2DKWA

Solution structure of the bromodomain of human protein kiaa1240
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
GSSGSSGNTLRELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords hypothetical protein KIAA1240
publication title Solution structure of the bromodomain of human protein KIAA1240
rcsb
source organism Homo sapiens
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dkwA00
5A5SA 5BT5A 4UIZA 5CUAA 4J0RA 3HMHA 5FE2A 4O75A 2H60A 2N9GA 4HXKA 4QEUA 4QSPA 4HBYA 4IOOA 5LKXA 4MR6A 2NXBA 4LYIA 5I7XA 2YYNA 4HBWA 4UITA 3FKMX 3IU5A 4WHWA 5CUGA 5F60A 2E7OA 4NR5A 3P1FA 4MEPA 2DVVA 4C67A 5L8UA 5FH8A 5DYUA 5F62A 4BJXA 4QY4A 5HENA 5LKUA 3S91A 3JVKA 4O7FA 4YYDA 3MB4A 4J3IA 3SVHA 4LZRA 4KV1A 4DONA 4QC3A 4A9NA 4RVRA 3MB3A 3UV4A 5F5ZA 5II1A 4UYGA 4YYGA 5KHMA 5CP5A 5CUEA 4TYLA 5FE9A 4YH3A 4OGIA 2G4AA 3MXFA 4QYDA 5CRZA 5TCMA 5EWDA 4ALGA 5E73A 3GG3A 3JVMA 5CRMA 4UIUA 5KTUA 2RNYA 4WIVA 4QSXA 5EICA 4CUTA 5EVAA 4NXJA 4QSSA 4UIYA 4UYFB 5IG6A 2RS9B 4YY6A 5HFQA 5BT3A 5COIA 5E3DA 5HRWA 4N4IA 5EPRA 5IIDA 4MR3A 4BW4A 4NQMA 5CZGA 5DY7A 4YAXA 5D7XA 3LJWA 5E7DA 4UYHA 5CQ3A 1JM4B 4QR5A 5C89A 4QSQA 4HXNA 3LQHA 5AD2A 4CUUA 5A85A 5F36A 3QZVA 4MR4A 5EWWA 3I3JA 5H85A 3NXBA 4TZ8A 4LRGA 5E9KA 3U5NA 4HBVA 5IBNA 5D26A 3S92A 5LKTA 4UYDA 5TB6A 4A9FA 5HCLA 4O77A 3LQIA 2F6JA 2F6NA 4MR5A 4A9JA 5KU3A 1X0JA 4NYVA 4IOQA 3SVFA 4O7BA 5L99A 3P5OA 3D7CA 4BW1A 4YYKA 3Q2FA 3U5LA 4UYEA 2DKWA 5DBMA 4UIXA 4LC2A 5E0RA 3U5OA 1N72A 3QZTA 5FB0A 5C7NA 5FH6A 4QSWA 5FE6A 5A7CA 4UIWA 4LYWA 5I1QA 5CQAA 2R0YA 1F68A 3DAIA 5L96A 4NRCA 5DW2A 5EA1A 4NUDA 4LZ2A 4A9EA 4XYAA 1EQFA 5IGMA 4QUUA 3DWYA 3LQJA 5KTWA 3MQMA 4QYLA 5DLXA 2RFJA 5JI8A 5G4SA 3QZSA 5A5RA 4MEQA 5C85A 5EPSA 5EISA 4YATA 3K2JA 4YH4A 3UW9A 2YEMA 2WP2A 4C66A 4LYSA 4PCEA 4Y03A 5CQTA 5FDZA 4TS8A 4ZC9A 4CL9A 2OSSA 5HJCA 5HQ5A 2DVQA 5AMEA 4QZSA 4FLPA 2E7NA 5HEMA 3TLPA 5HFRA 4TT4A 4PS5A 5CGPA 4NRAA 4NR7A 3UV2A 2OUOA 3HMEA 2R0VA 5CQ6A 4QB3A 4YY4A 5EWVA 5G4RA 4YBMA 4HBXA 2L85A 4PY6A 4YADA 5IGLA 5DYCA 5E9IA 5D3PA 4ZW1A 5I86A 5FE7A 4BW2A 2RNWA 4NRBA 4O7CA 5JWMA 4YYMA 4YYIA 1E6IA 5EM3A 4CUSA 4HXOA 4NR8A 2OO1A 4HXRA 5IGKA 3HMFA 5EI4A 4Q0OA 5EP7A 3ONIA 4LR6A 4NR6A 4N4GA 4A9OA 4IORA 3UVXA 4BHWA 5HRVA 5CY9A 3UV5A 5A81A 5H1TA 5F63A 4QEWA 5ENCA 2YW5A 4PCIA 2MJVB 2RNXA 5E9VA 5ETBA 4PTBA 5FE0A 5FFVA 5FH7A 4QUTA 5L98A 4WHUA 4TTEA 4KCXA 5ENHA 5EU1A 5K29A 3P1EA 2YELA 4Z1QA 4YABA 5AMFA 4QBMA 5HRXA 5F1HA 5FE3A 5EK9A 4HXMA 3AQAA 4OGJA 