5ENHA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-12 n11528 (sgc - diamond i04-1 fragment screening)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
molecule keywords PH-interacting protein
molecule tags Signaling protein
source organism Homo sapiens
total genus 48
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enhA00
2RNWA 2I8NA 4LC2A 5HRXA 5HJCA 4A9FA 4NXJA 5CY9A 4MEPA 4Y03A 5DFDA 5FFYA 3JVJA 4OUFA 4UIUA 5LUUA 4UIZA 5FG6A 4N4IA 5C85A 4TTEA 5D26A 5A5PA 4QSQA 5G4RA 5A5SA 4YYKA 4A9HA 5C4QA 3QZVA 5FE9A 4LR6A 2GRCA 5ETDA 4QNSA 4WHWA 5AMFA 2RNXA 5E9KA 4UYEA 5EWCA 3MULA 5FE1A 5COIA 4CL9A 5ENJA 3QZSA 5L8TA 5D7XA 5AD2A 5CPEA 3Q2EA 5D3SA 3G0LA 3MB4A 2F6NA 3AADA 4NYVA 5ENIA 4AKNA 2R0YA 5EVAA 5F61A 4O70A 5CQ5A 5DBMA 3UV5A 2D9EA 5A5RA 3U5NA 4UYDA 5E9YA 4YYMA 5A82A 5LKTA 4HBYA 5CQ6A 4YC9A 5ENHA 5E3DA 4PCEA 5KTXA 2NXBA 5D25A 5IGMA 5DKCA 4WIVA 5L97A 2YQDA 5CUGA 5L99A 5EP7A 4NR5A 2YELA 4O78A 5DYAA 5EA1A 5EPRA 4MENA 4IR3A 2WP2A 2DVRA 5EWVA 5CQ7A 5EICA 5F62A 4NRCA 4HXMA 3O35A 4ZQLA 4MEOA 3U5KA 4BW1A 5ENBA 5DW1A 4Z6HA 5H1TA 4CFLA 5D3HA 5HLSA 3RCWA 4MR4A 3LQJA 4TZ2A 4MEQA 5ENCA 5C8GA 5CRZA 5EQ1A 4CURA 4LDFA 4BJXA 5KHMA 3S92A 5C87A 5FG4A 5FB0A 4NYWA 4XUAA 4J0RA 4O72A 5FH8A 5CUDA 5ENFA 5KTWA 4TZ8A 5CQ3A 2E7NA 3HMEA 3LXJA 4PCIA 4A9LA 5EGUA 5D3NA 5L8UA 3P1EA 4YYIA 4HXNA 4MR6A 4CUQA 5ACYA 1WUMA 4QY4A 5E9MA 5D3PA 4TS8A 5CZGA 5A5QA 4UYFA 4HBXA 4O7BA 5E3GA 5I86A 5CS8A 5CQAA 4J1PA 5KU3A 4YBSA 3UVDA 4QSVA 4KV4A 5CFWA 3G0JA 4Q0OA 4HXKA 5E73A 5G4SA 4A9JA 2YW5A 4O7FA 4QSXA 4UIVA 5FB1A 2MJVB 2OSSA 4NR8A 5EM3A 3U5PA 4PKLA 5C7NA 4N4GA 4NUCA 5CU8A 5F2PA 4YK0A 3HMHA 4QC3A 4YABA 2F6JA 4QSUA 4N3WA 5CP5A 5DYCA 5A85A 4YBMA 4TT4A 4NRBA 3DAIA 3QZTA 5CQ4A 5LVRA 5BT3A 5I7XA 2R0SA 1E6IA 5D3LA 4QEWA 5HENA 4ALGA 5HFRA 4QC1A 4A9KA 5IIDA 4IR4A 3HMFA 4LRGA 2I7KA 4A9NA 4C66A 3P5OA 1EQFA 4CUTA 5D3TA 3SVFA 4YYNA 2H60A 5LJ2A 5HELA 4MR3A 4QYLA 5DW2A 2R10A 5CUEA 3P1DA 3LQHA 4UIYA 3JVMA 5DLZA 5FG5A 5KO4A 4LYWA 4O7AA 5EPBA 4PTBA 3UVWA 4O7EA 5EPSA 5BT5A 4PS5A 5L98A 3MQMA 5JI8A 5HRVA 4CUPA 5DYXA 4NR9A 4RVRA 3MUKA 4IR6A 5FBXA 2RI7A 5FE6A 5I1QA 5I7YA 4QSWA 3P1CA 4QUTA 4QR3A 4YH3A 2YDWA 5CUBA 5FE3A 5J0DA 4KV1A 4XUBA 5DKHA 4XYAA 5A5NA 4QR4A 2DVQA 3FKMX 5EWHA 5LJ1A 4N4FA 1X0JA 4YAXA 1ZS5A 2E3KA 3S91A 4YYGA 5EI4A 4Q0NA 4YYHA 4XY8A 5F60A 5AD3A 4CUSA 2L85A 5EWWA 5DY7A 5CQ8A 5D24A 5HQ6A 2E7OA 5K29A 5DFCA 4O77A 3O33A 2L5EA 2YYNA 5L96A 3DWYA 4ZC9A 5II1A 3JVKA 3SVHA 4NQMA 4TU4A 2YEKA 5I80A 4C67A 4UYHA 5F3AA 4UITA 2DATA 3IU5A 5E74A 4OGIA 1F68A 4XY9A 5EU1A 4HXRA 5FE4A 3TLPA 4OGJA 4J3IA 4BW2A 5FFWA 5C89A 4NR4A 4YYDA 5IBNA 4YY6A 2DVVA 4QBMA 5IGLA 4CUUA 4NR6A 3D7CA 5CRMA 3Q2FA 2D82A 5CTLA 5HFQA 5FH7A 5AMEA 2OUOA 2RNYA 4PY6A 4O74A 4HXOA 5DYUA 5EK9A 1JSPB 2DKWA 2G4AA 4A9OA 4QZSA 5HEMA 2DWWA 4KCXA 4YBTA 5CQTA 4QSSA 4A9EA 3U5JA 4ALHA 5HQ5A 4A9IA 5HCLA 4HXLA 5FE8A 5H1VA 2OO1A 4NR7A 4QEVA 4QYDA 5D3RA 2N9GA 4BW4A 5F36A 5A5OA 2RS9B 2L84A 5H1UA 5I83A 3UV4A 3U5OA 5E9LA 4J0SA 4NYXA 4TQNA 5A7CA 5TCMA 5DFBA 5D3JA 3JVLA 4O76A 3NXBA 5CGPA 4GPJA 4Z1SA 4NUEA 3ONIA 5LJ0A 4ZW1A 5IGNA 4CLBA 4LYIA 4LYSA 5JWMA 5LKXA 5FE2A 4QSTA 4UIWA 5HRWA 5II2A 5LVQA 5LKUA 5E9VA 5CUCA 4TYLA 5TB6A 5LKZA 5F1LA 4HBWA 3UVXA 4IORA 5IGKA 4HXPA 4NRAA 5A81A 4HXSA 4QR5A 5F25A 5DX4A 5HQ7A 5I89A 4QUUA 3O34A 5EV9A 4UYFB 4YH4A 4TT2A 4N4HA 4NS5A 1N72A 4Z1QA 3LJWA 3GG3A 4Z6IA 5I29A 4NQNA 3SVGA 3LQIA 2FSAA 4IR5A 4TT6A 3U5LA 4YYJA 3UV2A 5FDZA 5I88A 4UIXA 4X2IA 5FFVA 3P1FA 5KTUA 2RO1A 5ENEA 4CFKA 1WUGA 5I40A 4O71A 3UVYA 4WHUA 4LZRA 4O75A 5HM0A 4BHWA 4Z93A 2LSPB 5E9IA 3O37A 4E96A 3UW9A 4NUDA 3U5MA 2KTBB 3MXFA 4A9MA 4QSPA 5D0CA 5DLXA 4UYGA 4IOOA 4YY4A 4YADA 5CUAA 2WP1A 2RFJA 3K2JA 5F63A 3ZYUA 2R0VA 5ENGA 2YEMA 4BW3A 1JM4B 4HBVA 5H85A 2DVSA 5E0RA 4MR5A 5ETBA 5F5ZA 4LZSA 5F1HA 4IOQA 5IG6A 5A83A 3MB3A 5FE7A 4TU6A 4YATA 3IU6A 4O7CA 5EISA 5FE5A 5BT4A 4F3IA 5DKDA 5E7DA 5FE0A 3I3JA 4FLPA 4QSRA 4DONA 3AQAA 5EWDA 4LZ2A 3O36A 4QEUA 4QB3A 5FH6A
