2DKWA

Solution structure of the bromodomain of human protein kiaa1240
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
GSSGSSGNTLRELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein KIAA1240
publication title Solution structure of the bromodomain of human protein KIAA1240
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dkwA00
5G4SA 4YYMA 4Q0OA 3O36A 3S91A 3U5MA 5A5QA 4TU6A 3O35A 5CY9A 5IIDA 3UVYA 4LYIA 5L97A 5ACYA 5D25A 4BW4A 4YBMA 4MEOA 4BW1A 3P1EA 4YBSA 5CUBA 4CUUA 5H1TA 5F1HA 5I88A 1WUGA 5I80A 4N3WA 4TQNA 5FE3A 4ALHA 4YADA 5D3PA 5DY7A 3AQAA 5D24A 5AMEA 3U5OA 4HXKA 5L96A 5LUUA 4A9NA 4BW3A 3D7CA 4QR5A 4OGJA 3MXFA 5C4QA 4TZ8A 4A9HA 4YYIA 5CQAA 4TYLA 4N4GA 4O76A 4QUUA 4XUBA 5HEMA 4WIVA 4QEVA 2DWWA 3O33A 4TZ2A 4AKNA 5DLZA 4Z1SA 4QSVA 5A5NA 2E3KA 5HRWA 5HFQA 5EI4A 5D7XA 5BT5A 3UVXA 5CTLA 5CPEA 4QUTA 5FE9A 4OGIA 5KO4A 5EM3A 4Z6IA 5FE7A 4BW2A 4Q0NA 4QC3A 4UYDA 5I86A 5EV9A 5F61A 5DW2A 5C8GA 5D3TA 4J3IA 5LKZA 2OSSA 4E96A 4HXPA 4LC2A 3IU6A 5KTWA 1E6IA 2MJVB 4KV1A 4WHWA 5FBXA 5EWDA 4HBWA 4IOOA 5E7DA 4MEQA 5I40A 4A9EA 4NR8A 4QR3A 4YC9A 4RVRA 5LJ0A 4QR4A 5E74A 5LKXA 5ENHA 2L84A 4KCXA 5J0DA 4CUTA 5D3JA 2YYNA 4O77A 5E3DA 5H85A 5CQ4A 5EWVA 5FB0A 4NUCA 4Z93A 5CQTA 4YH4A 5IGMA 5F60A 4NRCA 4HBYA 1WUMA 5HRXA 2OO1A 5ENIA 4QYLA 5AMFA 4IR4A 4NRAA 4GPJA 3JVKA 4MEPA 5I29A 5I7YA 2E7OA 5LJ2A 4MR5A 5FE0A 3HMFA 2WP1A 5BT3A 5F62A 3U5KA 4YYKA 5DFCA 2R10A 4QYDA 2I8NA 4PTBA 2YEMA 2RNYA 5CQ8A 4IOQA 5ENBA 5G4RA 5CGPA 5HM0A 4DONA 4O75A 4UYFA 5DYUA 5DYCA 2DVSA 5ENJA 4LR6A 2F6NA 4NYVA 2RNXA 4A9KA 4PKLA 5DFDA 5HJCA 4A9IA 5F25A 5D3SA 5CQ5A 5FE2A 4NYWA 5CUEA 4UIVA 4HBXA 4A9FA 4YK0A 1F68A 1N72A 4UYGA 3UV4A 4A9MA 2YDWA 4MENA 4LRGA 5CUAA 2I7KA 3FKMX 4LZSA 4PCEA 5FG4A 4LZRA 4O74A 4NQMA 5E3GA 4YAXA 5DYXA 5H1UA 4UIZA 4YYHA 2DVVA 5CQ7A 5IGKA 3LQJA 3Q2EA 2FSAA 4TS8A 5EGUA 5FFYA 3AADA 5DKCA 5HQ6A 4O72A 5CS8A 5TB6A 3SVFA 3G0LA 4NQNA 3LXJA 5CP5A 4YYGA 2R0SA 4ZW1A 4OUFA 4C66A 4XY9A 4QB3A 4KV4A 5AD3A 5C7NA 4UIYA 2D82A 3QZTA 5ENGA 2R0VA 5EWWA 5FH8A 5L98A 5BT4A 4FLPA 5COIA 5A5OA 5LVQA 4O7CA 5ETBA 3DWYA 5DBMA 4O7EA 5A5SA 3ZYUA 5F1LA 5I1QA 5E0RA 4YY4A 5D3LA 3JVJA 4YYDA 4IORA 5FE5A 1JM4B 5FE8A 5CUCA 2YW5A 4NRBA 5F5ZA 5HCLA 5F2PA 5ENCA 5L99A 2YQDA 2L85A 3DAIA 4QZSA 5TCMA 3NXBA 5AD2A 4NUEA 5HQ5A 5KTUA 3U5NA 4QY4A 4UYHA 3P1CA 2H60A 4A9LA 2RI7A 4NUDA 5HELA 5FE6A 5F36A 5FG6A 5KU3A 4ZC9A 3LJWA 4CUSA 5EVAA 2G4AA 5A7CA 5CRMA 5D0CA 5DKHA 4QSQA 2GRCA 5C89A 5HLSA 5HQ7A 3RCWA 5FE4A 4Z6HA 3GG3A 3O37A 5D3HA 4IR6A 5JWMA 3U5LA 5EPBA 2OUOA 5IG6A 2NXBA 4NXJA 4XYAA 5A82A 3MUKA 3MB4A 3P5OA 4A9JA 5KTXA 5CQ3A 4MR4A 2DATA 5DKDA 5DFBA 4ZQLA 5DYAA 2E7NA 3UV2A 2WP2A 5CZGA 4HBVA 4HXMA 5D26A 5E73A 4HXRA 5LJ1A 4UIXA 5C87A 5E9KA 2LSPB 3JVMA 5KHMA 4UIWA 4QSRA 4MR3A 1EQFA 5IGNA 4O78A 5FDZA 3SVHA 4HXOA 5A81A 5F63A 4QEWA 4QSWA 4MR6A 4NR7A 5EPRA 4QBMA 4TT6A 4CUPA 4PY6A 4YABA 5L8TA 4UITA 2RO1A 4TT4A 5A85A 4NR9A 5FH7A 5EK9A 5HENA 5D3RA 4PS5A 2KTBB 5A5PA 4QNSA 5ETDA 5JI8A 5D3NA 4YY6A 4YYJA 1ZS5A 4NR5A 3UVDA 3IU5A 4O7BA 4J0SA 4Z1QA 3JVLA 2YEKA 4O7FA 2D9EA 5CUDA 5I89A 2DVRA 4TU4A 5CRZA 4YYNA 5FFWA 5CUGA 2RS9B 5E9VA 4ALGA 5CQ6A 5K29A 3ONIA 2DVQA 5EA1A 5IGLA 4QC1A 3UV5A 4HXLA 4N4FA 2N9GA 4TTEA 3QZVA 3O34A 3S92A 4QSPA 5L8UA 4LZ2A 4UYFB 5A5RA 3Q2FA 3G0JA 2R0YA 4IR3A 5EWHA 3P1DA 3I3JA 3MQMA 4BJXA 4CFKA 4XY8A 4QSSA 1X0JA 4LYSA 5DW1A 5FB1A 4CFLA 5E9IA 4Y03A 3LQHA 5CU8A 4J1PA 5II2A 4IR5A 4YBTA 5LVRA 3SVGA 3K2JA 5EPSA 5LKUA 4TT2A 4NR6A 5LKTA 5DLXA 4QSUA 5EU1A 4NR4A 3UVWA 5A83A 4CUQA 4YH3A 4X2IA 4LDFA 2RNWA 4O70A 5FFVA 5F3AA 5IBNA 3P1FA 5EP7A 4PCIA 4YATA 3U5JA 4UYEA 3UW9A 5I83A 4O71A 5DX4A 5ENEA 4CL9A 1JSPB 3QZSA 5HRVA 3MULA 4QSXA 4J0RA 4HXSA 4NS5A 5FG5A 5EISA 3HMHA 5ENFA 3MB3A 5EICA 2L5EA 3U5PA 4QSTA 4N4IA 4QEUA 4HXNA 5E9MA 4BHWA 3TLPA 4O7AA 4UIUA 5EQ1A 4WHUA 5H1VA 4CURA 3HMEA 5E9YA 2YELA 4C67A 5FE1A 5EWCA 3LQIA 5E9LA 4CLBA 4NYXA 4N4HA 4LYWA 5I7XA 5HFRA 4A9OA 4F3IA 4XUAA 5FH6A 5CFWA 5II1A 2DKWA 2F6JA 2RFJA 5C85A
