2DKWA

Solution structure of the bromodomain of human protein kiaa1240
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
GSSGSSGNTLRELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein KIAA1240
publication title Solution structure of the bromodomain of human protein KIAA1240
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dkwA00
4NR7A 4NUDA 4NRAA 5L97A 2FSAA 2R10A 4HXSA 2D9EA 3U5JA 5LJ2A 4O7CA 2YEKA 5D3TA 4LYSA 1F68A 4N4IA 4HBVA 4YH3A 5DLXA 5LKZA 4NS5A 3QZVA 3LJWA 3LXJA 5EK9A 4J0SA 4QUTA 3UVDA 5A81A 5KTXA 5A5RA 4BHWA 5HM0A 5D3PA 4YYDA 5F61A 5ENCA 5CRMA 2R0VA 5E74A 5AMEA 4O77A 5DLZA 4XYAA 3UVXA 3P1EA 5E0RA 4UIUA 1WUMA 5DYXA 5CQ5A 4A9OA 5CZGA 3G0JA 4QZSA 4NR9A 4NRBA 5DW2A 4A9EA 5LKTA 2RNXA 4ALHA 4TYLA 5JI8A 4CLBA 4A9JA 3UVWA 4YYNA 3Q2EA 3LQIA 5EA1A 2RS9B 5FFVA 5I7XA 5A5OA 4Q0NA 4IOQA 5EVAA 4YBTA 5II2A 3TLPA 4N3WA 2DVVA 4LR6A 3ZYUA 5D3HA 5D3NA 3UVYA 5CY9A 5FE8A 4NQMA 5CQ3A 4OGJA 4O7FA 4WHWA 4KCXA 5FB1A 5IGMA 4HXMA 5CGPA 3SVGA 4BJXA 4XUBA 2RNWA 4XUAA 4QSRA 5BT5A 4CUSA 4TZ8A 4UYHA 5IIDA 5EPSA 3UV4A 5HLSA 4HBWA 4CURA 4TQNA 5F5ZA 3SVHA 3UV5A 5HQ7A 4TTEA 5IGLA 3MQMA 5A5SA 4Q0OA 5DKHA 4YYGA 3U5LA 2DWWA 3UV2A 5D3JA 3QZTA 5E3DA 2L5EA 4TS8A 3G0LA 2DATA 2GRCA 5E9VA 4LC2A 4YYKA 5ENJA 4TT4A 1ZS5A 1N72A 4MR5A 2R0SA 4LDFA 4QYDA 5EWVA 3I3JA 4NR6A 5ENGA 4PY6A 5HENA 4YH4A 4BW2A 3S91A 4UYDA 5CPEA 4A9LA 4UIVA 3HMEA 3P5OA 5ETBA 5FH6A 5FE9A 3D7CA 5HRWA 5CUBA 4A9HA 4QEVA 4QUUA 4IR5A 5E9IA 5BT4A 5CQTA 2N9GA 5COIA 5DFDA 2L84A 3JVJA 5L96A 5I40A 4CL9A 4NYWA 5FG6A 5KTUA 4N4HA 5I88A 5HEMA 4N4FA 4PCEA 3O35A 4QSWA 2L85A 3U5PA 5D7XA 2E7OA 5FE7A 3Q2FA 4IORA 4YYHA 4OUFA 4TT6A 4QC1A 5FE4A 5JWMA 4RVRA 2NXBA 3P1FA 5D3LA 5LJ0A 5D3SA 5FE0A 4QEUA 5CQ4A 4YYMA 4YAXA 4PTBA 4HXOA 5CS8A 4PKLA 4MR6A 2RNYA 4XY8A 4AKNA 5ENBA 5AD2A 2R0YA 3ONIA 5HCLA 4Y03A 4YY4A 4CUQA 5C8GA 5C89A 5F62A 4XY9A 4CUUA 4HBXA 4NR4A 4O70A 5CUDA 5AD3A 5LKXA 4UITA 4QSXA 4FLPA 3K2JA 5ENEA 5FE3A 4UIYA 5EM3A 5FB0A 5F25A 4ZQLA 5CTLA 4TT2A 3U5NA 5C85A 4NYXA 5CQ8A 5EPRA 5FH7A 5I86A 4HXNA 3DAIA 5CUAA 4C66A 4J3IA 4KV1A 2F6NA 2OUOA 5HFRA 4QSTA 4TU4A 4Z6IA 5F1LA 3MUKA 5L8UA 5E9KA 4A9NA 5LUUA 5E3GA 5LVQA 4PCIA 3AQAA 2YELA 5H1VA 5A5PA 5C87A 4YK0A 3O33A 5EWCA 4Z1SA 3O34A 5D0CA 3JVLA 5E9YA 3LQJA 5CRZA 5DW1A 5DYUA 5F60A 4QEWA 4UIZA 5ENFA 5FE5A 4O7AA 4YABA 4YBMA 4QSUA 5I83A 5FE2A 4LZ2A 5EI4A 5HQ6A 3RCWA 4A9FA 5F3AA 2F6JA 4Z6HA 5BT3A 2G4AA 4CUPA 4PS5A 4Z1QA 5FH8A 5AMFA 4UYFA 4X2IA 4HXRA 5A5QA 4BW3A 5IGKA 5L8TA 1EQFA 4IOOA 5F1HA 4QYLA 5I80A 2OO1A 3FKMX 4MEQA 5HFQA 4QR5A 4BW4A 3QZSA 5FE6A 5HQ5A 4YYJA 5FFYA 3O37A 5KU3A 4O78A 4QB3A 4O76A 5E9LA 5G4RA 3U5MA 5DFBA 5E73A 5A85A 5EISA 5KHMA 5F36A 5CUGA 4MR4A 5E7DA 4NRCA 3MB4A 2I7KA 3JVKA 4YATA 4MEPA 5HRVA 4GPJA 4IR4A 5ENHA 4TZ2A 3SVFA 3IU6A 4LRGA 5EPBA 4ZW1A 4OGIA 5CQAA 4CFLA 5IG6A 4IR3A 5LKUA 4MENA 1X0JA 4NQNA 5H1UA 4QY4A 4CFKA 5DKDA 4WHUA 2DVQA 5L99A 5ACYA 5LVRA 4A9IA 3HMHA 5ENIA 5K29A 4E96A 4ALGA 2YDWA 2YW5A 5LJ1A 5D3RA 5DBMA 4A9KA 4O7BA 5FBXA 5DYAA 4QSQA 2WP1A 5EICA 1WUGA 4NYVA 5FE1A 5II1A 2WP2A 4NXJA 2RFJA 3GG3A 4O74A 5EU1A 5IGNA 4QR4A 4LZRA 5I89A 5EP7A 4WIVA 5A83A 5I7YA 5DKCA 5DY7A 3UW9A 4YYIA 2OSSA 4QR3A 4TU6A 3U5OA 2YEMA 4CUTA 2DVRA 1JSPB 5HJCA 3P1DA 4UIWA 5E9MA 5CQ7A 2H60A 5EWDA 2DKWA 5L98A 5C7NA 3S92A 4YBSA 3MB3A 5FG4A 5I29A 5DX4A 3LQHA 3P1CA 5DFCA 5KTWA 1JM4B 5CP5A 4O7EA 4A9MA 4IR6A 4O71A 4J0RA 4QBMA 4HXLA 5KO4A 4YY6A 2LSPB 5D26A 4KV4A 4O72A 5DYCA 4DONA 2MJVB 5TCMA 5G4SA 2RO1A 4UYEA 5C4QA 3AADA 3MXFA 4BW1A 3MULA 5EGUA 2DVSA 5ETDA 3HMFA 5CUEA 4QSVA 4MR3A 5A7CA 5CQ6A 2KTBB 4LYWA 4UYGA 5F2PA 5FDZA 4QNSA 4UIXA 5A5NA 4HBYA 2I8NA 4MEOA 4NUEA 5EQ1A 2YQDA 5EWHA 2RI7A 5HELA 4F3IA 3O36A 5FFWA 5TB6A 2YYNA 5A82A 3U5KA 5CUCA 4YC9A 3NXBA 4Z93A 4NUCA 5J0DA 5IBNA 4LZSA 5EWWA 5D25A 5H85A 4ZC9A 4O75A 4YADA 4QSSA 5EV9A 5FG5A 5D24A 3DWYA 4HXPA 5CU8A 1E6IA 4C67A 4NR8A 4LYIA 5F63A 5I1QA 5H1TA 4NR5A 2E7NA 5HRXA 2E3KA 4HXKA 3JVMA 2D82A 4UYFB 4N4GA 3IU5A 5CFWA 4QSPA 4QC3A 4J1PA