chains in the Genus database with same CATH superfamily
2RNWA 2I8NA 4LC2A 5HRXA 5HJCA 4A9FA 4NXJA 5CY9A 4MEPA 4Y03A 5DFDA 5FFYA 3JVJA 4OUFA 4UIUA 5LUUA 4UIZA 5FG6A 4N4IA 5C85A 4TTEA 5D26A 5A5PA 4QSQA 5G4RA 5A5SA 4YYKA 4A9HA 5C4QA 3QZVA 5FE9A 4LR6A 2GRCA 5ETDA 4QNSA 4WHWA 5AMFA 2RNXA 5E9KA 4UYEA 5EWCA 1ZKRA 3MULA 5FE1A 5COIA 4CL9A 5ENJA 3QZSA 5L8TA 5D7XA 5AD2A 5CPEA 3Q2EA 5D3SA 3G0LA 3MB4A 2F6NA 3AADA 4NYVA 5ENIA 4AKNA 2R0YA 5EVAA 5F61A 4O70A 1PUOA 5CQ5A 5DBMA 3UV5A 2D9EA 5A5RA 3U5NA 4UYDA 5E9YA 4YYMA 5A82A 5LKTA 4HBYA 5CQ6A 4YC9A 5ENHA 5E3DA 4PCEA 5KTXA 2NXBA 5D25A 5IGMA 5DKCA 4WIVA 5L97A 2YQDA 5CUGA 5L99A 2EJNA 5EP7A 4NR5A 2YELA 4O78A 5DYAA 5EA1A 5EPRA 4MENA 4IR3A 2WP2A 2DVRA 5EWVA 5CQ7A 5EICA 5F62A 4NRCA 4HXMA 3O35A 4ZQLA 4MEOA 3U5KA 4BW1A 5ENBA 5DW1A 4Z6HA 5H1TA 4CFLA 5D3HA 5HLSA 3RCWA 4MR4A 3LQJA 4TZ2A 4MEQA 5ENCA 5C8GA 5CRZA 5EQ1A 4CURA 4LDFA 4BJXA 5KHMA 3S92A 5C87A 5FG4A 5FB0A 4NYWA 4XUAA 4J0RA 4O72A 5FH8A 5CUDA 5ENFA 5KTWA 4TZ8A 5CQ3A 2E7NA 3HMEA 3LXJA 4PCIA 4A9LA 5EGUA 5D3NA 5L8UA 3P1EA 4YYIA 4HXNA 4MR6A 4CUQA 5ACYA 1WUMA 4QY4A 5E9MA 5D3PA 4TS8A 5CZGA 5A5QA 4UYFA 4HBXA 4O7BA 5E3GA 5I86A 5CS8A 5CQAA 4J1PA 5KU3A 4YBSA 3UVDA 4QSVA 4KV4A 5CFWA 3G0JA 4Q0OA 4HXKA 5E73A 5G4SA 4A9JA 2YW5A 4O7FA 4QSXA 4UIVA 5FB1A 2MJVB 2OSSA 3D1BA 4NR8A 5EM3A 3U5PA 4PKLA 3VKHA 5C7NA 4N4GA 4NUCA 5CU8A 5F2PA 4YK0A 3HMHA 4QC3A 4YABA 2F6JA 4QSUA 4N3WA 5CP5A 5DYCA 5A85A 4YBMA 4TT4A 4NRBA 3DAIA 3QZTA 5CQ4A 5LVRA 5BT3A 5I7XA 2R0SA 1E6IA 5D3LA 4QEWA 5HENA 4ALGA 5HFRA 4QC1A 4A9KA 5IIDA 4IR4A 3HMFA 4LRGA 2I7KA 4A9NA 4C66A 3P5OA 1EQFA 4AKGA 4CUTA 5D3TA 3SVFA 4YYNA 2H60A 5LJ2A 5HELA 4MR3A 4QYLA 5DW2A 2R10A 5CUEA 3P1DA 3LQHA 4UIYA 3JVMA 5DLZA 5FG5A 5KO4A 4LYWA 4O7AA 5EPBA 4PTBA 3UVWA 4O7EA 5EPSA 5BT5A 4PS5A 5L98A 3MQMA 5JI8A 5HRVA 4CUPA 5DYXA 4NR9A 4RVRA 3MUKA 4IR6A 5FBXA 2RI7A 5FE6A 5I1QA 5I7YA 4QSWA 3P1CA 4QUTA 4QR3A 4YH3A 2YDWA 5CUBA 5FE3A 5J0DA 4KV1A 4XUBA 5DKHA 4XYAA 5A5NA 4QR4A 2DVQA 3FKMX 5EWHA 5LJ1A 4N4FA 1X0JA 4YAXA 1ZS5A 2E3KA 3S91A 4YYGA 5EI4A 4Q0NA 4YYHA 4XY8A 5F60A 5AD3A 4CUSA 2L85A 5EWWA 5DY7A 5CQ8A 5D24A 5HQ6A 2E7OA 5K29A 5DFCA 4O77A 3O33A 2L5EA 2YYNA 5L96A 3DWYA 4ZC9A 5II1A 3JVKA 3SVHA 4NQMA 4TU4A 2YEKA 5I80A 4C67A 4UYHA 5F3AA 4UITA 2DATA 3IU5A 5E74A 4OGIA 1F68A 4XY9A 5EU1A 4HXRA 5FE4A 3TLPA 4OGJA 4J3IA 4BW2A 5FFWA 5C89A 4NR4A 4YYDA 5IBNA 4YY6A 2DVVA 4QBMA 5IGLA 4CUUA 4NR6A 3D7CA 5CRMA 3Q2FA 2D82A 5CTLA 5HFQA 5FH7A 5AMEA 2OUOA 2RNYA 4PY6A 4O74A 4HXOA 5DYUA 5EK9A 1JSPB 2DKWA 2G4AA 3ERRA 4A9OA 4QZSA 5HEMA 2DWWA 4KCXA 4YBTA 5CQTA 4QSSA 4A9EA 3U5JA 4ALHA 5HQ5A 4A9IA 5HCLA 4HXLA 5FE8A 5H1VA 2OO1A 4NR7A 4QEVA 4QYDA 5D3RA 2N9GA 4BW4A 5F36A 5A5OA 2RS9B 2L84A 5H1UA 5I83A 3UV4A 3U5OA 5E9LA 4J0SA 4NYXA 4TQNA 5A7CA 5TCMA 5DFBA 5D3JA 3JVLA 4O76A 3NXBA 5CGPA 4GPJA 4Z1SA 4NUEA 3ONIA 5LJ0A 4ZW1A 5IGNA 4CLBA 4LYIA 4LYSA 5JWMA 5LKXA 5FE2A 4QSTA 4UIWA 5HRWA 5II2A 5LVQA 5LKUA 5E9VA 5CUCA 4TYLA 5TB6A 5LKZA 5F1LA 4HBWA 3UVXA 4IORA 5IGKA 4HXPA 4NRAA 5A81A 4HXSA 4QR5A 5F25A 