;  4HXR A;  4CUT A;  5DBM A;  4BW4 A;  5LJ1 A;  4YBS A;  5EPS A;  4PS5 A;  5F1H A;  5FH8 A;  3NXB A;  4CUS A;  4QUU A;  5L97 A;  5CRZ A;  4HBX A;  5EWW A;  5D3J A;  4YYJ A;  4A9K A;  3FKM X;  3SVF A;  5IGM A;  5E9L A;  4MR4 A;  3O34 A;  4YYN A;  4QYD A;  4IR4 A;  2YDW A;  4J0R A;  4NQN A;  4F3I A;  3I3J A;  4A9J A;  5DLZ A;  2R0S A;  4Z6H A;  5I7X A;  4QY4 A;  3UVD A;  5F5Z A;  5CZG A;  5HRV A;  3LQJ A;  4LDF A;  4BW3 A;  1F68 A;  5F36 A;  5CQ7 A;  4AKN A;  3LQI A;  3MXF A;  4UIZ A;  3JVJ A;  4UIY A;  5IGL A;  5IGK A;  3GG3 A;  5CQA A;  4YAB A;  2L84 A;  2RNW A;  5KTX A;  4QSR A;  5EA1 A;  5E9Y A;  5ETB A;  4UYF A;  2R0V A;  4UIW A;  2RI7 A;  3O37 A;  5FE7 A;  5EI4 A;  5HQ6 A;  4NUE A;  5D26 A;  5EWC A;  4NR7 A;  4HXK A;  5FFW A;  4HXP A;  4HBY A;  4TT6 A;  4J0S A;  4CUU A;  4QEV A;  5A83 A;  4LR6 A;  4A9O A;  4XY8 A;  5ENE A;  3QZT A;  5FB0 A;  5ENH A;  5EWV A;  5CUC A;  5F62 A;  5ENI A;  4NYV A;  5D25 A;  4MEQ A;  4N4I A;  2DVV A;  4A9H A;  3G0L A;  3MUL A;  4BJX A;  5CS8 A;  5EU1 A;  3RCW A;  3S92 A;  2RO1 A;  3G0J A;  4WIV A;  4CFL A;  4QSP A;  3DWY A;  5CP5 A;  4XY9 A;  4TQN A;  5CU8 A;  5C7N A;  3U5J A;  4NYW A;  5CFW A;  5LUU A;  4QSW A;  4TU6 A;  3UV4 A;  5I1Q A;  4O71 A;  4CUP A;  5L98 A;  4LZS A;  2L85 A;  4YYG A;  4CUR A;  4A9N A;  5FE8 A;  4QSQ A;  3P5O A;  4LRG A;  4Z6I A;  2DWW A;  4CFK A;  4YAX A;  2NXB A;  5CGP A;  2YEL A;  2DVS A;  4UIV A;  5TB6 A;  1JSP B;  5H1U A;  5EV9 A;  5LKX A;  5FG4 A;  5DYA A;  5KTU A;  3UVY A;  5A5O A;  5I83 A;  1WUM A;  3O36 A;  5F61 A;  5I7Y A;  4OUF A;  1EQF A;  5KO4 A;  4ZW1 A;  4BW2 A;  3MB4 A;  5DW2 A;  5LVQ A;  4A9M A;  4MR5 A;  5AMF A;  4UYF B;  3K2J A;  5FE6 A;  5C87 A;  5C4Q A;  3UVX A;  5A5S A;  2RNX A;  5CUB A;  5HEL A;  4O78 A;  5ENB A;  4NRC A;  4PKL A;  5DW1 A;  4HBW A;  4QC3 A;  4YYI A;  5CQT A;  5TCM A;  4TS8 A;  5DFC A;  4N3W A;  4BHW A;  4OGJ A;  3LXJ A;  5D3H A;  4LC2 A;  3U5L A;  4QR3 A;  5C8G A;  4QSU A;  4LZR A;  4QYL A;  4WHW A;  4O7E A;  4YYH A;  5LJ2 A;  5DX4 A;  4A9I A;  2OUO A;  4A9F A;  2R0Y A;  2L5E A;  4YBM A;  5DKD A;  4O76 A;  4PTB A;  5J0D A;  5D3L A;  3JVK A;  4NRA A;  3LQH A;  5IGN A;  1JM4 B;  3UVW A;  4E96 A;  4LYS A;  3IU6 A;  5E74 A;  5F2P A;  5KU3 A;  5FE0 A;  5FFY A;  5HQ5 A;  5ACY A;  5HEN A;  5C85 A;  2YYN A;  4NR9 A;  4O70 A;  5JWM A;  4YH4 A;  4RVR A;  2E3K A;  5KHM A;  5ETD A;  5A5R A;  3JVM A;  3MUK A;  4ZQL A;  4UIT A;  4TTE A;  5CRM A;  4NXJ A;  5IG6 A;  5HRX A;  4NQM A;  5HCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...