chains in the Genus database with same CATH superfamily
4NR7A 4NUDA 4NRAA 5L97A 2FSAA 2R10A 4HXSA 2D9EA 3U5JA 5LJ2A 4AKGA 4O7CA 2YEKA 5D3TA 4LYSA 1F68A 4N4IA 4HBVA 4YH3A 5DLXA 5LKZA 4NS5A 3QZVA 3LJWA 3LXJA 5EK9A 4J0SA 4QUTA 3UVDA 5A81A 5KTXA 5A5RA 4BHWA 5HM0A 5D3PA 4YYDA 5F61A 5ENCA 5CRMA 2R0VA 5E74A 5AMEA 4O77A 5DLZA 4XYAA 3UVXA 3P1EA 5E0RA 4UIUA 1WUMA 5DYXA 5CQ5A 4A9OA 5CZGA 3G0JA 4QZSA 4NR9A 4NRBA 5DW2A 4A9EA 5LKTA 2RNXA 4ALHA 4TYLA 5JI8A 4CLBA 4A9JA 3UVWA 4YYNA 3Q2EA 3LQIA 5EA1A 2RS9B 5FFVA 5I7XA 5A5OA 4Q0NA 4IOQA 5EVAA 4YBTA 5II2A 3TLPA 4N3WA 2DVVA 4LR6A 3ZYUA 5D3HA 5D3NA 3UVYA 5CY9A 5FE8A 4NQMA 5CQ3A 4OGJA 4O7FA 4WHWA 4KCXA 5FB1A 5IGMA 4HXMA 5CGPA 3SVGA 4BJXA 4XUBA 2RNWA 4XUAA 4QSRA 5BT5A 4CUSA 4TZ8A 4UYHA 5IIDA 5EPSA 3UV4A 5HLSA 4HBWA 4CURA 4TQNA 5F5ZA 3SVHA 3UV5A 3D1BA 5HQ7A 4TTEA 5IGLA 3MQMA 5A5SA 4Q0OA 5DKHA 4YYGA 4AKIA 3U5LA 2DWWA 3UV2A 5D3JA 3QZTA 5E3DA 2L5EA 4TS8A 3G0LA 2DATA 2GRCA 5E9VA 4LC2A 4YYKA 5ENJA 4TT4A 1ZS5A 1N72A 4MR5A 2R0SA 4LDFA 4QYDA 5EWVA 3I3JA 4NR6A 5ENGA 4PY6A 5HENA 4YH4A 4BW2A 3S91A 4UYDA 1PUOA 5CPEA 4A9LA 4UIVA 3HMEA 3P5OA 5ETBA 5FH6A 5FE9A 3D7CA 5HRWA 5CUBA 4A9HA 4QEVA 4QUUA 4IR5A 5E9IA 5BT4A 5CQTA 2N9GA 5COIA 5DFDA 2L84A 3JVJA 5L96A 5I40A 4CL9A 4NYWA 5FG6A 5KTUA 4N4HA 5I88A 5HEMA 4N4FA 4PCEA 3O35A 4QSWA 2L85A 3U5PA 5D7XA 2E7OA 5FE7A 3Q2FA 4IORA 4YYHA 4OUFA 4TT6A 4QC1A 5FE4A 5JWMA 4RVRA 2NXBA 3P1FA 5D3LA 5LJ0A 5D3SA 5FE0A 4QEUA 5CQ4A 4YYMA 4YAXA 4PTBA 4HXOA 5CS8A 4PKLA 4MR6A 2RNYA 4XY8A 4AKNA 5ENBA 5AD2A 2R0YA 3ONIA 5HCLA 4Y03A 4YY4A 4CUQA 5C8GA 5C89A 5F62A 4XY9A 4CUUA 4HBXA 4NR4A 4O70A 3VKGA 5CUDA 5AD3A 5LKXA 4UITA 4QSXA 4FLPA 3K2JA 5ENEA 5FE3A 4UIYA 5EM3A 5FB0A 5F25A 4ZQLA 5CTLA 4TT2A 3U5NA 5C85A 4NYXA 5CQ8A 5EPRA 5FH7A 5I86A 4HXNA 3DAIA 5CUAA 4C66A 4J3IA 4KV1A 2F6NA 2OUOA 5HFRA 4QSTA 4TU4A 4Z6IA 5F1LA 3MUKA 5L8UA 5E9KA 4A9NA 5LUUA 5E3GA 5LVQA 4PCIA 3AQAA 2YELA 5H1VA 5A5PA 5C87A 4YK0A 3O33A 5EWCA 4Z1SA 3O34A 5D0CA 3JVLA 5E9YA 3LQJA 5CRZA 5DW1A 5DYUA 5F60A 4QEWA 4UIZA 5ENFA 5FE5A 4O7AA 4YABA 4YBMA 4QSUA 5I83A 5FE2A 4LZ2A 5EI4A 5HQ6A 3RCWA 4A9FA 5F3AA 2F6JA 4Z6HA 5BT3A 2G4AA 4CUPA 4PS5A 4Z1QA 5FH8A 5AMFA 4UYFA 4X2IA 3VKHA 4HXRA 5A5QA 4BW3A 5IGKA 5L8TA 1EQFA 4IOOA 5F1HA 4QYLA 5I80A 2OO1A 3FKMX 4MEQA 5HFQA 4QR5A 4BW4A 3QZSA 5FE6A 5HQ5A 4YYJA 5FFYA 3O37A 5KU3A 4O78A 4QB3A 4O76A 5E9LA 5G4RA 3U5MA 5DFBA 5E73A 5A85A 5EISA 5KHMA 5F36A 5CUGA 4MR4A 5E7DA 4NRCA 3MB4A 2I7KA 3JVKA 4YATA 4MEPA 1ZKRA 5HRVA 4GPJA 4IR4A 5ENHA 4TZ2A 3SVFA 3IU6A 4LRGA 5EPBA 4ZW1A 4OGIA 5CQAA 4CFLA 5IG6A 4IR3A 5LKUA 3D1DA 4MENA 1X0JA 4NQNA 5H1UA 4QY4A 4CFKA 5DKDA 4WHUA 2DVQA 5L99A 5ACYA 5LVRA 4A9IA 3HMHA 5ENIA 5K29A 4E96A 4ALGA 2YDWA 2YW5A 5LJ1A 5D3RA 5DBMA 4A9KA 4O7BA 5FBXA 5DYAA 4QSQA 2WP1A 2EJNA 5EICA 1WUGA 4NYVA 5FE1A 5II1A 2WP2A 4NXJA 2RFJA 3GG3A 4O74A 5EU1A 5IGNA 4QR4A 4LZRA 5I89A 5EP7A 4WIVA 5A83A 5I7YA 5DKCA 5DY7A 3UW9A 4YYIA 2OSSA 4QR3A 4TU6A 3U5OA 2YEMA 4CUTA 2DVRA 1JSPB 5HJCA 3P1DA 4UIWA 4AKHA 5E9MA 5CQ7A 2H60A 5EWDA 2DKWA 