3VKGA 5DX4A 5HQ7A 5I89A 4QUUA 3O34A 5EV9A 4UYFB 4YH4A 4TT2A 4N4HA 4NS5A 1N72A 4Z1QA 3LJWA 3GG3A 4Z6IA 5I29A 4NQNA 3SVGA 3LQIA 2FSAA 4IR5A 4TT6A 3U5LA 4YYJA 4AKIA 3UV2A 5FDZA 5I88A 4UIXA 4X2IA 5FFVA 3P1FA 5KTUA 2RO1A 5ENEA 4CFKA 1WUGA 5I40A 4O71A 3UVYA 4AKHA 4WHUA 4LZRA 4O75A 5HM0A 4BHWA 4Z93A 2LSPB 5E9IA 3O37A 4E96A 3UW9A 4NUDA 3U5MA 2KTBB 3MXFA 4A9MA 4QSPA 5D0CA 5DLXA 4UYGA 4IOOA 4YY4A 4YADA 5CUAA 2WP1A 2RFJA 3K2JA 5F63A 3ZYUA 2R0VA 5ENGA 2YEMA 4BW3A 1JM4B 4HBVA 5H85A 2DVSA 5E0RA 4MR5A 5ETBA 5F5ZA 4LZSA 5F1HA 4IOQA 5IG6A 5A83A 3MB3A 5FE7A 4TU6A 4YATA 3IU6A 4O7CA 5EISA 5FE5A 5BT4A 4F3IA 5DKDA 5E7DA 5FE0A 3I3JA 4FLPA 4QSRA 4AI6A 4DONA 3AQAA 5EWDA 3D1DA 4LZ2A 3O36A 4QEUA 4QB3A 5FH6A
chains in the Genus database with same CATH topology
2RNWA 2I8NA 4LC2A 5HRXA 5HJCA 4A9FA 4NXJA 5CY9A 4MEPA 4Y03A 5DFDA 5FFYA 3JVJA 4OUFA 4UIUA 5LUUA 4UIZA 5FG6A 4N4IA 5C85A 4TTEA 5D26A 5A5PA 4QSQA 5G4RA 5A5SA 4YYKA 4A9HA 5C4QA 3QZVA 5FE9A 4LR6A 2GRCA 5ETDA 4QNSA 4WHWA 5AMFA 2RNXA 5E9KA 4UYEA 5EWCA 3MULA 5FE1A 5COIA 4CL9A 5ENJA 3QZSA 5L8TA 5D7XA 5AD2A 5CPEA 3Q2EA 5D3SA 3G0LA 3MB4A 2F6NA 3AADA 4NYVA 5ENIA 4AKNA 2R0YA 5EVAA 5F61A 4O70A 5CQ5A 5DBMA 3UV5A 2D9EA 5A5RA 3U5NA 4UYDA 5E9YA 4YYMA 5A82A 5LKTA 4HBYA 5CQ6A 4YC9A 5ENHA 5E3DA 4PCEA 5KTXA 2NXBA 5D25A 5IGMA 5DKCA 4WIVA 5L97A 2YQDA 5CUGA 5L99A 5EP7A 4NR5A 2YELA 4O78A 5DYAA 5EA1A 5EPRA 4MENA 4IR3A 2WP2A 2DVRA 5EWVA 5CQ7A 5EICA 5F62A 4NRCA 4HXMA 3O35A 4ZQLA 4MEOA 3U5KA 4BW1A 5ENBA 5DW1A 4Z6HA 5H1TA 4CFLA 5D3HA 5HLSA 3RCWA 4MR4A 3LQJA 4TZ2A 4MEQA 5ENCA 5C8GA 5CRZA 5EQ1A 4CURA 4LDFA 4BJXA 5KHMA 3S92A 5C87A 5FG4A 5FB0A 4NYWA 4XUAA 4J0RA 4O72A 5FH8A 5CUDA 5ENFA 5KTWA 4TZ8A 5CQ3A 2E7NA 3HMEA 3LXJA 4PCIA 4A9LA 5EGUA 5D3NA 5L8UA 3P1EA 4YYIA 4HXNA 4MR6A 4CUQA 5ACYA 1WUMA 4QY4A 5E9MA 5D3PA 4TS8A 5CZGA 5A5QA 4UYFA 4HBXA 4O7BA 5E3GA 5I86A 5CS8A 5CQAA 4J1PA 5KU3A 4YBSA 3UVDA 4QSVA 4KV4A 5CFWA 3G0JA 4Q0OA 4HXKA 5E73A 5G4SA 4A9JA 2YW5A 4O7FA 4QSXA 4UIVA 5FB1A 2MJVB 2OSSA 4NR8A 5EM3A 3U5PA 4PKLA 5C7NA 4N4GA 4NUCA 5CU8A 5F2PA 4YK0A 3HMHA 4QC3A 4YABA 2F6JA 4QSUA 4N3WA 5CP5A 5DYCA 5A85A 4YBMA 4TT4A 4NRBA 3DAIA 3QZTA 5CQ4A 5LVRA 5BT3A 5I7XA 2R0SA 1E6IA 5D3LA 4QEWA 5HENA 4ALGA 5HFRA 4QC1A 4A9KA 5IIDA 4IR4A 3HMFA 4LRGA 2I7KA 4A9NA 4C66A 3P5OA 1EQFA 4CUTA 5D3TA 3SVFA 4YYNA 2H60A 5LJ2A 5HELA 4MR3A 4QYLA 5DW2A 2R10A 5CUEA 3P1DA 3LQHA 4UIYA 3JVMA 5DLZA 5FG5A 5KO4A 4LYWA 4O7AA 5EPBA 4PTBA 3UVWA 4O7EA 5EPSA 5BT5A 4PS5A 5L98A 3MQMA 5JI8A 5HRVA 4CUPA 5DYXA 4NR9A 4RVRA 3MUKA 4IR6A 5FBXA 2RI7A 5FE6A 5I1QA 5I7YA 4QSWA 3P1CA 4QUTA 4QR3A 4YH3A 2YDWA 5CUBA 5FE3A 5J0DA 4KV1A 4XUBA 5DKHA 4XYAA 5A5NA 4QR4A 2DVQA 3FKMX 5EWHA 5LJ1A 4N4FA 1X0JA 4YAXA 1ZS5A 2E3KA 3S91A 4YYGA 5EI4A 4Q0NA 4YYHA 4XY8A 5F60A 5AD3A 4CUSA 2L85A 5EWWA 5DY7A 5CQ8A 5D24A 5HQ6A 2E7OA 5K29A 5DFCA 4O77A 3O33A 2L5EA 2YYNA 5L96A 3DWYA 4ZC9A 5II1A 3JVKA 3SVHA 4NQMA 4TU4A 2YEKA 5I80A 4C67A 4UYHA 5F3AA 4UITA 2DATA 3IU5A 5E74A 4OGIA 1F68A 4XY9A 5EU1A 4HXRA 5FE4A 3TLPA 4OGJA 4J3IA 4BW2A 5FFWA 5C89A 4NR4A 4YYDA 5IBNA 4YY6A 2DVVA 4QBMA 5IGLA 4CUUA 4NR6A 3D7CA 5CRMA 3Q2FA 2D82A 5CTLA 5HFQA 5FH7A 5AMEA 2OUOA 2RNYA 4PY6A 4O74A 4HXOA 5DYUA 5EK9A 1JSPB 2DKWA 2G4AA 4A9OA 4QZSA 5HEMA 2DWWA 4KCXA 4YBTA 5CQTA 4QSSA 4A9EA 3U5JA 4ALHA 5HQ5A 4A9IA 5HCLA 4HXLA 5FE8A 5H1VA 2OO1A 4NR7A 4QEVA 4QYDA 5D3RA 2N9GA 4BW4A 5F36A 5A5OA 2RS9B 2L84A 5H1UA 5I83A 3UV4A 3U5OA 5E9LA 4J0SA 4NYXA 4TQNA 5A7CA 5TCMA 5DFBA 5D3JA 3JVLA 4O76A 3NXBA 5CGPA 4GPJA 4Z1SA 4NUEA 