chains in the Genus database with same CATH superfamily
5G4SA 4YYMA 4Q0OA 3O36A 3S91A 3U5MA 5A5QA 4TU6A 3O35A 5CY9A 5IIDA 3UVYA 4LYIA 5L97A 5ACYA 5D25A 4BW4A 4YBMA 4MEOA 4BW1A 3P1EA 4YBSA 5CUBA 4CUUA 5H1TA 5F1HA 5I88A 1WUGA 5I80A 4N3WA 4TQNA 5FE3A 4ALHA 4YADA 5D3PA 5DY7A 3AQAA 5D24A 5AMEA 3U5OA 4HXKA 5L96A 5LUUA 4A9NA 4BW3A 3D7CA 4QR5A 4OGJA 3MXFA 3ERRA 5C4QA 4TZ8A 4A9HA 4YYIA 5CQAA 4TYLA 4N4GA 4O76A 4QUUA 4XUBA 5HEMA 4WIVA 4QEVA 2DWWA 3O33A 4TZ2A 4AKNA 5DLZA 4Z1SA 4QSVA 5A5NA 2E3KA 5HRWA 5HFQA 5EI4A 5D7XA 5BT5A 3UVXA 5CTLA 5CPEA 4QUTA 5FE9A 4OGIA 5KO4A 5EM3A 4Z6IA 5FE7A 4BW2A 4Q0NA 4QC3A 4UYDA 5I86A 5EV9A 5F61A 5DW2A 5C8GA 5D3TA 4J3IA 5LKZA 2OSSA 4E96A 4HXPA 4LC2A 3IU6A 5KTWA 1E6IA 2MJVB 4KV1A 4WHWA 3VKGA 5FBXA 5EWDA 4HBWA 4IOOA 5E7DA 4MEQA 5I40A 4A9EA 4NR8A 1ZKRA 4QR3A 4YC9A 4RVRA 5LJ0A 4QR4A 5E74A 5LKXA 5ENHA 2L84A 4KCXA 5J0DA 4CUTA 5D3JA 2YYNA 4O77A 5E3DA 5H85A 5CQ4A 5EWVA 5FB0A 4NUCA 4Z93A 5CQTA 4YH4A 5IGMA 5F60A 4NRCA 4HBYA 1PUOA 1WUMA 5HRXA 2OO1A 5ENIA 4QYLA 5AMFA 4IR4A 4NRAA 4GPJA 3JVKA 4MEPA 5I29A 5I7YA 2E7OA 5LJ2A 4MR5A 5FE0A 3HMFA 2WP1A 5BT3A 5F62A 3U5KA 4YYKA 5DFCA 2R10A 4QYDA 2I8NA 4PTBA 2YEMA 2RNYA 5CQ8A 4IOQA 5ENBA 5G4RA 5CGPA 5HM0A 4DONA 4O75A 4UYFA 5DYUA 5DYCA 2DVSA 5ENJA 4LR6A 4AKIA 2F6NA 4NYVA 2RNXA 4A9KA 4PKLA 5DFDA 5HJCA 4A9IA 5F25A 5D3SA 5CQ5A 5FE2A 4NYWA 5CUEA 4UIVA 4HBXA 4A9FA 4YK0A 1F68A 1N72A 4UYGA 3UV4A 4A9MA 2YDWA 4MENA 4LRGA 5CUAA 2I7KA 3FKMX 4LZSA 4PCEA 5FG4A 4LZRA 4O74A 4NQMA 5E3GA 4YAXA 5DYXA 5H1UA 4UIZA 4YYHA 2DVVA 5CQ7A 5IGKA 3LQJA 3Q2EA 2FSAA 4TS8A 5EGUA 5FFYA 3AADA 5DKCA 5HQ6A 4O72A 5CS8A 5TB6A 3SVFA 3G0LA 4NQNA 3LXJA 5CP5A 4YYGA 2R0SA 4ZW1A 4OUFA 4C66A 4XY9A 4QB3A 4KV4A 5AD3A 5C7NA 4UIYA 2D82A 3QZTA 5ENGA 2R0VA 5EWWA 5FH8A 5L98A 5BT4A 4FLPA 5COIA 5A5OA 5LVQA 4O7CA 5ETBA 3DWYA 5DBMA 4O7EA 5A5SA 3ZYUA 5F1LA 5I1QA 5E0RA 4YY4A 5D3LA 3JVJA 4YYDA 4IORA 5FE5A 1JM4B 5FE8A 5CUCA 2YW5A 4NRBA 5F5ZA 5HCLA 5F2PA 5ENCA 5L99A 2YQDA 2L85A 3DAIA 4QZSA 5TCMA 3NXBA 5AD2A 4NUEA 5HQ5A 5KTUA 3U5NA 4QY4A 4UYHA 3P1CA 2H60A 4AKGA 4A9LA 2RI7A 4NUDA 5HELA 5FE6A 5F36A 5FG6A 5KU3A 4ZC9A 3LJWA 4CUSA 5EVAA 2G4AA 5A7CA 5CRMA 5D0CA 5DKHA 4QSQA 2GRCA 5C89A 5HLSA 5HQ7A 3RCWA 5FE4A 4Z6HA 3GG3A 3O37A 5D3HA 4IR6A 5JWMA 3U5LA 5EPBA 2OUOA 5IG6A 2NXBA 4NXJA 4XYAA 5A82A 3MUKA 3MB4A 3P5OA 4A9JA 5KTXA 5CQ3A 4MR4A 2DATA 5DKDA 5DFBA 4ZQLA 5DYAA 2E7NA 3UV2A 2WP2A 5CZGA 4HBVA 4HXMA 5D26A 5E73A 4HXRA 5LJ1A 4UIXA 5C87A 5E9KA 2LSPB 3JVMA 5KHMA 4UIWA 4QSRA 4MR3A 3D1DA 1EQFA 5IGNA 4O78A 5FDZA 3SVHA 4HXOA 5A81A 5F63A 4QEWA 4QSWA 4MR6A 4NR7A 5EPRA 4QBMA 4TT6A 4CUPA 2EJNA 4PY6A 4YABA 5L8TA 4UITA 2RO1A 4TT4A 5A85A 4NR9A 5FH7A 5EK9A 5HENA 5D3RA 4PS5A 2KTBB 5A5PA 4QNSA 5ETDA 5JI8A 5D3NA 4YY6A 4YYJA 1ZS5A 4NR5A 3UVDA 3IU5A 4O7BA 4J0SA 4Z1QA 3JVLA 2YEKA 4O7FA 2D9EA 5CUDA 5I89A 2DVRA 4TU4A 5CRZA 4YYNA 5FFWA 5CUGA 2RS9B 5E9VA 4ALGA 5CQ6A 4AKHA 5K29A 3ONIA 2DVQA 5EA1A 5IGLA 4QC1A 3UV5A 4HXLA 4N4FA 2N9GA 4TTEA 3QZVA 3O34A 3S92A 4QSPA 5L8UA 4LZ2A 4UYFB 5A5RA 