5L98A 5C7NA 3S92A 4YBSA 3MB3A 5FG4A 5I29A 5DX4A 3LQHA 3P1CA 5DFCA 5KTWA 1JM4B 5CP5A 4O7EA 4A9MA 4IR6A 4O71A 4J0RA 4QBMA 4HXLA 5KO4A 4YY6A 2LSPB 5D26A 4KV4A 4O72A 5DYCA 4DONA 2MJVB 5TCMA 5G4SA 2RO1A 4UYEA 5C4QA 3AADA 3MXFA 4BW1A 4AI6A 3MULA 5EGUA 2DVSA 5ETDA 3HMFA 3ERRA 5CUEA 4QSVA 4MR3A 5A7CA 5CQ6A 2KTBB 4LYWA 4UYGA 5F2PA 5FDZA 4QNSA 4UIXA 5A5NA 4HBYA 2I8NA 4MEOA 4NUEA 5EQ1A 2YQDA 5EWHA 2RI7A 5HELA 4F3IA 3O36A 5FFWA 5TB6A 2YYNA 5A82A 3U5KA 5CUCA 4YC9A 3NXBA 4Z93A 4NUCA 5J0DA 5IBNA 4LZSA 5EWWA 5D25A 5H85A 4ZC9A 4O75A 4YADA 4QSSA 5EV9A 5FG5A 5D24A 3DWYA 4HXPA 5CU8A 1E6IA 4C67A 4NR8A 4LYIA 5F63A 5I1QA 5H1TA 4NR5A 2E7NA 5HRXA 2E3KA 4HXKA 3JVMA 2D82A 4UYFB 4N4GA 3IU5A 5CFWA 4QSPA 4QC3A 4J1PA
chains in the Genus database with same CATH topology
4NR7A 4NUDA 4NRAA 5L97A 2FSAA 2R10A 4HXSA 2D9EA 3U5JA 5LJ2A 4O7CA 2YEKA 5D3TA 4LYSA 1F68A 4N4IA 4HBVA 4YH3A 5DLXA 5LKZA 4NS5A 3QZVA 3LJWA 3LXJA 5EK9A 4J0SA 4QUTA 3UVDA 5A81A 5KTXA 5A5RA 4BHWA 5HM0A 5D3PA 4YYDA 5F61A 5ENCA 5CRMA 2R0VA 5E74A 5AMEA 4O77A 5DLZA 4XYAA 3UVXA 3P1EA 5E0RA 4UIUA 1WUMA 5DYXA 5CQ5A 4A9OA 5CZGA 3G0JA 4QZSA 4NR9A 4NRBA 5DW2A 4A9EA 5LKTA 2RNXA 4ALHA 4TYLA 5JI8A 4CLBA 4A9JA 3UVWA 4YYNA 3Q2EA 3LQIA 5EA1A 2RS9B 5FFVA 5I7XA 5A5OA 4Q0NA 4IOQA 5EVAA 4YBTA 5II2A 3TLPA 4N3WA 2DVVA 4LR6A 3ZYUA 5D3HA 5D3NA 3UVYA 5CY9A 5FE8A 4NQMA 5CQ3A 4OGJA 4O7FA 4WHWA 4KCXA 5FB1A 5IGMA 4HXMA 5CGPA 3SVGA 4BJXA 4XUBA 2RNWA 4XUAA 4QSRA 5BT5A 4CUSA 4TZ8A 4UYHA 5IIDA 5EPSA 3UV4A 5HLSA 4HBWA 4CURA 4TQNA 5F5ZA 3SVHA 3UV5A 5HQ7A 4TTEA 5IGLA 3MQMA 5A5SA 4Q0OA 5DKHA 4YYGA 3U5LA 2DWWA 3UV2A 5D3JA 3QZTA 5E3DA 2L5EA 4TS8A 3G0LA 2DATA 2GRCA 5E9VA 4LC2A 4YYKA 5ENJA 4TT4A 1ZS5A 1N72A 4MR5A 2R0SA 4LDFA 4QYDA 5EWVA 3I3JA 4NR6A 5ENGA 4PY6A 5HENA 4YH4A 4BW2A 3S91A 4UYDA 5CPEA 4A9LA 4UIVA 3HMEA 3P5OA 5ETBA 5FH6A 5FE9A 3D7CA 5HRWA 5CUBA 4A9HA 4QEVA 4QUUA 4IR5A 5E9IA 5BT4A 5CQTA 2N9GA 5COIA 5DFDA 2L84A 3JVJA 5L96A 5I40A 4CL9A 4NYWA 5FG6A 5KTUA 4N4HA 5I88A 5HEMA 4N4FA 4PCEA 3O35A 4QSWA 2L85A 3U5PA 5D7XA 2E7OA 5FE7A 3Q2FA 4IORA 4YYHA 4OUFA 4TT6A 4QC1A 5FE4A 5JWMA 4RVRA 2NXBA 3P1FA 5D3LA 5LJ0A 5D3SA 5FE0A 4QEUA 5CQ4A 4YYMA 4YAXA 4PTBA 4HXOA 5CS8A 4PKLA 4MR6A 2RNYA 4XY8A 4AKNA 5ENBA 5AD2A 2R0YA 3ONIA 5HCLA 4Y03A 4YY4A 4CUQA 5C8GA 5C89A 5F62A 4XY9A 4CUUA 4HBXA 4NR4A 4O70A 5CUDA 5AD3A 5LKXA 4UITA 4QSXA 4FLPA 3K2JA 5ENEA 5FE3A 4UIYA 5EM3A 5FB0A 5F25A 4ZQLA 5CTLA 4TT2A 3U5NA 5C85A 4NYXA 5CQ8A 5EPRA 5FH7A 5I86A 4HXNA 3DAIA 5CUAA 4C66A 4J3IA 4KV1A 2F6NA 2OUOA 5HFRA 4QSTA 4TU4A 4Z6IA 5F1LA 3MUKA 5L8UA 5E9KA 4A9NA 5LUUA 5E3GA 5LVQA 4PCIA 3AQAA 2YELA 5H1VA 5A5PA 5C87A 4YK0A 3O33A 5EWCA 4Z1SA 3O34A 5D0CA 3JVLA 5E9YA 3LQJA 5CRZA 5DW1A 5DYUA 5F60A 4QEWA 4UIZA 5ENFA 5FE5A 4O7AA 4YABA 4YBMA 4QSUA 5I83A 5FE2A 4LZ2A 5EI4A 5HQ6A 3RCWA 4A9FA 5F3AA 2F6JA 4Z6HA 5BT3A 2G4AA 4CUPA 4PS5A 4Z1QA 5FH8A 5AMFA 4UYFA 4X2IA 4HXRA 5A5QA 4BW3A 5IGKA 5L8TA 1EQFA 4IOOA 5F1HA 4QYLA 5I80A 2OO1A 3FKMX 4MEQA 5HFQA 4QR5A 4BW4A 3QZSA 5FE6A 5HQ5A 4YYJA 5FFYA 3O37A 5KU3A 4O78A 4QB3A 4O76A 5E9LA 5G4RA 3U5MA 5DFBA 5E73A 5A85A 5EISA 5KHMA 5F36A 5CUGA 4MR4A 5E7DA 4NRCA 3MB4A 2I7KA 3JVKA 4YATA 4MEPA 5HRVA 4GPJA 4IR4A 5ENHA 4TZ2A 3SVFA 3IU6A 4LRGA 5EPBA 4ZW1A 4OGIA 5CQAA 4CFLA 5IG6A 4IR3A 5LKUA 4MENA 1X0JA 4NQNA 5H1UA 4QY4A 4CFKA 5DKDA 4WHUA 2DVQA 5L99A 5ACYA 5LVRA 4A9IA 3HMHA 5ENIA 5K29A 4E96A 4ALGA 2YDWA 2YW5A 5LJ1A 5D3RA 5DBMA 4A9KA 4O7BA 5FBXA 5DYAA 4QSQA 2WP1A 5EICA 1WUGA 4NYVA 5FE1A 5II1A 2WP2A 4NXJA 2RFJA 3GG3A 4O74A 