3ONIA 5LJ0A 4ZW1A 5IGNA 4CLBA 4LYIA 4LYSA 5JWMA 5LKXA 5FE2A 4QSTA 4UIWA 5HRWA 5II2A 5LVQA 5LKUA 5E9VA 5CUCA 4TYLA 5TB6A 5LKZA 5F1LA 4HBWA 3UVXA 4IORA 5IGKA 4HXPA 4NRAA 5A81A 4HXSA 4QR5A 5F25A 5DX4A 5HQ7A 5I89A 4QUUA 3O34A 5EV9A 4UYFB 4YH4A 4TT2A 4N4HA 4NS5A 1N72A 4Z1QA 3LJWA 3GG3A 4Z6IA 5I29A 4NQNA 3SVGA 3LQIA 2FSAA 4IR5A 4TT6A 3U5LA 4YYJA 3UV2A 5FDZA 5I88A 4UIXA 4X2IA 5FFVA 3P1FA 5KTUA 2RO1A 5ENEA 4CFKA 1WUGA 5I40A 4O71A 3UVYA 4WHUA 4LZRA 4O75A 5HM0A 4BHWA 4Z93A 2LSPB 5E9IA 3O37A 4E96A 3UW9A 4NUDA 3U5MA 2KTBB 3MXFA 4A9MA 4QSPA 5D0CA 5DLXA 4UYGA 4IOOA 4YY4A 4YADA 5CUAA 2WP1A 2RFJA 3K2JA 5F63A 3ZYUA 2R0VA 5ENGA 2YEMA 4BW3A 1JM4B 4HBVA 5H85A 2DVSA 5E0RA 4MR5A 5ETBA 5F5ZA 4LZSA 5F1HA 4IOQA 5IG6A 5A83A 3MB3A 5FE7A 4TU6A 4YATA 3IU6A 4O7CA 5EISA 5FE5A 5BT4A 4F3IA 5DKDA 5E7DA 5FE0A 3I3JA 4FLPA 4QSRA 4DONA 3AQAA 5EWDA 4LZ2A 3O36A 4QEUA 4QB3A 5FH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNW A;  2I8N A;  4LC2 A;  5HRX A;  5HJC A;  4A9F A;  4NXJ A;  5CY9 A;  4MEP A;  4Y03 A;  5DFD A;  5FFY A;  3JVJ A;  4OUF A;  4UIU A;  5LUU A;  4UIZ A;  5FG6 A;  4N4I A;  5C85 A;  4TTE A;  5D26 A;  5A5P A;  4QSQ A;  5G4R A;  5A5S A;  4YYK A;  4A9H A;  5C4Q A;  3QZV A;  5FE9 A;  4LR6 A;  2GRC A;  5ETD A;  4QNS A;  4WHW A;  5AMF A;  2RNX A;  5E9K A;  4UYE A;  5EWC A;  3MUL A;  5FE1 A;  5COI A;  4CL9 A;  5ENJ A;  3QZS A;  5L8T A;  5D7X A;  5AD2 A;  5CPE A;  3Q2E A;  5D3S A;  3G0L A;  3MB4 A;  2F6N A;  3AAD A;  4NYV A;  5ENI A;  4AKN A;  2R0Y A;  5EVA A;  5F61 A;  4O70 A;  5CQ5 A;  5DBM A;  3UV5 A;  2D9E A;  5A5R A;  3U5N A;  4UYD A;  5E9Y A;  4YYM A;  5A82 A;  5LKT A;  4HBY A;  5CQ6 A;  4YC9 A;  5ENH A;  5E3D A;  4PCE A;  5KTX A;  2NXB A;  5D25 A;  5IGM A;  5DKC A;  4WIV A;  5L97 A;  2YQD A;  5CUG A;  5L99 A;  5EP7 A;  4NR5 A;  2YEL A;  4O78 A;  5DYA A;  5EA1 A;  5EPR A;  4MEN A;  4IR3 A;  2WP2 A;  2DVR A;  5EWV A;  5CQ7 A;  5EIC A;  5F62 A;  4NRC A;  4HXM A;  3O35 A;  4ZQL A;  4MEO A;  3U5K A;  4BW1 A;  5ENB A;  5DW1 A;  4Z6H A;  5H1T A;  4CFL A;  5D3H A;  5HLS A;  3RCW A;  4MR4 A;  3LQJ A;  4TZ2 A;  4MEQ A;  5ENC A;  5C8G A;  5CRZ A;  5EQ1 A;  4CUR A;  4LDF A;  4BJX A;  5KHM A;  3S92 A;  5C87 A;  5FG4 A;  5FB0 A;  4NYW A;  4XUA A;  4J0R A;  4O72 A;  5FH8 A;  5CUD A;  5ENF A;  5KTW A;  4TZ8 A;  5CQ3 A;  2E7N A;  3HME A;  3LXJ A;  4PCI A;  4A9L A;  5EGU A;  5D3N A;  5L8U A;  3P1E A;  4YYI A;  4HXN A;  4MR6 A;  4CUQ A;  5ACY A;  1WUM A;  4QY4 A;  5E9M A;  5D3P A;  4TS8 A;  5CZG A;  5A5Q A;  4UYF A;  4HBX A;  4O7B A;  5E3G A;  5I86 A;  5CS8 A;  5CQA A;  4J1P A;  5KU3 A;  4YBS A;  3UVD A;  4QSV A;  4KV4 A;  5CFW A;  3G0J A;  4Q0O A;  4HXK A;  5E73 A;  5G4S A;  4A9J A;  2YW5 A;  4O7F A;  4QSX A;  4UIV A;  5FB1 A;  2MJV B;  2OSS A;  4NR8 A;  5EM3 A;  3U5P A;  4PKL A;  5C7N A;  4N4G A;  4NUC A;  5CU8 A;  5F2P A;  4YK0 A;  3HMH A;  4QC3 A;  4YAB A;  2F6J A;  4QSU A;  4N3W A;  5CP5 A;  5DYC A;  5A85 A;  4YBM A;  4TT4 A;  4NRB A;  3DAI A;  3QZT A;  5CQ4 A;  5LVR A;  5BT3 A;  5I7X A;  2R0S A;  1E6I A;  5D3L A;  4QEW A;  5HEN A;  4ALG A;  5HFR A;  4QC1 A;  4A9K A;  5IID A;  4IR4 A;  3HMF A;  4LRG A;  2I7K A;  4A9N A;  4C66 A;  3P5O A;  1EQF A;  4CUT A;  5D3T A;  3SVF A;  4YYN A;  2H60 A;  5LJ2 A;  5HEL A;  4MR3 A;  4QYL A;  5DW2 A;  2R10 A;  5CUE A;  3P1D A;  3LQH A;  4UIY A;  3JVM A;  5DLZ A;  5FG5 A;  5KO4 A;  4LYW A;  4O7A A;  5EPB A;  4PTB A;  3UVW A;  4O7E A;  5EPS A;  5BT5 A;  4PS5 A;  5L98 A;  3MQM