3Q2FA 3G0JA 2R0YA 4IR3A 5EWHA 3P1DA 3I3JA 3MQMA 4BJXA 4CFKA 4XY8A 4QSSA 1X0JA 4LYSA 5DW1A 5FB1A 4CFLA 5E9IA 4Y03A 3LQHA 5CU8A 4J1PA 5II2A 4IR5A 4YBTA 5LVRA 3SVGA 3K2JA 5EPSA 5LKUA 4TT2A 4NR6A 5LKTA 5DLXA 4QSUA 5EU1A 4NR4A 3UVWA 5A83A 4CUQA 4YH3A 4X2IA 4LDFA 3VKHA 2RNWA 4O70A 5FFVA 5F3AA 5IBNA 3P1FA 5EP7A 4PCIA 4YATA 3U5JA 4UYEA 3UW9A 5I83A 4O71A 5DX4A 5ENEA 4CL9A 1JSPB 3D1BA 3QZSA 5HRVA 3MULA 4QSXA 4J0RA 4HXSA 4NS5A 5FG5A 5EISA 3HMHA 5ENFA 3MB3A 5EICA 2L5EA 3U5PA 4QSTA 4N4IA 4QEUA 4HXNA 5E9MA 4BHWA 3TLPA 4O7AA 4UIUA 5EQ1A 4WHUA 5H1VA 4CURA 3HMEA 5E9YA 2YELA 4C67A 5FE1A 5EWCA 3LQIA 5E9LA 4AI6A 4CLBA 4NYXA 4N4HA 4LYWA 5I7XA 5HFRA 4A9OA 4F3IA 4XUAA 5FH6A 5CFWA 5II1A 2DKWA 2F6JA 2RFJA 5C85A
chains in the Genus database with same CATH topology
5G4SA 4YYMA 4Q0OA 3O36A 3S91A 3U5MA 5A5QA 4TU6A 3O35A 5CY9A 5IIDA 3UVYA 4LYIA 5L97A 5ACYA 5D25A 4BW4A 4YBMA 4MEOA 4BW1A 3P1EA 4YBSA 5CUBA 4CUUA 5H1TA 5F1HA 5I88A 1WUGA 5I80A 4N3WA 4TQNA 5FE3A 4ALHA 4YADA 5D3PA 5DY7A 3AQAA 5D24A 5AMEA 3U5OA 4HXKA 5L96A 5LUUA 4A9NA 4BW3A 3D7CA 4QR5A 4OGJA 3MXFA 5C4QA 4TZ8A 4A9HA 4YYIA 5CQAA 4TYLA 4N4GA 4O76A 4QUUA 4XUBA 5HEMA 4WIVA 4QEVA 2DWWA 3O33A 4TZ2A 4AKNA 5DLZA 4Z1SA 4QSVA 5A5NA 2E3KA 5HRWA 5HFQA 5EI4A 5D7XA 5BT5A 3UVXA 5CTLA 5CPEA 4QUTA 5FE9A 4OGIA 5KO4A 5EM3A 4Z6IA 5FE7A 4BW2A 4Q0NA 4QC3A 4UYDA 5I86A 5EV9A 5F61A 5DW2A 5C8GA 5D3TA 4J3IA 5LKZA 2OSSA 4E96A 4HXPA 4LC2A 3IU6A 5KTWA 1E6IA 2MJVB 4KV1A 4WHWA 5FBXA 5EWDA 4HBWA 4IOOA 5E7DA 4MEQA 5I40A 4A9EA 4NR8A 4QR3A 4YC9A 4RVRA 5LJ0A 4QR4A 5E74A 5LKXA 5ENHA 2L84A 4KCXA 5J0DA 4CUTA 5D3JA 2YYNA 4O77A 5E3DA 5H85A 5CQ4A 5EWVA 5FB0A 4NUCA 4Z93A 5CQTA 4YH4A 5IGMA 5F60A 4NRCA 4HBYA 1WUMA 5HRXA 2OO1A 5ENIA 4QYLA 5AMFA 4IR4A 4NRAA 4GPJA 3JVKA 4MEPA 5I29A 5I7YA 2E7OA 5LJ2A 4MR5A 5FE0A 3HMFA 2WP1A 5BT3A 5F62A 3U5KA 4YYKA 5DFCA 2R10A 4QYDA 2I8NA 4PTBA 2YEMA 2RNYA 5CQ8A 4IOQA 5ENBA 5G4RA 5CGPA 5HM0A 4DONA 4O75A 4UYFA 5DYUA 5DYCA 2DVSA 5ENJA 4LR6A 2F6NA 4NYVA 2RNXA 4A9KA 4PKLA 5DFDA 5HJCA 4A9IA 5F25A 5D3SA 5CQ5A 5FE2A 4NYWA 5CUEA 4UIVA 4HBXA 4A9FA 4YK0A 1F68A 1N72A 4UYGA 3UV4A 4A9MA 2YDWA 4MENA 4LRGA 5CUAA 2I7KA 3FKMX 4LZSA 4PCEA 5FG4A 4LZRA 4O74A 4NQMA 5E3GA 4YAXA 5DYXA 5H1UA 4UIZA 4YYHA 2DVVA 5CQ7A 5IGKA 3LQJA 3Q2EA 2FSAA 4TS8A 5EGUA 5FFYA 3AADA 5DKCA 5HQ6A 4O72A 5CS8A 5TB6A 3SVFA 3G0LA 4NQNA 3LXJA 5CP5A 4YYGA 2R0SA 4ZW1A 4OUFA 4C66A 4XY9A 4QB3A 4KV4A 5AD3A 5C7NA 4UIYA 2D82A 3QZTA 5ENGA 2R0VA 5EWWA 5FH8A 5L98A 5BT4A 4FLPA 5COIA 5A5OA 5LVQA 4O7CA 5ETBA 3DWYA 5DBMA 4O7EA 5A5SA 3ZYUA 5F1LA 5I1QA 5E0RA 4YY4A 5D3LA 3JVJA 4YYDA 4IORA 5FE5A 1JM4B 5FE8A 5CUCA 2YW5A 4NRBA 5F5ZA 5HCLA 5F2PA 5ENCA 5L99A 2YQDA 2L85A 3DAIA 4QZSA 5TCMA 3NXBA 5AD2A 4NUEA 5HQ5A 5KTUA 3U5NA 4QY4A 4UYHA 3P1CA 2H60A 4A9LA 2RI7A 4NUDA 5HELA 5FE6A 5F36A 5FG6A 5KU3A 4ZC9A 3LJWA 4CUSA 5EVAA 2G4AA 5A7CA 5CRMA 5D0CA 5DKHA 4QSQA 2GRCA 5C89A 5HLSA 5HQ7A 3RCWA 5FE4A 4Z6HA 3GG3A 3O37A 5D3HA 4IR6A 5JWMA 3U5LA 5EPBA 2OUOA 5IG6A 2NXBA 4NXJA 4XYAA 5A82A 3MUKA 3MB4A 3P5OA 4A9JA 5KTXA 5CQ3A 4MR4A 2DATA 5DKDA 5DFBA 4ZQLA 5DYAA 2E7NA 3UV2A 2WP2A 5CZGA 4HBVA 4HXMA 5D26A 5E73A 4HXRA 5LJ1A 4UIXA 5C87A 5E9KA 2LSPB 3JVMA 5KHMA 4UIWA 4QSRA 4MR3A 1EQFA 5IGNA 4O78A 5FDZA 3SVHA 4HXOA 5A81A 5F63A 4QEWA 4QSWA 4MR6A 4NR7A 5EPRA 4QBMA 4TT6A 4CUPA 4PY6A 4YABA 5L8TA 4UITA 2RO1A 4TT4A 5A85A 4NR9A 5FH7A 5EK9A 5HENA 5D3RA 4PS5A 2KTBB 5A5PA 4QNSA 5ETDA 5JI8A 5D3NA 4YY6A 4YYJA 1ZS5A 4NR5A 3UVDA 3IU5A 4O7BA 4J0SA 4Z1QA 3JVLA 2YEKA 4O7FA 2D9EA 5CUDA 