5EU1A 5IGNA 4QR4A 4LZRA 5I89A 5EP7A 4WIVA 5A83A 5I7YA 5DKCA 5DY7A 3UW9A 4YYIA 2OSSA 4QR3A 4TU6A 3U5OA 2YEMA 4CUTA 2DVRA 1JSPB 5HJCA 3P1DA 4UIWA 5E9MA 5CQ7A 2H60A 5EWDA 2DKWA 5L98A 5C7NA 3S92A 4YBSA 3MB3A 5FG4A 5I29A 5DX4A 3LQHA 3P1CA 5DFCA 5KTWA 1JM4B 5CP5A 4O7EA 4A9MA 4IR6A 4O71A 4J0RA 4QBMA 4HXLA 5KO4A 4YY6A 2LSPB 5D26A 4KV4A 4O72A 5DYCA 4DONA 2MJVB 5TCMA 5G4SA 2RO1A 4UYEA 5C4QA 3AADA 3MXFA 4BW1A 3MULA 5EGUA 2DVSA 5ETDA 3HMFA 5CUEA 4QSVA 4MR3A 5A7CA 5CQ6A 2KTBB 4LYWA 4UYGA 5F2PA 5FDZA 4QNSA 4UIXA 5A5NA 4HBYA 2I8NA 4MEOA 4NUEA 5EQ1A 2YQDA 5EWHA 2RI7A 5HELA 4F3IA 3O36A 5FFWA 5TB6A 2YYNA 5A82A 3U5KA 5CUCA 4YC9A 3NXBA 4Z93A 4NUCA 5J0DA 5IBNA 4LZSA 5EWWA 5D25A 5H85A 4ZC9A 4O75A 4YADA 4QSSA 5EV9A 5FG5A 5D24A 3DWYA 4HXPA 5CU8A 1E6IA 4C67A 4NR8A 4LYIA 5F63A 5I1QA 5H1TA 4NR5A 2E7NA 5HRXA 2E3KA 4HXKA 3JVMA 2D82A 4UYFB 4N4GA 3IU5A 5CFWA 4QSPA 4QC3A 4J1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR7 A;  4NUD A;  4NRA A;  5L97 A;  2FSA A;  2R10 A;  4HXS A;  2D9E A;  3U5J A;  5LJ2 A;  4O7C A;  2YEK A;  5D3T A;  4LYS A;  1F68 A;  4N4I A;  4HBV A;  4YH3 A;  5DLX A;  5LKZ A;  4NS5 A;  3QZV A;  3LJW A;  3LXJ A;  5EK9 A;  4J0S A;  4QUT A;  3UVD A;  5A81 A;  5KTX A;  5A5R A;  4BHW A;  5HM0 A;  5D3P A;  4YYD A;  5F61 A;  5ENC A;  5CRM A;  2R0V A;  5E74 A;  5AME A;  4O77 A;  5DLZ A;  4XYA A;  3UVX A;  3P1E A;  5E0R A;  4UIU A;  1WUM A;  5DYX A;  5CQ5 A;  4A9O A;  5CZG A;  3G0J A;  4QZS A;  4NR9 A;  4NRB A;  5DW2 A;  4A9E A;  5LKT A;  2RNX A;  4ALH A;  4TYL A;  5JI8 A;  4CLB A;  4A9J A;  3UVW A;  4YYN A;  3Q2E A;  3LQI A;  5EA1 A;  2RS9 B;  5FFV A;  5I7X A;  5A5O A;  4Q0N A;  4IOQ A;  5EVA A;  4YBT A;  5II2 A;  3TLP A;  4N3W A;  2DVV A;  4LR6 A;  3ZYU A;  5D3H A;  5D3N A;  3UVY A;  5CY9 A;  5FE8 A;  4NQM A;  5CQ3 A;  4OGJ A;  4O7F A;  4WHW A;  4KCX A;  5FB1 A;  5IGM A;  4HXM A;  5CGP A;  3SVG A;  4BJX A;  4XUB A;  2RNW A;  4XUA A;  4QSR A;  5BT5 A;  4CUS A;  4TZ8 A;  4UYH A;  5IID A;  5EPS A;  3UV4 A;  5HLS A;  4HBW A;  4CUR A;  4TQN A;  5F5Z A;  3SVH A;  3UV5 A;  5HQ7 A;  4TTE A;  5IGL A;  3MQM A;  5A5S A;  4Q0O A;  5DKH A;  4YYG A;  3U5L A;  2DWW A;  3UV2 A;  5D3J A;  3QZT A;  5E3D A;  2L5E A;  4TS8 A;  3G0L A;  2DAT A;  2GRC A;  5E9V A;  4LC2 A;  4YYK A;  5ENJ A;  4TT4 A;  1ZS5 A;  1N72 A;  4MR5 A;  2R0S A;  4LDF A;  4QYD A;  5EWV A;  3I3J A;  4NR6 A;  5ENG A;  4PY6 A;  5HEN A;  4YH4 A;  4BW2 A;  3S91 A;  4UYD A;  5CPE A;  4A9L A;  4UIV A;  3HME A;  3P5O A;  5ETB A;  5FH6 A;  5FE9 A;  3D7C A;  5HRW A;  5CUB A;  4A9H A;  4QEV A;  4QUU A;  4IR5 A;  5E9I A;  5BT4 A;  5CQT A;  2N9G A;  5COI A;  5DFD A;  2L84 A;  3JVJ A;  5L96 A;  5I40 A;  4CL9 A;  4NYW A;  5FG6 A;  5KTU A;  4N4H A;  5I88 A;  5HEM A;  4N4F A;  4PCE A;  3O35 A;  4QSW A;  2L85 A;  3U5P A;  5D7X A;  2E7O A;  5FE7 A;  3Q2F A;  4IOR A;  4YYH A;  4OUF A;  4TT6 A;  4QC1 A;  5FE4 A;  5JWM A;  4RVR A;  2NXB A;  3P1F A;  5D3L A;  5LJ0 A;  5D3S A;  5FE0 A;  4QEU A;  5CQ4 A;  4YYM A;  4YAX A;  4PTB A;  4HXO A;  5CS8 A;  4PKL A;  4MR6 A;  2RNY A;  4XY8 A;  4AKN A;  5ENB A;  5AD2 A;  2R0Y A;  3ONI A;  5HCL A;  4Y03 A;  4YY4 A;  4CUQ A;  5C8G A;  5C89 A;  5F62 A;  4XY9 A;  4CUU A;  4HBX A;  4NR4 A;  4O70 A;  5CUD A;  5AD3 A;  5LKX A;  4UIT A;  4QSX A;  4FLP A;  3K2J A;  5ENE A;  5FE3 A;  4UIY A;  5EM3 A;  5FB0 A;  5F25 A;  4ZQL A;  5CTL A;  4TT2 A;  3U5N A;  5C85 A;  4NYX A;  5CQ8 A;  5EPR A;  5FH7 A;  5I86 A;  4HXN A;  3DAI A;  5CUA A;  4C66 