A;  5JI8 A;  5HRV A;  4CUP A;  5DYX A;  4NR9 A;  4RVR A;  3MUK A;  4IR6 A;  5FBX A;  2RI7 A;  5FE6 A;  5I1Q A;  5I7Y A;  4QSW A;  3P1C A;  4QUT A;  4QR3 A;  4YH3 A;  2YDW A;  5CUB A;  5FE3 A;  5J0D A;  4KV1 A;  4XUB A;  5DKH A;  4XYA A;  5A5N A;  4QR4 A;  2DVQ A;  3FKM X;  5EWH A;  5LJ1 A;  4N4F A;  1X0J A;  4YAX A;  1ZS5 A;  2E3K A;  3S91 A;  4YYG A;  5EI4 A;  4Q0N A;  4YYH A;  4XY8 A;  5F60 A;  5AD3 A;  4CUS A;  2L85 A;  5EWW A;  5DY7 A;  5CQ8 A;  5D24 A;  5HQ6 A;  2E7O A;  5K29 A;  5DFC A;  4O77 A;  3O33 A;  2L5E A;  2YYN A;  5L96 A;  3DWY A;  4ZC9 A;  5II1 A;  3JVK A;  3SVH A;  4NQM A;  4TU4 A;  2YEK A;  5I80 A;  4C67 A;  4UYH A;  5F3A A;  4UIT A;  2DAT A;  3IU5 A;  5E74 A;  4OGI A;  1F68 A;  4XY9 A;  5EU1 A;  4HXR A;  5FE4 A;  3TLP A;  4OGJ A;  4J3I A;  4BW2 A;  5FFW A;  5C89 A;  4NR4 A;  4YYD A;  5IBN A;  4YY6 A;  2DVV A;  4QBM A;  5IGL A;  4CUU A;  4NR6 A;  3D7C A;  5CRM A;  3Q2F A;  2D82 A;  5CTL A;  5HFQ A;  5FH7 A;  5AME A;  2OUO A;  2RNY A;  4PY6 A;  4O74 A;  4HXO A;  5DYU A;  5EK9 A;  1JSP B;  2DKW A;  2G4A A;  4A9O A;  4QZS A;  5HEM A;  2DWW A;  4KCX A;  4YBT A;  5CQT A;  4QSS A;  4A9E A;  3U5J A;  4ALH A;  5HQ5 A;  4A9I A;  5HCL A;  4HXL A;  5FE8 A;  5H1V A;  2OO1 A;  4NR7 A;  4QEV A;  4QYD A;  5D3R A;  2N9G A;  4BW4 A;  5F36 A;  5A5O A;  2RS9 B;  2L84 A;  5H1U A;  5I83 A;  3UV4 A;  3U5O A;  5E9L A;  4J0S A;  4NYX A;  4TQN A;  5A7C A;  5TCM A;  5DFB A;  5D3J A;  3JVL A;  4O76 A;  3NXB A;  5CGP A;  4GPJ A;  4Z1S A;  4NUE A;  3ONI A;  5LJ0 A;  4ZW1 A;  5IGN A;  4CLB A;  4LYI A;  4LYS A;  5JWM A;  5LKX A;  5FE2 A;  4QST A;  4UIW A;  5HRW A;  5II2 A;  5LVQ A;  5LKU A;  5E9V A;  5CUC A;  4TYL A;  5TB6 A;  5LKZ A;  5F1L A;  4HBW A;  3UVX A;  4IOR A;  5IGK A;  4HXP A;  4NRA A;  5A81 A;  4HXS A;  4QR5 A;  5F25 A;  5DX4 A;  5HQ7 A;  5I89 A;  4QUU A;  3O34 A;  5EV9 A;  4UYF B;  4YH4 A;  4TT2 A;  4N4H A;  4NS5 A;  1N72 A;  4Z1Q A;  3LJW A;  3GG3 A;  4Z6I A;  5I29 A;  4NQN A;  3SVG A;  3LQI A;  2FSA A;  4IR5 A;  4TT6 A;  3U5L A;  4YYJ A;  3UV2 A;  5FDZ A;  5I88 A;  4UIX A;  4X2I A;  5FFV A;  3P1F A;  5KTU A;  2RO1 A;  5ENE A;  4CFK A;  1WUG A;  5I40 A;  4O71 A;  3UVY A;  4WHU A;  4LZR A;  4O75 A;  5HM0 A;  4BHW A;  4Z93 A;  2LSP B;  5E9I A;  3O37 A;  4E96 A;  3UW9 A;  4NUD A;  3U5M A;  2KTB B;  3MXF A;  4A9M A;  4QSP A;  5D0C A;  5DLX A;  4UYG A;  4IOO A;  4YY4 A;  4YAD A;  5CUA A;  2WP1 A;  2RFJ A;  3K2J A;  5F63 A;  3ZYU A;  2R0V A;  5ENG A;  2YEM A;  4BW3 A;  1JM4 B;  4HBV A;  5H85 A;  2DVS A;  5E0R A;  4MR5 A;  5ETB A;  5F5Z A;  4LZS A;  5F1H A;  4IOQ A;  5IG6 A;  5A83 A;  3MB3 A;  5FE7 A;  4TU6 A;  4YAT A;  3IU6 A;  4O7C A;  5EIS A;  5FE5 A;  5BT4 A;  4F3I A;  5DKD A;  5E7D A;  5FE0 A;  3I3J A;  4FLP A;  4QSR A;  4DON A;  3AQA A;  5EWD A;  4LZ2 A;  3O36 A;  4QEU A;  4QB3 A;  5FH6 A; 
#chains in the Genus database with same CATH topology
 2RNW A;  2I8N A;  4LC2 A;  5HRX A;  5HJC A;  4A9F A;  4NXJ A;  5CY9 A;  4MEP A;  4Y03 A;  5DFD A;  5FFY A;  3JVJ A;  4OUF A;  4UIU A;  5LUU A;  4UIZ A;  5FG6 A;  4N4I A;  5C85 A;  4TTE A;  5D26 A;  5A5P A;  4QSQ A;  5G4R A;  5A5S A;  4YYK A;  4A9H A;  5C4Q A;  3QZV A;  5FE9 A;  4LR6 A;  2GRC A;  5ETD A;  4QNS A;  4WHW A;  5AMF A;  2RNX A;  5E9K A;  4UYE A;  5EWC A;  1ZKR A;  3MUL A;  5FE1 A;  5COI A;  4CL9 A;  5ENJ A;  3QZS A;  5L8T A;  5D7X A;  5AD2 A;  5CPE A;  3Q2E A;  5D3S A;  3G0L A;  3MB4 A;  2F6N A;  3AAD A;  4NYV A;  5ENI A;  4AKN