5I89A 2DVRA 4TU4A 5CRZA 4YYNA 5FFWA 5CUGA 2RS9B 5E9VA 4ALGA 5CQ6A 5K29A 3ONIA 2DVQA 5EA1A 5IGLA 4QC1A 3UV5A 4HXLA 4N4FA 2N9GA 4TTEA 3QZVA 3O34A 3S92A 4QSPA 5L8UA 4LZ2A 4UYFB 5A5RA 3Q2FA 3G0JA 2R0YA 4IR3A 5EWHA 3P1DA 3I3JA 3MQMA 4BJXA 4CFKA 4XY8A 4QSSA 1X0JA 4LYSA 5DW1A 5FB1A 4CFLA 5E9IA 4Y03A 3LQHA 5CU8A 4J1PA 5II2A 4IR5A 4YBTA 5LVRA 3SVGA 3K2JA 5EPSA 5LKUA 4TT2A 4NR6A 5LKTA 5DLXA 4QSUA 5EU1A 4NR4A 3UVWA 5A83A 4CUQA 4YH3A 4X2IA 4LDFA 2RNWA 4O70A 5FFVA 5F3AA 5IBNA 3P1FA 5EP7A 4PCIA 4YATA 3U5JA 4UYEA 3UW9A 5I83A 4O71A 5DX4A 5ENEA 4CL9A 1JSPB 3QZSA 5HRVA 3MULA 4QSXA 4J0RA 4HXSA 4NS5A 5FG5A 5EISA 3HMHA 5ENFA 3MB3A 5EICA 2L5EA 3U5PA 4QSTA 4N4IA 4QEUA 4HXNA 5E9MA 4BHWA 3TLPA 4O7AA 4UIUA 5EQ1A 4WHUA 5H1VA 4CURA 3HMEA 5E9YA 2YELA 4C67A 5FE1A 5EWCA 3LQIA 5E9LA 4CLBA 4NYXA 4N4HA 4LYWA 5I7XA 5HFRA 4A9OA 4F3IA 4XUAA 5FH6A 5CFWA 5II1A 2DKWA 2F6JA 2RFJA 5C85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4S A;  4YYM A;  4Q0O A;  3O36 A;  3S91 A;  3U5M A;  5A5Q A;  4TU6 A;  3O35 A;  5CY9 A;  5IID A;  3UVY A;  4LYI A;  5L97 A;  5ACY A;  5D25 A;  4BW4 A;  4YBM A;  4MEO A;  4BW1 A;  3P1E A;  4YBS A;  5CUB A;  4CUU A;  5H1T A;  5F1H A;  5I88 A;  1WUG A;  5I80 A;  4N3W A;  4TQN A;  5FE3 A;  4ALH A;  4YAD A;  5D3P A;  5DY7 A;  3AQA A;  5D24 A;  5AME A;  3U5O A;  4HXK A;  5L96 A;  5LUU A;  4A9N A;  4BW3 A;  3D7C A;  4QR5 A;  4OGJ A;  3MXF A;  5C4Q A;  4TZ8 A;  4A9H A;  4YYI A;  5CQA A;  4TYL A;  4N4G A;  4O76 A;  4QUU A;  4XUB A;  5HEM A;  4WIV A;  4QEV A;  2DWW A;  3O33 A;  4TZ2 A;  4AKN A;  5DLZ A;  4Z1S A;  4QSV A;  5A5N A;  2E3K A;  5HRW A;  5HFQ A;  5EI4 A;  5D7X A;  5BT5 A;  3UVX A;  5CTL A;  5CPE A;  4QUT A;  5FE9 A;  4OGI A;  5KO4 A;  5EM3 A;  4Z6I A;  5FE7 A;  4BW2 A;  4Q0N A;  4QC3 A;  4UYD A;  5I86 A;  5EV9 A;  5F61 A;  5DW2 A;  5C8G A;  5D3T A;  4J3I A;  5LKZ A;  2OSS A;  4E96 A;  4HXP A;  4LC2 A;  3IU6 A;  5KTW A;  1E6I A;  2MJV B;  4KV1 A;  4WHW A;  5FBX A;  5EWD A;  4HBW A;  4IOO A;  5E7D A;  4MEQ A;  5I40 A;  4A9E A;  4NR8 A;  4QR3 A;  4YC9 A;  4RVR A;  5LJ0 A;  4QR4 A;  5E74 A;  5LKX A;  5ENH A;  2L84 A;  4KCX A;  5J0D A;  4CUT A;  5D3J A;  2YYN A;  4O77 A;  5E3D A;  5H85 A;  5CQ4 A;  5EWV A;  5FB0 A;  4NUC A;  4Z93 A;  5CQT A;  4YH4 A;  5IGM A;  5F60 A;  4NRC A;  4HBY A;  1WUM A;  5HRX A;  2OO1 A;  5ENI A;  4QYL A;  5AMF A;  4IR4 A;  4NRA A;  4GPJ A;  3JVK A;  4MEP A;  5I29 A;  5I7Y A;  2E7O A;  5LJ2 A;  4MR5 A;  5FE0 A;  3HMF A;  2WP1 A;  5BT3 A;  5F62 A;  3U5K A;  4YYK A;  5DFC A;  2R10 A;  4QYD A;  2I8N A;  4PTB A;  2YEM A;  2RNY A;  5CQ8 A;  4IOQ A;  5ENB A;  5G4R A;  5CGP A;  5HM0 A;  4DON A;  4O75 A;  4UYF A;  5DYU A;  5DYC A;  2DVS A;  5ENJ A;  4LR6 A;  2F6N A;  4NYV A;  2RNX A;  4A9K A;  4PKL A;  5DFD A;  5HJC A;  4A9I A;  5F25 A;  5D3S A;  5CQ5 A;  5FE2 A;  4NYW A;  5CUE A;  4UIV A;  4HBX A;  4A9F A;  4YK0 A;  1F68 A;  1N72 A;  4UYG A;  3UV4 A;  4A9M A;  2YDW A;  4MEN A;  4LRG A;  5CUA A;  2I7K A;  3FKM X;  4LZS A;  4PCE A;  5FG4 A;  4LZR A;  4O74 A;  4NQM A;  5E3G A;  4YAX A;  5DYX A;  5H1U A;  4UIZ A;  4YYH A;  2DVV A;  5CQ7 A;  5IGK A;  3LQJ A;  3Q2E A;  2FSA A;  4TS8 A;  5EGU A;  5FFY A;  3AAD A;  5DKC A;  5HQ6 A;  4O72 A;  5CS8 A;  5TB6 A;  3SVF A;  3G0L A;  4NQN A;  3LXJ A;  5CP5 A;  4YYG A;  2R0S A;  4ZW1 A;  4OUF A;  4C66 A;  4XY9 A;  4QB3 A;  4KV4 A;  5AD3 A;  5C7N A;  4UIY A;  2D82 A;  3QZT A;  5ENG A;  2R0V A;  5EWW A;  5FH8 A;  5L98 A;  5BT4 A;  4FLP A;  5COI