A;  4J3I A;  4KV1 A;  2F6N A;  2OUO A;  5HFR A;  4QST A;  4TU4 A;  4Z6I A;  5F1L A;  3MUK A;  5L8U A;  5E9K A;  4A9N A;  5LUU A;  5E3G A;  5LVQ A;  4PCI A;  3AQA A;  2YEL A;  5H1V A;  5A5P A;  5C87 A;  4YK0 A;  3O33 A;  5EWC A;  4Z1S A;  3O34 A;  5D0C A;  3JVL A;  5E9Y A;  3LQJ A;  5CRZ A;  5DW1 A;  5DYU A;  5F60 A;  4QEW A;  4UIZ A;  5ENF A;  5FE5 A;  4O7A A;  4YAB A;  4YBM A;  4QSU A;  5I83 A;  5FE2 A;  4LZ2 A;  5EI4 A;  5HQ6 A;  3RCW A;  4A9F A;  5F3A A;  2F6J A;  4Z6H A;  5BT3 A;  2G4A A;  4CUP A;  4PS5 A;  4Z1Q A;  5FH8 A;  5AMF A;  4UYF A;  4X2I A;  4HXR A;  5A5Q A;  4BW3 A;  5IGK A;  5L8T A;  1EQF A;  4IOO A;  5F1H A;  4QYL A;  5I80 A;  2OO1 A;  3FKM X;  4MEQ A;  5HFQ A;  4QR5 A;  4BW4 A;  3QZS A;  5FE6 A;  5HQ5 A;  4YYJ A;  5FFY A;  3O37 A;  5KU3 A;  4O78 A;  4QB3 A;  4O76 A;  5E9L A;  5G4R A;  3U5M A;  5DFB A;  5E73 A;  5A85 A;  5EIS A;  5KHM A;  5F36 A;  5CUG A;  4MR4 A;  5E7D A;  4NRC A;  3MB4 A;  2I7K A;  3JVK A;  4YAT A;  4MEP A;  5HRV A;  4GPJ A;  4IR4 A;  5ENH A;  4TZ2 A;  3SVF A;  3IU6 A;  4LRG A;  5EPB A;  4ZW1 A;  4OGI A;  5CQA A;  4CFL A;  5IG6 A;  4IR3 A;  5LKU A;  4MEN A;  1X0J A;  4NQN A;  5H1U A;  4QY4 A;  4CFK A;  5DKD A;  4WHU A;  2DVQ A;  5L99 A;  5ACY A;  5LVR A;  4A9I A;  3HMH A;  5ENI A;  5K29 A;  4E96 A;  4ALG A;  2YDW A;  2YW5 A;  5LJ1 A;  5D3R A;  5DBM A;  4A9K A;  4O7B A;  5FBX A;  5DYA A;  4QSQ A;  2WP1 A;  5EIC A;  1WUG A;  4NYV A;  5FE1 A;  5II1 A;  2WP2 A;  4NXJ A;  2RFJ A;  3GG3 A;  4O74 A;  5EU1 A;  5IGN A;  4QR4 A;  4LZR A;  5I89 A;  5EP7 A;  4WIV A;  5A83 A;  5I7Y A;  5DKC A;  5DY7 A;  3UW9 A;  4YYI A;  2OSS A;  4QR3 A;  4TU6 A;  3U5O A;  2YEM A;  4CUT A;  2DVR A;  1JSP B;  5HJC A;  3P1D A;  4UIW A;  5E9M A;  5CQ7 A;  2H60 A;  5EWD A;  2DKW A;  5L98 A;  5C7N A;  3S92 A;  4YBS A;  3MB3 A;  5FG4 A;  5I29 A;  5DX4 A;  3LQH A;  3P1C A;  5DFC A;  5KTW A;  1JM4 B;  5CP5 A;  4O7E A;  4A9M A;  4IR6 A;  4O71 A;  4J0R A;  4QBM A;  4HXL A;  5KO4 A;  4YY6 A;  2LSP B;  5D26 A;  4KV4 A;  4O72 A;  5DYC A;  4DON A;  2MJV B;  5TCM A;  5G4S A;  2RO1 A;  4UYE A;  5C4Q A;  3AAD A;  3MXF A;  4BW1 A;  3MUL A;  5EGU A;  2DVS A;  5ETD A;  3HMF A;  5CUE A;  4QSV A;  4MR3 A;  5A7C A;  5CQ6 A;  2KTB B;  4LYW A;  4UYG A;  5F2P A;  5FDZ A;  4QNS A;  4UIX A;  5A5N A;  4HBY A;  2I8N A;  4MEO A;  4NUE A;  5EQ1 A;  2YQD A;  5EWH A;  2RI7 A;  5HEL A;  4F3I A;  3O36 A;  5FFW A;  5TB6 A;  2YYN A;  5A82 A;  3U5K A;  5CUC A;  4YC9 A;  3NXB A;  4Z93 A;  4NUC A;  5J0D A;  5IBN A;  4LZS A;  5EWW A;  5D25 A;  5H85 A;  4ZC9 A;  4O75 A;  4YAD A;  4QSS A;  5EV9 A;  5FG5 A;  5D24 A;  3DWY A;  4HXP A;  5CU8 A;  1E6I A;  4C67 A;  4NR8 A;  4LYI A;  5F63 A;  5I1Q A;  5H1T A;  4NR5 A;  2E7N A;  5HRX A;  2E3K A;  4HXK A;  3JVM A;  2D82 A;  4UYF B;  4N4G A;  3IU5 A;  5CFW A;  4QSP A;  4QC3 A;  4J1P A; 
#chains in the Genus database with same CATH topology
 4NR7 A;  4NUD A;  4NRA A;  5L97 A;  2FSA A;  2R10 A;  4HXS A;  2D9E A;  3U5J A;  5LJ2 A;  4AKG A;  4O7C A;  2YEK A;  5D3T A;  4LYS A;  1F68 A;  4N4I A;  4HBV A;  4YH3 A;  5DLX A;  5LKZ A;  4NS5 A;  3QZV A;  3LJW A;  3LXJ A;  5EK9 A;  4J0S A;  4QUT A;  3UVD A;  5A81 A;  5KTX A;  5A5R A;  4BHW A;  5HM0 A;  5D3P A;  4YYD A;  5F61 A;  5ENC A;  5CRM A;  2R0V A;  5E74 A;  5AME A;  4O77 A;  5DLZ A;  4XYA A;  3UVX A;  3P1E A;  5E0R A;  4UIU A;  1WUM A;  5DYX A;  5CQ5 A;  4A9O A;  5CZG A;  3G0J A;  4QZS A;  4NR9 A;  4NRB A;  5DW2 A;  4A9E A;  5LKT