A;  2R0Y A;  5EVA A;  5F61 A;  4O70 A;  1PUO A;  5CQ5 A;  5DBM A;  3UV5 A;  2D9E A;  5A5R A;  3U5N A;  4UYD A;  5E9Y A;  4YYM A;  5A82 A;  5LKT A;  4HBY A;  5CQ6 A;  4YC9 A;  5ENH A;  5E3D A;  4PCE A;  5KTX A;  2NXB A;  5D25 A;  5IGM A;  5DKC A;  4WIV A;  5L97 A;  2YQD A;  5CUG A;  5L99 A;  2EJN A;  5EP7 A;  4NR5 A;  2YEL A;  4O78 A;  5DYA A;  5EA1 A;  5EPR A;  4MEN A;  4IR3 A;  2WP2 A;  2DVR A;  5EWV A;  5CQ7 A;  5EIC A;  5F62 A;  4NRC A;  4HXM A;  3O35 A;  4ZQL A;  4MEO A;  3U5K A;  4BW1 A;  5ENB A;  5DW1 A;  4Z6H A;  5H1T A;  4CFL A;  5D3H A;  5HLS A;  3RCW A;  4MR4 A;  3LQJ A;  4TZ2 A;  4MEQ A;  5ENC A;  5C8G A;  5CRZ A;  5EQ1 A;  4CUR A;  4LDF A;  4BJX A;  5KHM A;  3S92 A;  5C87 A;  5FG4 A;  5FB0 A;  4NYW A;  4XUA A;  4J0R A;  4O72 A;  5FH8 A;  5CUD A;  5ENF A;  5KTW A;  4TZ8 A;  5CQ3 A;  2E7N A;  3HME A;  3LXJ A;  4PCI A;  4A9L A;  5EGU A;  5D3N A;  5L8U A;  3P1E A;  4YYI A;  4HXN A;  4MR6 A;  4CUQ A;  5ACY A;  1WUM A;  4QY4 A;  5E9M A;  5D3P A;  4TS8 A;  5CZG A;  5A5Q A;  4UYF A;  4HBX A;  4O7B A;  5E3G A;  5I86 A;  5CS8 A;  5CQA A;  4J1P A;  5KU3 A;  4YBS A;  3UVD A;  4QSV A;  4KV4 A;  5CFW A;  3G0J A;  4Q0O A;  4HXK A;  5E73 A;  5G4S A;  4A9J A;  2YW5 A;  4O7F A;  4QSX A;  4UIV A;  5FB1 A;  2MJV B;  2OSS A;  3D1B A;  4NR8 A;  5EM3 A;  3U5P A;  4PKL A;  3VKH A;  5C7N A;  4N4G A;  4NUC A;  5CU8 A;  5F2P A;  4YK0 A;  3HMH A;  4QC3 A;  4YAB A;  2F6J A;  4QSU A;  4N3W A;  5CP5 A;  5DYC A;  5A85 A;  4YBM A;  4TT4 A;  4NRB A;  3DAI A;  3QZT A;  5CQ4 A;  5LVR A;  5BT3 A;  5I7X A;  2R0S A;  1E6I A;  5D3L A;  4QEW A;  5HEN A;  4ALG A;  5HFR A;  4QC1 A;  4A9K A;  5IID A;  4IR4 A;  3HMF A;  4LRG A;  2I7K A;  4A9N A;  4C66 A;  3P5O A;  1EQF A;  4AKG A;  4CUT A;  5D3T A;  3SVF A;  4YYN A;  2H60 A;  5LJ2 A;  5HEL A;  4MR3 A;  4QYL A;  5DW2 A;  2R10 A;  5CUE A;  3P1D A;  3LQH A;  4UIY A;  3JVM A;  5DLZ A;  5FG5 A;  5KO4 A;  4LYW A;  4O7A A;  5EPB A;  4PTB A;  3UVW A;  4O7E A;  5EPS A;  5BT5 A;  4PS5 A;  5L98 A;  3MQM A;  5JI8 A;  5HRV A;  4CUP A;  5DYX A;  4NR9 A;  4RVR A;  3MUK A;  4IR6 A;  5FBX A;  2RI7 A;  5FE6 A;  5I1Q A;  5I7Y A;  4QSW A;  3P1C A;  4QUT A;  4QR3 A;  4YH3 A;  2YDW A;  5CUB A;  5FE3 A;  5J0D A;  4KV1 A;  4XUB A;  5DKH A;  4XYA A;  5A5N A;  4QR4 A;  2DVQ A;  3FKM X;  5EWH A;  5LJ1 A;  4N4F A;  1X0J A;  4YAX A;  1ZS5 A;  2E3K A;  3S91 A;  4YYG A;  5EI4 A;  4Q0N A;  4YYH A;  4XY8 A;  5F60 A;  5AD3 A;  4CUS A;  2L85 A;  5EWW A;  5DY7 A;  5CQ8 A;  5D24 A;  5HQ6 A;  2E7O A;  5K29 A;  5DFC A;  4O77 A;  3O33 A;  2L5E A;  2YYN A;  5L96 A;  3DWY A;  4ZC9 A;  5II1 A;  3JVK A;  3SVH A;  4NQM A;  4TU4 A;  2YEK A;  5I80 A;  4C67 A;  4UYH A;  5F3A A;  4UIT A;  2DAT A;  3IU5 A;  5E74 A;  4OGI A;  1F68 A;  4XY9 A;  5EU1 A;  4HXR A;  5FE4 A;  3TLP A;  4OGJ A;  4J3I A;  4BW2 A;  5FFW A;  5C89 A;  4NR4 A;  4YYD A;  5IBN A;  4YY6 A;  2DVV A;  4QBM A;  5IGL A;  4CUU A;  4NR6 A;  3D7C A;  5CRM A;  3Q2F A;  2D82 A;  5CTL A;  5HFQ A;  5FH7 A;  5AME A;  2OUO A;  2RNY A;  4PY6 A;  4O74 A;  4HXO A;  5DYU A;  5EK9 A;  1JSP B;  2DKW A;  2G4A A;  3ERR A;  4A9O A;  4QZS A;  5HEM A;  2DWW A;  4KCX A;  4YBT A;  5CQT A;  4QSS A;  4A9E A;  3U5J A;  4ALH A;  5HQ5 A;  4A9I A;  5HCL A;  4HXL A;  5FE8 A;  5H1V A;  2OO1 A;  4NR7 A;  4QEV A;  4QYD A;  5D3R A;  2N9G A;  4BW4 A;  5F36 A;  5A5O A;  2RS9 B;  2L84 A;  5H1U A;  5I83 A;  3UV4 A;  3U5O A;  5E9L A;  4J0S A;  4NYX A;  4TQN A;  5A7C A;  5TCM A;  5DFB