A;  5A5O A;  5LVQ A;  4O7C A;  5ETB A;  3DWY A;  5DBM A;  4O7E A;  5A5S A;  3ZYU A;  5F1L A;  5I1Q A;  5E0R A;  4YY4 A;  5D3L A;  3JVJ A;  4YYD A;  4IOR A;  5FE5 A;  1JM4 B;  5FE8 A;  5CUC A;  2YW5 A;  4NRB A;  5F5Z A;  5HCL A;  5F2P A;  5ENC A;  5L99 A;  2YQD A;  2L85 A;  3DAI A;  4QZS A;  5TCM A;  3NXB A;  5AD2 A;  4NUE A;  5HQ5 A;  5KTU A;  3U5N A;  4QY4 A;  4UYH A;  3P1C A;  2H60 A;  4A9L A;  2RI7 A;  4NUD A;  5HEL A;  5FE6 A;  5F36 A;  5FG6 A;  5KU3 A;  4ZC9 A;  3LJW A;  4CUS A;  5EVA A;  2G4A A;  5A7C A;  5CRM A;  5D0C A;  5DKH A;  4QSQ A;  2GRC A;  5C89 A;  5HLS A;  5HQ7 A;  3RCW A;  5FE4 A;  4Z6H A;  3GG3 A;  3O37 A;  5D3H A;  4IR6 A;  5JWM A;  3U5L A;  5EPB A;  2OUO A;  5IG6 A;  2NXB A;  4NXJ A;  4XYA A;  5A82 A;  3MUK A;  3MB4 A;  3P5O A;  4A9J A;  5KTX A;  5CQ3 A;  4MR4 A;  2DAT A;  5DKD A;  5DFB A;  4ZQL A;  5DYA A;  2E7N A;  3UV2 A;  2WP2 A;  5CZG A;  4HBV A;  4HXM A;  5D26 A;  5E73 A;  4HXR A;  5LJ1 A;  4UIX A;  5C87 A;  5E9K A;  2LSP B;  3JVM A;  5KHM A;  4UIW A;  4QSR A;  4MR3 A;  1EQF A;  5IGN A;  4O78 A;  5FDZ A;  3SVH A;  4HXO A;  5A81 A;  5F63 A;  4QEW A;  4QSW A;  4MR6 A;  4NR7 A;  5EPR A;  4QBM A;  4TT6 A;  4CUP A;  4PY6 A;  4YAB A;  5L8T A;  4UIT A;  2RO1 A;  4TT4 A;  5A85 A;  4NR9 A;  5FH7 A;  5EK9 A;  5HEN A;  5D3R A;  4PS5 A;  2KTB B;  5A5P A;  4QNS A;  5ETD A;  5JI8 A;  5D3N A;  4YY6 A;  4YYJ A;  1ZS5 A;  4NR5 A;  3UVD A;  3IU5 A;  4O7B A;  4J0S A;  4Z1Q A;  3JVL A;  2YEK A;  4O7F A;  2D9E A;  5CUD A;  5I89 A;  2DVR A;  4TU4 A;  5CRZ A;  4YYN A;  5FFW A;  5CUG A;  2RS9 B;  5E9V A;  4ALG A;  5CQ6 A;  5K29 A;  3ONI A;  2DVQ A;  5EA1 A;  5IGL A;  4QC1 A;  3UV5 A;  4HXL A;  4N4F A;  2N9G A;  4TTE A;  3QZV A;  3O34 A;  3S92 A;  4QSP A;  5L8U A;  4LZ2 A;  4UYF B;  5A5R A;  3Q2F A;  3G0J A;  2R0Y A;  4IR3 A;  5EWH A;  3P1D A;  3I3J A;  3MQM A;  4BJX A;  4CFK A;  4XY8 A;  4QSS A;  1X0J A;  4LYS A;  5DW1 A;  5FB1 A;  4CFL A;  5E9I A;  4Y03 A;  3LQH A;  5CU8 A;  4J1P A;  5II2 A;  4IR5 A;  4YBT A;  5LVR A;  3SVG A;  3K2J A;  5EPS A;  5LKU A;  4TT2 A;  4NR6 A;  5LKT A;  5DLX A;  4QSU A;  5EU1 A;  4NR4 A;  3UVW A;  5A83 A;  4CUQ A;  4YH3 A;  4X2I A;  4LDF A;  2RNW A;  4O70 A;  5FFV A;  5F3A A;  5IBN A;  3P1F A;  5EP7 A;  4PCI A;  4YAT A;  3U5J A;  4UYE A;  3UW9 A;  5I83 A;  4O71 A;  5DX4 A;  5ENE A;  4CL9 A;  1JSP B;  3QZS A;  5HRV A;  3MUL A;  4QSX A;  4J0R A;  4HXS A;  4NS5 A;  5FG5 A;  5EIS A;  3HMH A;  5ENF A;  3MB3 A;  5EIC A;  2L5E A;  3U5P A;  4QST A;  4N4I A;  4QEU A;  4HXN A;  5E9M A;  4BHW A;  3TLP A;  4O7A A;  4UIU A;  5EQ1 A;  4WHU A;  5H1V A;  4CUR A;  3HME A;  5E9Y A;  2YEL A;  4C67 A;  5FE1 A;  5EWC A;  3LQI A;  5E9L A;  4CLB A;  4NYX A;  4N4H A;  4LYW A;  5I7X A;  5HFR A;  4A9O A;  4F3I A;  4XUA A;  5FH6 A;  5CFW A;  5II1 A;  2DKW A;  2F6J A;  2RFJ A;  5C85 A; 
#chains in the Genus database with same CATH topology
 5G4S A;  4YYM A;  4Q0O A;  3O36 A;  3S91 A;  3U5M A;  5A5Q A;  4TU6 A;  3O35 A;  5CY9 A;  5IID A;  3UVY A;  4LYI A;  5L97 A;  5ACY A;  5D25 A;  4BW4 A;  4YBM A;  4MEO A;  4BW1 A;  3P1E A;  4YBS A;  5CUB A;  4CUU A;  5H1T A;  5F1H A;  5I88 A;  1WUG A;  5I80 A;  4N3W A;  4TQN A;  5FE3 A;  4ALH A;  4YAD A;  5D3P A;  5DY7 A;  3AQA A;  5D24 A;  5AME A;  3U5O A;  4HXK A;  5L96 A;  5LUU A;  4A9N A;  4BW3 A;  3D7C A;  4QR5 A;  4OGJ A;  3MXF A;  3ERR A;  5C4Q A;  4TZ8 A;  4A9H A;  4YYI A;  5CQA A;  4TYL A;  4N4G A;  4O76 A;  4QUU A;  4XUB A;  5HEM