A;  2RNX A;  4ALH A;  4TYL A;  5JI8 A;  4CLB A;  4A9J A;  3UVW A;  4YYN A;  3Q2E A;  3LQI A;  5EA1 A;  2RS9 B;  5FFV A;  5I7X A;  5A5O A;  4Q0N A;  4IOQ A;  5EVA A;  4YBT A;  5II2 A;  3TLP A;  4N3W A;  2DVV A;  4LR6 A;  3ZYU A;  5D3H A;  5D3N A;  3UVY A;  5CY9 A;  5FE8 A;  4NQM A;  5CQ3 A;  4OGJ A;  4O7F A;  4WHW A;  4KCX A;  5FB1 A;  5IGM A;  4HXM A;  5CGP A;  3SVG A;  4BJX A;  4XUB A;  2RNW A;  4XUA A;  4QSR A;  5BT5 A;  4CUS A;  4TZ8 A;  4UYH A;  5IID A;  5EPS A;  3UV4 A;  5HLS A;  4HBW A;  4CUR A;  4TQN A;  5F5Z A;  3SVH A;  3UV5 A;  3D1B A;  5HQ7 A;  4TTE A;  5IGL A;  3MQM A;  5A5S A;  4Q0O A;  5DKH A;  4YYG A;  4AKI A;  3U5L A;  2DWW A;  3UV2 A;  5D3J A;  3QZT A;  5E3D A;  2L5E A;  4TS8 A;  3G0L A;  2DAT A;  2GRC A;  5E9V A;  4LC2 A;  4YYK A;  5ENJ A;  4TT4 A;  1ZS5 A;  1N72 A;  4MR5 A;  2R0S A;  4LDF A;  4QYD A;  5EWV A;  3I3J A;  4NR6 A;  5ENG A;  4PY6 A;  5HEN A;  4YH4 A;  4BW2 A;  3S91 A;  4UYD A;  1PUO A;  5CPE A;  4A9L A;  4UIV A;  3HME A;  3P5O A;  5ETB A;  5FH6 A;  5FE9 A;  3D7C A;  5HRW A;  5CUB A;  4A9H A;  4QEV A;  4QUU A;  4IR5 A;  5E9I A;  5BT4 A;  5CQT A;  2N9G A;  5COI A;  5DFD A;  2L84 A;  3JVJ A;  5L96 A;  5I40 A;  4CL9 A;  4NYW A;  5FG6 A;  5KTU A;  4N4H A;  5I88 A;  5HEM A;  4N4F A;  4PCE A;  3O35 A;  4QSW A;  2L85 A;  3U5P A;  5D7X A;  2E7O A;  5FE7 A;  3Q2F A;  4IOR A;  4YYH A;  4OUF A;  4TT6 A;  4QC1 A;  5FE4 A;  5JWM A;  4RVR A;  2NXB A;  3P1F A;  5D3L A;  5LJ0 A;  5D3S A;  5FE0 A;  4QEU A;  5CQ4 A;  4YYM A;  4YAX A;  4PTB A;  4HXO A;  5CS8 A;  4PKL A;  4MR6 A;  2RNY A;  4XY8 A;  4AKN A;  5ENB A;  5AD2 A;  2R0Y A;  3ONI A;  5HCL A;  4Y03 A;  4YY4 A;  4CUQ A;  5C8G A;  5C89 A;  5F62 A;  4XY9 A;  4CUU A;  4HBX A;  4NR4 A;  4O70 A;  3VKG A;  5CUD A;  5AD3 A;  5LKX A;  4UIT A;  4QSX A;  4FLP A;  3K2J A;  5ENE A;  5FE3 A;  4UIY A;  5EM3 A;  5FB0 A;  5F25 A;  4ZQL A;  5CTL A;  4TT2 A;  3U5N A;  5C85 A;  4NYX A;  5CQ8 A;  5EPR A;  5FH7 A;  5I86 A;  4HXN A;  3DAI A;  5CUA A;  4C66 A;  4J3I A;  4KV1 A;  2F6N A;  2OUO A;  5HFR A;  4QST A;  4TU4 A;  4Z6I A;  5F1L A;  3MUK A;  5L8U A;  5E9K A;  4A9N A;  5LUU A;  5E3G A;  5LVQ A;  4PCI A;  3AQA A;  2YEL A;  5H1V A;  5A5P A;  5C87 A;  4YK0 A;  3O33 A;  5EWC A;  4Z1S A;  3O34 A;  5D0C A;  3JVL A;  5E9Y A;  3LQJ A;  5CRZ A;  5DW1 A;  5DYU A;  5F60 A;  4QEW A;  4UIZ A;  5ENF A;  5FE5 A;  4O7A A;  4YAB A;  4YBM A;  4QSU A;  5I83 A;  5FE2 A;  4LZ2 A;  5EI4 A;  5HQ6 A;  3RCW A;  4A9F A;  5F3A A;  2F6J A;  4Z6H A;  5BT3 A;  2G4A A;  4CUP A;  4PS5 A;  4Z1Q A;  5FH8 A;  5AMF A;  4UYF A;  4X2I A;  3VKH A;  4HXR A;  5A5Q A;  4BW3 A;  5IGK A;  5L8T A;  1EQF A;  4IOO A;  5F1H A;  4QYL A;  5I80 A;  2OO1 A;  3FKM X;  4MEQ A;  5HFQ A;  4QR5 A;  4BW4 A;  3QZS A;  5FE6 A;  5HQ5 A;  4YYJ A;  5FFY A;  3O37 A;  5KU3 A;  4O78 A;  4QB3 A;  4O76 A;  5E9L A;  5G4R A;  3U5M A;  5DFB A;  5E73 A;  5A85 A;  5EIS A;  5KHM A;  5F36 A;  5CUG A;  4MR4 A;  5E7D A;  4NRC A;  3MB4 A;  2I7K A;  3JVK A;  4YAT A;  4MEP A;  1ZKR A;  5HRV A;  4GPJ A;  4IR4 A;  5ENH A;  4TZ2 A;  3SVF A;  3IU6 A;  4LRG A;  5EPB A;  4ZW1 A;  4OGI A;  5CQA A;  4CFL A;  5IG6 A;  4IR3 A;  5LKU A;  3D1D A;  4MEN A;  1X0J A;  4NQN A;  5H1U A;  4QY4 A;  4CFK A;  5DKD A;  4WHU A;  2DVQ A;  5L99 A;  5ACY A;  5LVR A;  4A9I A;  3HMH A;  5ENI A;  5K29 A;  4E96 A;  4ALG A;  2YDW A;  2YW5 A;  5LJ1 A;  5D3R A;  5DBM A;  4A9K A;  4O7B A;  5FBX A;  5DYA A;  4QSQ A;  2WP1 A;  2EJN A;  5EIC