A;  5D3J A;  3JVL A;  4O76 A;  3NXB A;  5CGP A;  4GPJ A;  4Z1S A;  4NUE A;  3ONI A;  5LJ0 A;  4ZW1 A;  5IGN A;  4CLB A;  4LYI A;  4LYS A;  5JWM A;  5LKX A;  5FE2 A;  4QST A;  4UIW A;  5HRW A;  5II2 A;  5LVQ A;  5LKU A;  5E9V A;  5CUC A;  4TYL A;  5TB6 A;  5LKZ A;  5F1L A;  4HBW A;  3UVX A;  4IOR A;  5IGK A;  4HXP A;  4NRA A;  5A81 A;  4HXS A;  4QR5 A;  5F25 A;  3VKG A;  5DX4 A;  5HQ7 A;  5I89 A;  4QUU A;  3O34 A;  5EV9 A;  4UYF B;  4YH4 A;  4TT2 A;  4N4H A;  4NS5 A;  1N72 A;  4Z1Q A;  3LJW A;  3GG3 A;  4Z6I A;  5I29 A;  4NQN A;  3SVG A;  3LQI A;  2FSA A;  4IR5 A;  4TT6 A;  3U5L A;  4YYJ A;  4AKI A;  3UV2 A;  5FDZ A;  5I88 A;  4UIX A;  4X2I A;  5FFV A;  3P1F A;  5KTU A;  2RO1 A;  5ENE A;  4CFK A;  1WUG A;  5I40 A;  4O71 A;  3UVY A;  4AKH A;  4WHU A;  4LZR A;  4O75 A;  5HM0 A;  4BHW A;  4Z93 A;  2LSP B;  5E9I A;  3O37 A;  4E96 A;  3UW9 A;  4NUD A;  3U5M A;  2KTB B;  3MXF A;  4A9M A;  4QSP A;  5D0C A;  5DLX A;  4UYG A;  4IOO A;  4YY4 A;  4YAD A;  5CUA A;  2WP1 A;  2RFJ A;  3K2J A;  5F63 A;  3ZYU A;  2R0V A;  5ENG A;  2YEM A;  4BW3 A;  1JM4 B;  4HBV A;  5H85 A;  2DVS A;  5E0R A;  4MR5 A;  5ETB A;  5F5Z A;  4LZS A;  5F1H A;  4IOQ A;  5IG6 A;  5A83 A;  3MB3 A;  5FE7 A;  4TU6 A;  4YAT A;  3IU6 A;  4O7C A;  5EIS A;  5FE5 A;  5BT4 A;  4F3I A;  5DKD A;  5E7D A;  5FE0 A;  3I3J A;  4FLP A;  4QSR A;  4AI6 A;  4DON A;  3AQA A;  5EWD A;  3D1D A;  4LZ2 A;  3O36 A;  4QEU A;  4QB3 A;  5FH6 A; 
#chains in the Genus database with same CATH homology
 2RNW A;  2I8N A;  4LC2 A;  5HRX A;  5HJC A;  4A9F A;  4NXJ A;  5CY9 A;  4MEP A;  4Y03 A;  5DFD A;  5FFY A;  3JVJ A;  4OUF A;  4UIU A;  5LUU A;  4UIZ A;  5FG6 A;  4N4I A;  5C85 A;  4TTE A;  5D26 A;  5A5P A;  4QSQ A;  5G4R A;  5A5S A;  4YYK A;  4A9H A;  5C4Q A;  3QZV A;  5FE9 A;  4LR6 A;  2GRC A;  5ETD A;  4QNS A;  4WHW A;  5AMF A;  2RNX A;  5E9K A;  4UYE A;  5EWC A;  3MUL A;  5FE1 A;  5COI A;  4CL9 A;  5ENJ A;  3QZS A;  5L8T A;  5D7X A;  5AD2 A;  5CPE A;  3Q2E A;  5D3S A;  3G0L A;  3MB4 A;  2F6N A;  3AAD A;  4NYV A;  5ENI A;  4AKN A;  2R0Y A;  5EVA A;  5F61 A;  4O70 A;  5CQ5 A;  5DBM A;  3UV5 A;  2D9E A;  5A5R A;  3U5N A;  4UYD A;  5E9Y A;  4YYM A;  5A82 A;  5LKT A;  4HBY A;  5CQ6 A;  4YC9 A;  5ENH A;  5E3D A;  4PCE A;  5KTX A;  2NXB A;  5D25 A;  5IGM A;  5DKC A;  4WIV A;  5L97 A;  2YQD A;  5CUG A;  5L99 A;  5EP7 A;  4NR5 A;  2YEL A;  4O78 A;  5DYA A;  5EA1 A;  5EPR A;  4MEN A;  4IR3 A;  2WP2 A;  2DVR A;  5EWV A;  5CQ7 A;  5EIC A;  5F62 A;  4NRC A;  4HXM A;  3O35 A;  4ZQL A;  4MEO A;  3U5K A;  4BW1 A;  5ENB A;  5DW1 A;  4Z6H A;  5H1T A;  4CFL A;  5D3H A;  5HLS A;  3RCW A;  4MR4 A;  3LQJ A;  4TZ2 A;  4MEQ A;  5ENC A;  5C8G A;  5CRZ A;  5EQ1 A;  4CUR A;  4LDF A;  4BJX A;  5KHM A;  3S92 A;  5C87 A;  5FG4 A;  5FB0 A;  4NYW A;  4XUA A;  4J0R A;  4O72 A;  5FH8 A;  5CUD A;  5ENF A;  5KTW A;  4TZ8 A;  5CQ3 A;  2E7N A;  3HME A;  3LXJ A;  4PCI A;  4A9L A;  5EGU A;  5D3N A;  5L8U A;  3P1E A;  4YYI A;  4HXN A;  4MR6 A;  4CUQ A;  5ACY A;  1WUM A;  4QY4 A;  5E9M A;  5D3P A;  4TS8 A;  5CZG A;  5A5Q A;  4UYF A;  4HBX A;  4O7B A;  5E3G A;  5I86 A;  5CS8 A;  5CQA A;  4J1P A;  5KU3 A;  4YBS A;  3UVD A;  4QSV A;  4KV4 A;  5CFW A;  3G0J A;  4Q0O A;  4HXK A;  5E73 A;  5G4S A;  4A9J A;  2YW5 A;  4O7F A;  4QSX A;  4UIV A;  5FB1 A;  2MJV B;  2OSS A;  4NR8 A;  5EM3 A;  3U5P A;  4PKL A;  5C7N A;  4N4G A;  4NUC A;  5CU8 A;  5F2P A;  4YK0 A;  3HMH A;  4QC3 A;  4YAB A;  2F6J A;  4QSU