A;  4WIV A;  4QEV A;  2DWW A;  3O33 A;  4TZ2 A;  4AKN A;  5DLZ A;  4Z1S A;  4QSV A;  5A5N A;  2E3K A;  5HRW A;  5HFQ A;  5EI4 A;  5D7X A;  5BT5 A;  3UVX A;  5CTL A;  5CPE A;  4QUT A;  5FE9 A;  4OGI A;  5KO4 A;  5EM3 A;  4Z6I A;  5FE7 A;  4BW2 A;  4Q0N A;  4QC3 A;  4UYD A;  5I86 A;  5EV9 A;  5F61 A;  5DW2 A;  5C8G A;  5D3T A;  4J3I A;  5LKZ A;  2OSS A;  4E96 A;  4HXP A;  4LC2 A;  3IU6 A;  5KTW A;  1E6I A;  2MJV B;  4KV1 A;  4WHW A;  3VKG A;  5FBX A;  5EWD A;  4HBW A;  4IOO A;  5E7D A;  4MEQ A;  5I40 A;  4A9E A;  4NR8 A;  1ZKR A;  4QR3 A;  4YC9 A;  4RVR A;  5LJ0 A;  4QR4 A;  5E74 A;  5LKX A;  5ENH A;  2L84 A;  4KCX A;  5J0D A;  4CUT A;  5D3J A;  2YYN A;  4O77 A;  5E3D A;  5H85 A;  5CQ4 A;  5EWV A;  5FB0 A;  4NUC A;  4Z93 A;  5CQT A;  4YH4 A;  5IGM A;  5F60 A;  4NRC A;  4HBY A;  1PUO A;  1WUM A;  5HRX A;  2OO1 A;  5ENI A;  4QYL A;  5AMF A;  4IR4 A;  4NRA A;  4GPJ A;  3JVK A;  4MEP A;  5I29 A;  5I7Y A;  2E7O A;  5LJ2 A;  4MR5 A;  5FE0 A;  3HMF A;  2WP1 A;  5BT3 A;  5F62 A;  3U5K A;  4YYK A;  5DFC A;  2R10 A;  4QYD A;  2I8N A;  4PTB A;  2YEM A;  2RNY A;  5CQ8 A;  4IOQ A;  5ENB A;  5G4R A;  5CGP A;  5HM0 A;  4DON A;  4O75 A;  4UYF A;  5DYU A;  5DYC A;  2DVS A;  5ENJ A;  4LR6 A;  4AKI A;  2F6N A;  4NYV A;  2RNX A;  4A9K A;  4PKL A;  5DFD A;  5HJC A;  4A9I A;  5F25 A;  5D3S A;  5CQ5 A;  5FE2 A;  4NYW A;  5CUE A;  4UIV A;  4HBX A;  4A9F A;  4YK0 A;  1F68 A;  1N72 A;  4UYG A;  3UV4 A;  4A9M A;  2YDW A;  4MEN A;  4LRG A;  5CUA A;  2I7K A;  3FKM X;  4LZS A;  4PCE A;  5FG4 A;  4LZR A;  4O74 A;  4NQM A;  5E3G A;  4YAX A;  5DYX A;  5H1U A;  4UIZ A;  4YYH A;  2DVV A;  5CQ7 A;  5IGK A;  3LQJ A;  3Q2E A;  2FSA A;  4TS8 A;  5EGU A;  5FFY A;  3AAD A;  5DKC A;  5HQ6 A;  4O72 A;  5CS8 A;  5TB6 A;  3SVF A;  3G0L A;  4NQN A;  3LXJ A;  5CP5 A;  4YYG A;  2R0S A;  4ZW1 A;  4OUF A;  4C66 A;  4XY9 A;  4QB3 A;  4KV4 A;  5AD3 A;  5C7N A;  4UIY A;  2D82 A;  3QZT A;  5ENG A;  2R0V A;  5EWW A;  5FH8 A;  5L98 A;  5BT4 A;  4FLP A;  5COI A;  5A5O A;  5LVQ A;  4O7C A;  5ETB A;  3DWY A;  5DBM A;  4O7E A;  5A5S A;  3ZYU A;  5F1L A;  5I1Q A;  5E0R A;  4YY4 A;  5D3L A;  3JVJ A;  4YYD A;  4IOR A;  5FE5 A;  1JM4 B;  5FE8 A;  5CUC A;  2YW5 A;  4NRB A;  5F5Z A;  5HCL A;  5F2P A;  5ENC A;  5L99 A;  2YQD A;  2L85 A;  3DAI A;  4QZS A;  5TCM A;  3NXB A;  5AD2 A;  4NUE A;  5HQ5 A;  5KTU A;  3U5N A;  4QY4 A;  4UYH A;  3P1C A;  2H60 A;  4AKG A;  4A9L A;  2RI7 A;  4NUD A;  5HEL A;  5FE6 A;  5F36 A;  5FG6 A;  5KU3 A;  4ZC9 A;  3LJW A;  4CUS A;  5EVA A;  2G4A A;  5A7C A;  5CRM A;  5D0C A;  5DKH A;  4QSQ A;  2GRC A;  5C89 A;  5HLS A;  5HQ7 A;  3RCW A;  5FE4 A;  4Z6H A;  3GG3 A;  3O37 A;  5D3H A;  4IR6 A;  5JWM A;  3U5L A;  5EPB A;  2OUO A;  5IG6 A;  2NXB A;  4NXJ A;  4XYA A;  5A82 A;  3MUK A;  3MB4 A;  3P5O A;  4A9J A;  5KTX A;  5CQ3 A;  4MR4 A;  2DAT A;  5DKD A;  5DFB A;  4ZQL A;  5DYA A;  2E7N A;  3UV2 A;  2WP2 A;  5CZG A;  4HBV A;  4HXM A;  5D26 A;  5E73 A;  4HXR A;  5LJ1 A;  4UIX A;  5C87 A;  5E9K A;  2LSP B;  3JVM A;  5KHM A;  4UIW A;  4QSR A;  4MR3 A;  3D1D A;  1EQF A;  5IGN A;  4O78 A;  5FDZ A;  3SVH A;  4HXO A;  5A81 A;  5F63 A;  4QEW A;  4QSW A;  4MR6 A;  4NR7 A;  5EPR A;  4QBM A;  4TT6 A;  4CUP A;  2EJN A;  4PY6 A;  4YAB A;  5L8T A;  4UIT A;  2RO1 A;  4TT4 A;  5A85 A;  4NR9 A;  5FH7 A;  5EK9 A;  5HEN A;  5D3R A;  4PS5 A;  2KTB B;  5A5P A;  4QNS A;  5ETD A;  5JI8 A;  5D3N A;  4YY6 A;  4YYJ A;  1ZS5 A;  4NR5 A;  3UVD A;  3IU5 