A;  1WUG A;  4NYV A;  5FE1 A;  5II1 A;  2WP2 A;  4NXJ A;  2RFJ A;  3GG3 A;  4O74 A;  5EU1 A;  5IGN A;  4QR4 A;  4LZR A;  5I89 A;  5EP7 A;  4WIV A;  5A83 A;  5I7Y A;  5DKC A;  5DY7 A;  3UW9 A;  4YYI A;  2OSS A;  4QR3 A;  4TU6 A;  3U5O A;  2YEM A;  4CUT A;  2DVR A;  1JSP B;  5HJC A;  3P1D A;  4UIW A;  4AKH A;  5E9M A;  5CQ7 A;  2H60 A;  5EWD A;  2DKW A;  5L98 A;  5C7N A;  3S92 A;  4YBS A;  3MB3 A;  5FG4 A;  5I29 A;  5DX4 A;  3LQH A;  3P1C A;  5DFC A;  5KTW A;  1JM4 B;  5CP5 A;  4O7E A;  4A9M A;  4IR6 A;  4O71 A;  4J0R A;  4QBM A;  4HXL A;  5KO4 A;  4YY6 A;  2LSP B;  5D26 A;  4KV4 A;  4O72 A;  5DYC A;  4DON A;  2MJV B;  5TCM A;  5G4S A;  2RO1 A;  4UYE A;  5C4Q A;  3AAD A;  3MXF A;  4BW1 A;  4AI6 A;  3MUL A;  5EGU A;  2DVS A;  5ETD A;  3HMF A;  3ERR A;  5CUE A;  4QSV A;  4MR3 A;  5A7C A;  5CQ6 A;  2KTB B;  4LYW A;  4UYG A;  5F2P A;  5FDZ A;  4QNS A;  4UIX A;  5A5N A;  4HBY A;  2I8N A;  4MEO A;  4NUE A;  5EQ1 A;  2YQD A;  5EWH A;  2RI7 A;  5HEL A;  4F3I A;  3O36 A;  5FFW A;  5TB6 A;  2YYN A;  5A82 A;  3U5K A;  5CUC A;  4YC9 A;  3NXB A;  4Z93 A;  4NUC A;  5J0D A;  5IBN A;  4LZS A;  5EWW A;  5D25 A;  5H85 A;  4ZC9 A;  4O75 A;  4YAD A;  4QSS A;  5EV9 A;  5FG5 A;  5D24 A;  3DWY A;  4HXP A;  5CU8 A;  1E6I A;  4C67 A;  4NR8 A;  4LYI A;  5F63 A;  5I1Q A;  5H1T A;  4NR5 A;  2E7N A;  5HRX A;  2E3K A;  4HXK A;  3JVM A;  2D82 A;  4UYF B;  4N4G A;  3IU5 A;  5CFW A;  4QSP A;  4QC3 A;  4J1P A; 
#chains in the Genus database with same CATH homology
 4NR7 A;  4NUD A;  4NRA A;  5L97 A;  2FSA A;  2R10 A;  4HXS A;  2D9E A;  3U5J A;  5LJ2 A;  4O7C A;  2YEK A;  5D3T A;  4LYS A;  1F68 A;  4N4I A;  4HBV A;  4YH3 A;  5DLX A;  5LKZ A;  4NS5 A;  3QZV A;  3LJW A;  3LXJ A;  5EK9 A;  4J0S A;  4QUT A;  3UVD A;  5A81 A;  5KTX A;  5A5R A;  4BHW A;  5HM0 A;  5D3P A;  4YYD A;  5F61 A;  5ENC A;  5CRM A;  2R0V A;  5E74 A;  5AME A;  4O77 A;  5DLZ A;  4XYA A;  3UVX A;  3P1E A;  5E0R A;  4UIU A;  1WUM A;  5DYX A;  5CQ5 A;  4A9O A;  5CZG A;  3G0J A;  4QZS A;  4NR9 A;  4NRB A;  5DW2 A;  4A9E A;  5LKT A;  2RNX A;  4ALH A;  4TYL A;  5JI8 A;  4CLB A;  4A9J A;  3UVW A;  4YYN A;  3Q2E A;  3LQI A;  5EA1 A;  2RS9 B;  5FFV A;  5I7X A;  5A5O A;  4Q0N A;  4IOQ A;  5EVA A;  4YBT A;  5II2 A;  3TLP A;  4N3W A;  2DVV A;  4LR6 A;  3ZYU A;  5D3H A;  5D3N A;  3UVY A;  5CY9 A;  5FE8 A;  4NQM A;  5CQ3 A;  4OGJ A;  4O7F A;  4WHW A;  4KCX A;  5FB1 A;  5IGM A;  4HXM A;  5CGP A;  3SVG A;  4BJX A;  4XUB A;  2RNW A;  4XUA A;  4QSR A;  5BT5 A;  4CUS A;  4TZ8 A;  4UYH A;  5IID A;  5EPS A;  3UV4 A;  5HLS A;  4HBW A;  4CUR A;  4TQN A;  5F5Z A;  3SVH A;  3UV5 A;  5HQ7 A;  4TTE A;  5IGL A;  3MQM A;  5A5S A;  4Q0O A;  5DKH A;  4YYG A;  3U5L A;  2DWW A;  3UV2 A;  5D3J A;  3QZT A;  5E3D A;  2L5E A;  4TS8 A;  3G0L A;  2DAT A;  2GRC A;  5E9V A;  4LC2 A;  4YYK A;  5ENJ A;  4TT4 A;  1ZS5 A;  1N72 A;  4MR5 A;  2R0S A;  4LDF A;  4QYD A;  5EWV A;  3I3J A;  4NR6 A;  5ENG A;  4PY6 A;  5HEN A;  4YH4 A;  4BW2 A;  3S91 A;  4UYD A;  5CPE A;  4A9L A;  4UIV A;  3HME A;  3P5O A;  5ETB A;  5FH6 A;  5FE9 A;  3D7C A;  5HRW A;  5CUB A;  4A9H A;  4QEV A;  4QUU A;  4IR5 A;  5E9I A;  5BT4 A;  5CQT A;  2N9G A;  5COI A;  5DFD A;  2L84 A;  3JVJ A;  5L96 A;  5I40 A;  4CL9 A;  4NYW A;  5FG6 A;  5KTU A;  4N4H A;  5I88 A;  5HEM A;  4N4F A;  4PCE A;  3O35 A;  4QSW A;  2L85 A;  3U5P A;  5D7X A;  2E7O A;  5FE7 A;  3Q2F A;  4IOR A;  4YYH A;  4OUF A;  4TT6 A;  4QC1 A;  5FE4 A;  5JWM A;  4RVR