A;  4N3W A;  5CP5 A;  5DYC A;  5A85 A;  4YBM A;  4TT4 A;  4NRB A;  3DAI A;  3QZT A;  5CQ4 A;  5LVR A;  5BT3 A;  5I7X A;  2R0S A;  1E6I A;  5D3L A;  4QEW A;  5HEN A;  4ALG A;  5HFR A;  4QC1 A;  4A9K A;  5IID A;  4IR4 A;  3HMF A;  4LRG A;  2I7K A;  4A9N A;  4C66 A;  3P5O A;  1EQF A;  4CUT A;  5D3T A;  3SVF A;  4YYN A;  2H60 A;  5LJ2 A;  5HEL A;  4MR3 A;  4QYL A;  5DW2 A;  2R10 A;  5CUE A;  3P1D A;  3LQH A;  4UIY A;  3JVM A;  5DLZ A;  5FG5 A;  5KO4 A;  4LYW A;  4O7A A;  5EPB A;  4PTB A;  3UVW A;  4O7E A;  5EPS A;  5BT5 A;  4PS5 A;  5L98 A;  3MQM A;  5JI8 A;  5HRV A;  4CUP A;  5DYX A;  4NR9 A;  4RVR A;  3MUK A;  4IR6 A;  5FBX A;  2RI7 A;  5FE6 A;  5I1Q A;  5I7Y A;  4QSW A;  3P1C A;  4QUT A;  4QR3 A;  4YH3 A;  2YDW A;  5CUB A;  5FE3 A;  5J0D A;  4KV1 A;  4XUB A;  5DKH A;  4XYA A;  5A5N A;  4QR4 A;  2DVQ A;  3FKM X;  5EWH A;  5LJ1 A;  4N4F A;  1X0J A;  4YAX A;  1ZS5 A;  2E3K A;  3S91 A;  4YYG A;  5EI4 A;  4Q0N A;  4YYH A;  4XY8 A;  5F60 A;  5AD3 A;  4CUS A;  2L85 A;  5EWW A;  5DY7 A;  5CQ8 A;  5D24 A;  5HQ6 A;  2E7O A;  5K29 A;  5DFC A;  4O77 A;  3O33 A;  2L5E A;  2YYN A;  5L96 A;  3DWY A;  4ZC9 A;  5II1 A;  3JVK A;  3SVH A;  4NQM A;  4TU4 A;  2YEK A;  5I80 A;  4C67 A;  4UYH A;  5F3A A;  4UIT A;  2DAT A;  3IU5 A;  5E74 A;  4OGI A;  1F68 A;  4XY9 A;  5EU1 A;  4HXR A;  5FE4 A;  3TLP A;  4OGJ A;  4J3I A;  4BW2 A;  5FFW A;  5C89 A;  4NR4 A;  4YYD A;  5IBN A;  4YY6 A;  2DVV A;  4QBM A;  5IGL A;  4CUU A;  4NR6 A;  3D7C A;  5CRM A;  3Q2F A;  2D82 A;  5CTL A;  5HFQ A;  5FH7 A;  5AME A;  2OUO A;  2RNY A;  4PY6 A;  4O74 A;  4HXO A;  5DYU A;  5EK9 A;  1JSP B;  2DKW A;  2G4A A;  4A9O A;  4QZS A;  5HEM A;  2DWW A;  4KCX A;  4YBT A;  5CQT A;  4QSS A;  4A9E A;  3U5J A;  4ALH A;  5HQ5 A;  4A9I A;  5HCL A;  4HXL A;  5FE8 A;  5H1V A;  2OO1 A;  4NR7 A;  4QEV A;  4QYD A;  5D3R A;  2N9G A;  4BW4 A;  5F36 A;  5A5O A;  2RS9 B;  2L84 A;  5H1U A;  5I83 A;  3UV4 A;  3U5O A;  5E9L A;  4J0S A;  4NYX A;  4TQN A;  5A7C A;  5TCM A;  5DFB A;  5D3J A;  3JVL A;  4O76 A;  3NXB A;  5CGP A;  4GPJ A;  4Z1S A;  4NUE A;  3ONI A;  5LJ0 A;  4ZW1 A;  5IGN A;  4CLB A;  4LYI A;  4LYS A;  5JWM A;  5LKX A;  5FE2 A;  4QST A;  4UIW A;  5HRW A;  5II2 A;  5LVQ A;  5LKU A;  5E9V A;  5CUC A;  4TYL A;  5TB6 A;  5LKZ A;  5F1L A;  4HBW A;  3UVX A;  4IOR A;  5IGK A;  4HXP A;  4NRA A;  5A81 A;  4HXS A;  4QR5 A;  5F25 A;  5DX4 A;  5HQ7 A;  5I89 A;  4QUU A;  3O34 A;  5EV9 A;  4UYF B;  4YH4 A;  4TT2 A;  4N4H A;  4NS5 A;  1N72 A;  4Z1Q A;  3LJW A;  3GG3 A;  4Z6I A;  5I29 A;  4NQN A;  3SVG A;  3LQI A;  2FSA A;  4IR5 A;  4TT6 A;  3U5L A;  4YYJ A;  3UV2 A;  5FDZ A;  5I88 A;  4UIX A;  4X2I A;  5FFV A;  3P1F A;  5KTU A;  2RO1 A;  5ENE A;  4CFK A;  1WUG A;  5I40 A;  4O71 A;  3UVY A;  4WHU A;  4LZR A;  4O75 A;  5HM0 A;  4BHW A;  4Z93 A;  2LSP B;  5E9I A;  3O37 A;  4E96 A;  3UW9 A;  4NUD A;  3U5M A;  2KTB B;  3MXF A;  4A9M A;  4QSP A;  5D0C A;  5DLX A;  4UYG A;  4IOO A;  4YY4 A;  4YAD A;  5CUA A;  2WP1 A;  2RFJ A;  3K2J A;  5F63 A;  3ZYU A;  2R0V A;  5ENG A;  2YEM A;  4BW3 A;  1JM4 B;  4HBV A;  5H85 A;  2DVS A;  5E0R A;  4MR5 A;  5ETB A;  5F5Z A;  4LZS A;  5F1H A;  4IOQ A;  5IG6 A;  5A83 A;  3MB3 A;  5FE7 A;  4TU6 A;  4YAT A;  3IU6 A;  4O7C A;  5EIS A;  5FE5 A;  5BT4 A;  4F3I A;  5DKD A;  5E7D A;  5FE0 A;  3I3J A;  4FLP A;  4QSR A;  4DON A;  3AQA A;  5EWD A;  4LZ2 A;  3O36 A;  4QEU A;  4QB3 A;  5FH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...