A;  4O7B A;  4J0S A;  4Z1Q A;  3JVL A;  2YEK A;  4O7F A;  2D9E A;  5CUD A;  5I89 A;  2DVR A;  4TU4 A;  5CRZ A;  4YYN A;  5FFW A;  5CUG A;  2RS9 B;  5E9V A;  4ALG A;  5CQ6 A;  4AKH A;  5K29 A;  3ONI A;  2DVQ A;  5EA1 A;  5IGL A;  4QC1 A;  3UV5 A;  4HXL A;  4N4F A;  2N9G A;  4TTE A;  3QZV A;  3O34 A;  3S92 A;  4QSP A;  5L8U A;  4LZ2 A;  4UYF B;  5A5R A;  3Q2F A;  3G0J A;  2R0Y A;  4IR3 A;  5EWH A;  3P1D A;  3I3J A;  3MQM A;  4BJX A;  4CFK A;  4XY8 A;  4QSS A;  1X0J A;  4LYS A;  5DW1 A;  5FB1 A;  4CFL A;  5E9I A;  4Y03 A;  3LQH A;  5CU8 A;  4J1P A;  5II2 A;  4IR5 A;  4YBT A;  5LVR A;  3SVG A;  3K2J A;  5EPS A;  5LKU A;  4TT2 A;  4NR6 A;  5LKT A;  5DLX A;  4QSU A;  5EU1 A;  4NR4 A;  3UVW A;  5A83 A;  4CUQ A;  4YH3 A;  4X2I A;  4LDF A;  3VKH A;  2RNW A;  4O70 A;  5FFV A;  5F3A A;  5IBN A;  3P1F A;  5EP7 A;  4PCI A;  4YAT A;  3U5J A;  4UYE A;  3UW9 A;  5I83 A;  4O71 A;  5DX4 A;  5ENE A;  4CL9 A;  1JSP B;  3D1B A;  3QZS A;  5HRV A;  3MUL A;  4QSX A;  4J0R A;  4HXS A;  4NS5 A;  5FG5 A;  5EIS A;  3HMH A;  5ENF A;  3MB3 A;  5EIC A;  2L5E A;  3U5P A;  4QST A;  4N4I A;  4QEU A;  4HXN A;  5E9M A;  4BHW A;  3TLP A;  4O7A A;  4UIU A;  5EQ1 A;  4WHU A;  5H1V A;  4CUR A;  3HME A;  5E9Y A;  2YEL A;  4C67 A;  5FE1 A;  5EWC A;  3LQI A;  5E9L A;  4AI6 A;  4CLB A;  4NYX A;  4N4H A;  4LYW A;  5I7X A;  5HFR A;  4A9O A;  4F3I A;  4XUA A;  5FH6 A;  5CFW A;  5II1 A;  2DKW A;  2F6J A;  2RFJ A;  5C85 A; 
#chains in the Genus database with same CATH homology
 5G4S A;  4YYM A;  4Q0O A;  3O36 A;  3S91 A;  3U5M A;  5A5Q A;  4TU6 A;  3O35 A;  5CY9 A;  5IID A;  3UVY A;  4LYI A;  5L97 A;  5ACY A;  5D25 A;  4BW4 A;  4YBM A;  4MEO A;  4BW1 A;  3P1E A;  4YBS A;  5CUB A;  4CUU A;  5H1T A;  5F1H A;  5I88 A;  1WUG A;  5I80 A;  4N3W A;  4TQN A;  5FE3 A;  4ALH A;  4YAD A;  5D3P A;  5DY7 A;  3AQA A;  5D24 A;  5AME A;  3U5O A;  4HXK A;  5L96 A;  5LUU A;  4A9N A;  4BW3 A;  3D7C A;  4QR5 A;  4OGJ A;  3MXF A;  5C4Q A;  4TZ8 A;  4A9H A;  4YYI A;  5CQA A;  4TYL A;  4N4G A;  4O76 A;  4QUU A;  4XUB A;  5HEM A;  4WIV A;  4QEV A;  2DWW A;  3O33 A;  4TZ2 A;  4AKN A;  5DLZ A;  4Z1S A;  4QSV A;  5A5N A;  2E3K A;  5HRW A;  5HFQ A;  5EI4 A;  5D7X A;  5BT5 A;  3UVX A;  5CTL A;  5CPE A;  4QUT A;  5FE9 A;  4OGI A;  5KO4 A;  5EM3 A;  4Z6I A;  5FE7 A;  4BW2 A;  4Q0N A;  4QC3 A;  4UYD A;  5I86 A;  5EV9 A;  5F61 A;  5DW2 A;  5C8G A;  5D3T A;  4J3I A;  5LKZ A;  2OSS A;  4E96 A;  4HXP A;  4LC2 A;  3IU6 A;  5KTW A;  1E6I A;  2MJV B;  4KV1 A;  4WHW A;  5FBX A;  5EWD A;  4HBW A;  4IOO A;  5E7D A;  4MEQ A;  5I40 A;  4A9E A;  4NR8 A;  4QR3 A;  4YC9 A;  4RVR A;  5LJ0 A;  4QR4 A;  5E74 A;  5LKX A;  5ENH A;  2L84 A;  4KCX A;  5J0D A;  4CUT A;  5D3J A;  2YYN A;  4O77 A;  5E3D A;  5H85 A;  5CQ4 A;  5EWV A;  5FB0 A;  4NUC A;  4Z93 A;  5CQT A;  4YH4 A;  5IGM A;  5F60 A;  4NRC A;  4HBY A;  1WUM A;  5HRX A;  2OO1 A;  5ENI A;  4QYL A;  5AMF A;  4IR4 A;  4NRA A;  4GPJ A;  3JVK A;  4MEP A;  5I29 A;  5I7Y A;  2E7O A;  5LJ2 A;  4MR5 A;  5FE0 A;  3HMF A;  2WP1 A;  5BT3 A;  5F62 A;  3U5K A;  4YYK A;  5DFC A;  2R10 A;  4QYD A;  2I8N A;  4PTB A;  2YEM A;  2RNY A;  5CQ8 A;  4IOQ A;  5ENB A;  5G4R A;  5CGP A;  5HM0 A;  4DON A;  4O75 A;  4UYF A;  5DYU A;  5DYC A;  2DVS A;  5ENJ A;  4LR6 A;  2F6N A;  4NYV A;  2RNX A;  4A9K A;  4PKL A;  5DFD A;  5HJC A;  4A9I A;  5F25 A;  5D3S A;  5CQ5 A;  5FE2 A;  4NYW A;  5CUE A;  4UIV A;  4HBX A;  4A9F A;  4YK0 A;  1F68 A;  1N72 A;  4UYG