A;  2NXB A;  3P1F A;  5D3L A;  5LJ0 A;  5D3S A;  5FE0 A;  4QEU A;  5CQ4 A;  4YYM A;  4YAX A;  4PTB A;  4HXO A;  5CS8 A;  4PKL A;  4MR6 A;  2RNY A;  4XY8 A;  4AKN A;  5ENB A;  5AD2 A;  2R0Y A;  3ONI A;  5HCL A;  4Y03 A;  4YY4 A;  4CUQ A;  5C8G A;  5C89 A;  5F62 A;  4XY9 A;  4CUU A;  4HBX A;  4NR4 A;  4O70 A;  5CUD A;  5AD3 A;  5LKX A;  4UIT A;  4QSX A;  4FLP A;  3K2J A;  5ENE A;  5FE3 A;  4UIY A;  5EM3 A;  5FB0 A;  5F25 A;  4ZQL A;  5CTL A;  4TT2 A;  3U5N A;  5C85 A;  4NYX A;  5CQ8 A;  5EPR A;  5FH7 A;  5I86 A;  4HXN A;  3DAI A;  5CUA A;  4C66 A;  4J3I A;  4KV1 A;  2F6N A;  2OUO A;  5HFR A;  4QST A;  4TU4 A;  4Z6I A;  5F1L A;  3MUK A;  5L8U A;  5E9K A;  4A9N A;  5LUU A;  5E3G A;  5LVQ A;  4PCI A;  3AQA A;  2YEL A;  5H1V A;  5A5P A;  5C87 A;  4YK0 A;  3O33 A;  5EWC A;  4Z1S A;  3O34 A;  5D0C A;  3JVL A;  5E9Y A;  3LQJ A;  5CRZ A;  5DW1 A;  5DYU A;  5F60 A;  4QEW A;  4UIZ A;  5ENF A;  5FE5 A;  4O7A A;  4YAB A;  4YBM A;  4QSU A;  5I83 A;  5FE2 A;  4LZ2 A;  5EI4 A;  5HQ6 A;  3RCW A;  4A9F A;  5F3A A;  2F6J A;  4Z6H A;  5BT3 A;  2G4A A;  4CUP A;  4PS5 A;  4Z1Q A;  5FH8 A;  5AMF A;  4UYF A;  4X2I A;  4HXR A;  5A5Q A;  4BW3 A;  5IGK A;  5L8T A;  1EQF A;  4IOO A;  5F1H A;  4QYL A;  5I80 A;  2OO1 A;  3FKM X;  4MEQ A;  5HFQ A;  4QR5 A;  4BW4 A;  3QZS A;  5FE6 A;  5HQ5 A;  4YYJ A;  5FFY A;  3O37 A;  5KU3 A;  4O78 A;  4QB3 A;  4O76 A;  5E9L A;  5G4R A;  3U5M A;  5DFB A;  5E73 A;  5A85 A;  5EIS A;  5KHM A;  5F36 A;  5CUG A;  4MR4 A;  5E7D A;  4NRC A;  3MB4 A;  2I7K A;  3JVK A;  4YAT A;  4MEP A;  5HRV A;  4GPJ A;  4IR4 A;  5ENH A;  4TZ2 A;  3SVF A;  3IU6 A;  4LRG A;  5EPB A;  4ZW1 A;  4OGI A;  5CQA A;  4CFL A;  5IG6 A;  4IR3 A;  5LKU A;  4MEN A;  1X0J A;  4NQN A;  5H1U A;  4QY4 A;  4CFK A;  5DKD A;  4WHU A;  2DVQ A;  5L99 A;  5ACY A;  5LVR A;  4A9I A;  3HMH A;  5ENI A;  5K29 A;  4E96 A;  4ALG A;  2YDW A;  2YW5 A;  5LJ1 A;  5D3R A;  5DBM A;  4A9K A;  4O7B A;  5FBX A;  5DYA A;  4QSQ A;  2WP1 A;  5EIC A;  1WUG A;  4NYV A;  5FE1 A;  5II1 A;  2WP2 A;  4NXJ A;  2RFJ A;  3GG3 A;  4O74 A;  5EU1 A;  5IGN A;  4QR4 A;  4LZR A;  5I89 A;  5EP7 A;  4WIV A;  5A83 A;  5I7Y A;  5DKC A;  5DY7 A;  3UW9 A;  4YYI A;  2OSS A;  4QR3 A;  4TU6 A;  3U5O A;  2YEM A;  4CUT A;  2DVR A;  1JSP B;  5HJC A;  3P1D A;  4UIW A;  5E9M A;  5CQ7 A;  2H60 A;  5EWD A;  2DKW A;  5L98 A;  5C7N A;  3S92 A;  4YBS A;  3MB3 A;  5FG4 A;  5I29 A;  5DX4 A;  3LQH A;  3P1C A;  5DFC A;  5KTW A;  1JM4 B;  5CP5 A;  4O7E A;  4A9M A;  4IR6 A;  4O71 A;  4J0R A;  4QBM A;  4HXL A;  5KO4 A;  4YY6 A;  2LSP B;  5D26 A;  4KV4 A;  4O72 A;  5DYC A;  4DON A;  2MJV B;  5TCM A;  5G4S A;  2RO1 A;  4UYE A;  5C4Q A;  3AAD A;  3MXF A;  4BW1 A;  3MUL A;  5EGU A;  2DVS A;  5ETD A;  3HMF A;  5CUE A;  4QSV A;  4MR3 A;  5A7C A;  5CQ6 A;  2KTB B;  4LYW A;  4UYG A;  5F2P A;  5FDZ A;  4QNS A;  4UIX A;  5A5N A;  4HBY A;  2I8N A;  4MEO A;  4NUE A;  5EQ1 A;  2YQD A;  5EWH A;  2RI7 A;  5HEL A;  4F3I A;  3O36 A;  5FFW A;  5TB6 A;  2YYN A;  5A82 A;  3U5K A;  5CUC A;  4YC9 A;  3NXB A;  4Z93 A;  4NUC A;  5J0D A;  5IBN A;  4LZS A;  5EWW A;  5D25 A;  5H85 A;  4ZC9 A;  4O75 A;  4YAD A;  4QSS A;  5EV9 A;  5FG5 A;  5D24 A;  3DWY A;  4HXP A;  5CU8 A;  1E6I A;  4C67 A;  4NR8 A;  4LYI A;  5F63 A;  5I1Q A;  5H1T A;  4NR5 A;  2E7N A;  5HRX A;  2E3K A;  4HXK A;  3JVM A;  2D82 A;  4UYF B;  4N4G A;  3IU5 A;  5CFW A;  4QSP A;  4QC3 A;  4J1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...