A;  3UV4 A;  4A9M A;  2YDW A;  4MEN A;  4LRG A;  5CUA A;  2I7K A;  3FKM X;  4LZS A;  4PCE A;  5FG4 A;  4LZR A;  4O74 A;  4NQM A;  5E3G A;  4YAX A;  5DYX A;  5H1U A;  4UIZ A;  4YYH A;  2DVV A;  5CQ7 A;  5IGK A;  3LQJ A;  3Q2E A;  2FSA A;  4TS8 A;  5EGU A;  5FFY A;  3AAD A;  5DKC A;  5HQ6 A;  4O72 A;  5CS8 A;  5TB6 A;  3SVF A;  3G0L A;  4NQN A;  3LXJ A;  5CP5 A;  4YYG A;  2R0S A;  4ZW1 A;  4OUF A;  4C66 A;  4XY9 A;  4QB3 A;  4KV4 A;  5AD3 A;  5C7N A;  4UIY A;  2D82 A;  3QZT A;  5ENG A;  2R0V A;  5EWW A;  5FH8 A;  5L98 A;  5BT4 A;  4FLP A;  5COI A;  5A5O A;  5LVQ A;  4O7C A;  5ETB A;  3DWY A;  5DBM A;  4O7E A;  5A5S A;  3ZYU A;  5F1L A;  5I1Q A;  5E0R A;  4YY4 A;  5D3L A;  3JVJ A;  4YYD A;  4IOR A;  5FE5 A;  1JM4 B;  5FE8 A;  5CUC A;  2YW5 A;  4NRB A;  5F5Z A;  5HCL A;  5F2P A;  5ENC A;  5L99 A;  2YQD A;  2L85 A;  3DAI A;  4QZS A;  5TCM A;  3NXB A;  5AD2 A;  4NUE A;  5HQ5 A;  5KTU A;  3U5N A;  4QY4 A;  4UYH A;  3P1C A;  2H60 A;  4A9L A;  2RI7 A;  4NUD A;  5HEL A;  5FE6 A;  5F36 A;  5FG6 A;  5KU3 A;  4ZC9 A;  3LJW A;  4CUS A;  5EVA A;  2G4A A;  5A7C A;  5CRM A;  5D0C A;  5DKH A;  4QSQ A;  2GRC A;  5C89 A;  5HLS A;  5HQ7 A;  3RCW A;  5FE4 A;  4Z6H A;  3GG3 A;  3O37 A;  5D3H A;  4IR6 A;  5JWM A;  3U5L A;  5EPB A;  2OUO A;  5IG6 A;  2NXB A;  4NXJ A;  4XYA A;  5A82 A;  3MUK A;  3MB4 A;  3P5O A;  4A9J A;  5KTX A;  5CQ3 A;  4MR4 A;  2DAT A;  5DKD A;  5DFB A;  4ZQL A;  5DYA A;  2E7N A;  3UV2 A;  2WP2 A;  5CZG A;  4HBV A;  4HXM A;  5D26 A;  5E73 A;  4HXR A;  5LJ1 A;  4UIX A;  5C87 A;  5E9K A;  2LSP B;  3JVM A;  5KHM A;  4UIW A;  4QSR A;  4MR3 A;  1EQF A;  5IGN A;  4O78 A;  5FDZ A;  3SVH A;  4HXO A;  5A81 A;  5F63 A;  4QEW A;  4QSW A;  4MR6 A;  4NR7 A;  5EPR A;  4QBM A;  4TT6 A;  4CUP A;  4PY6 A;  4YAB A;  5L8T A;  4UIT A;  2RO1 A;  4TT4 A;  5A85 A;  4NR9 A;  5FH7 A;  5EK9 A;  5HEN A;  5D3R A;  4PS5 A;  2KTB B;  5A5P A;  4QNS A;  5ETD A;  5JI8 A;  5D3N A;  4YY6 A;  4YYJ A;  1ZS5 A;  4NR5 A;  3UVD A;  3IU5 A;  4O7B A;  4J0S A;  4Z1Q A;  3JVL A;  2YEK A;  4O7F A;  2D9E A;  5CUD A;  5I89 A;  2DVR A;  4TU4 A;  5CRZ A;  4YYN A;  5FFW A;  5CUG A;  2RS9 B;  5E9V A;  4ALG A;  5CQ6 A;  5K29 A;  3ONI A;  2DVQ A;  5EA1 A;  5IGL A;  4QC1 A;  3UV5 A;  4HXL A;  4N4F A;  2N9G A;  4TTE A;  3QZV A;  3O34 A;  3S92 A;  4QSP A;  5L8U A;  4LZ2 A;  4UYF B;  5A5R A;  3Q2F A;  3G0J A;  2R0Y A;  4IR3 A;  5EWH A;  3P1D A;  3I3J A;  3MQM A;  4BJX A;  4CFK A;  4XY8 A;  4QSS A;  1X0J A;  4LYS A;  5DW1 A;  5FB1 A;  4CFL A;  5E9I A;  4Y03 A;  3LQH A;  5CU8 A;  4J1P A;  5II2 A;  4IR5 A;  4YBT A;  5LVR A;  3SVG A;  3K2J A;  5EPS A;  5LKU A;  4TT2 A;  4NR6 A;  5LKT A;  5DLX A;  4QSU A;  5EU1 A;  4NR4 A;  3UVW A;  5A83 A;  4CUQ A;  4YH3 A;  4X2I A;  4LDF A;  2RNW A;  4O70 A;  5FFV A;  5F3A A;  5IBN A;  3P1F A;  5EP7 A;  4PCI A;  4YAT A;  3U5J A;  4UYE A;  3UW9 A;  5I83 A;  4O71 A;  5DX4 A;  5ENE A;  4CL9 A;  1JSP B;  3QZS A;  5HRV A;  3MUL A;  4QSX A;  4J0R A;  4HXS A;  4NS5 A;  5FG5 A;  5EIS A;  3HMH A;  5ENF A;  3MB3 A;  5EIC A;  2L5E A;  3U5P A;  4QST A;  4N4I A;  4QEU A;  4HXN A;  5E9M A;  4BHW A;  3TLP A;  4O7A A;  4UIU A;  5EQ1 A;  4WHU A;  5H1V A;  4CUR A;  3HME A;  5E9Y A;  2YEL A;  4C67 A;  5FE1 A;  5EWC A;  3LQI A;  5E9L A;  4CLB A;  4NYX A;  4N4H A;  4LYW A;  5I7X A;  5HFR A;  4A9O A;  4F3I A;  4XUA A;  5FH6 A;  5CFW A;  5II1 A;  2DKW A;  2F6J A;  2RFJ A;  5C85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...