5HM0A 1ZS5A 5ENEA 5DFCA 4NQNA 4N4FA 5DKDA 4CLBA 4XUAA 4N3WA 5FE1A 5D3SA 5F1LA 2L84A 5H1VA 4YYNA 5FE4A 5I88A 5HLSA 4IR4A 5D3JA 4Z93A 4NUCA 2FSAA 2YQDA 5E74A 2WP1A 5EPBA 3O33A 3U5JA 4NS5A 4CUPA 4YYHA 4TT2A 5E9LA 5H1UA 5KTXA 5AD3A 5E3GA 5EV9A 4O72A 4A9HA 2DVSA 3ZYUA 5HQ7A 3P1CA 5D0CA 4O7EA 4NUEA 4QR4A 5DW1A 2R0SA 4QC1A 4NR4A 2GRCA 4TU6A 5FE5A 5DKCA 5C4QA 5LKZA 4TZ2A 2I8NA 3JVJA 5BT4A 4J1PA 4YC9A 5F2PA 4NYXA 5L97A 5CTLA 2D9EA 4KV4A 5ETDA 5HQ6A 4IR5A 1JSPB 4O70A 4MENA 4PKLA 3P1DA 4A9IA 5LVRA 5J0DA 4O74A 4UIVA 5E9MA 5EQ1A 3UVWA 2YEKA 5ENGA 4O7AA 4CFLA 2LSPB 4HXLA 4E96A 4NR9A 2YDWA 5CFWA 5I83A 5CU8A 5ENIA 5FBXA 2RI7A 3IU6A 4ALHA 5A5PA 5C8GA 4O76A 4A9LA 5CQ7A 3U5MA 5CUBA 5FE8A 5I40A 4QNSA 3G0JA 4YBSA 2L5EA 3UVDA 5D3HA 4YK0A 5D24A 4OUFA 2DVRA 4CUQA 5D3NA 5FG6A 3RCWA 3O37A 5CQ4A 3U5KA 5ACYA 5I29A 4YBTA 5ENJA 4QSUA 5I80A 4GPJA 5LJ1A 4TQNA 5DX4A 2DWWA 5CQ5A 3MUKA 5CPEA 5A5QA 1WUGA 5C87A 5F25A 4YYJA 5CUDA 2I7KA 5I89A 5A82A 5FG5A 4QSRA 4IR3A 4IR6A 5F3AA 5DYAA 5LUUA 5D3TA 5FB1A 5L8TA 5F61A 5IGNA 4QEVA 5CQ8A 5LJ2A 4Q0NA 2D82A 5DFDA 3O36A 5DYXA 4QR3A 5KO4A 4XY8A 4UYFA 4CFKA 3AADA 4A9MA 4O71A 4BW3A 5FFWA 5II2A 4F3IA 3Q2EA 4MEOA 5A83A 4LZSA 4TT6A 2R10A 2KTBB 5FG4A 4Z1SA 3G0LA 5CS8A 4ZQLA 4Z6HA 3O34A 5FFYA 5EWHA 5LJ0A 1WUMA 5D25A 5DFBA 2DATA 2E3KA 5DKHA 4HXPA 4NYWA 5EWCA 3O35A 3SVGA 5I7YA 5DLZA 3LXJA 5A5NA 3U5PA 4XY9A 5LVQA 4A9KA 5EGUA 4CURA 4TU4A 4XUBA 4J0SA 2RO1A 3UVYA 4N4HA 3JVLA 4QSTA 4Z6IA 5D3LA 5ENBA 5D3RA 4O78A 5ENFA 5E9YA 4AKNA 4X2IA 5CUCA 5HELA 5A5OA 3MULA 4HXSA 4LDFA 4QSVA
chains in the Genus database with same CATH superfamily
5A5SA 5BT5A 4UIZA 5CUAA 4J0RA 3HMHA 5FE2A 4O75A 2H60A 2N9GA 4HXKA 4QEUA 2EJNA 4QSPA 4HBYA 4IOOA 5LKXA 4MR6A 2NXBA 4LYIA 5I7XA 2YYNA 4HBWA 4UITA 4AI6A 3FKMX 3IU5A 4WHWA 5CUGA 5F60A 2E7OA 4NR5A 3P1FA 4MEPA 2DVVA 4C67A 5L8UA 5FH8A 5DYUA 5F62A 4BJXA 4QY4A 5HENA 5LKUA 3S91A 3JVKA 4O7FA 4YYDA 3MB4A 4J3IA 3VKGA 3SVHA 4LZRA 4KV1A 4DONA 4QC3A 4A9NA 4RVRA 3MB3A 3UV4A 5F5ZA 5II1A 4UYGA 4YYGA 5KHMA 5CP5A 5CUEA 4TYLA 5FE9A 4YH3A 4OGIA 2G4AA 3MXFA 4QYDA 5CRZA 5TCMA 5EWDA 4ALGA 5E73A 3GG3A 3JVMA 5CRMA 4UIUA 5KTUA 2RNYA 4WIVA 4QSXA 5EICA 4CUTA 5EVAA 4NXJA 4QSSA 4UIYA 4UYFB 5IG6A 2RS9B 4YY6A 5HFQA 5BT3A 5COIA 5E3DA 5HRWA 1PUOA 4N4IA 5EPRA 5IIDA 4MR3A 4BW4A 4NQMA 5CZGA 5DY7A 4YAXA 5D7XA 3LJWA 5E7DA 4UYHA 5CQ3A 1JM4B 4QR5A 5C89A 4QSQA 4HXNA 3LQHA 5AD2A 4CUUA 5A85A 5F36A 3QZVA 4MR4A 5EWWA 3I3JA 3VKHA 5H85A 3NXBA 4TZ8A 4LRGA 5E9KA 3U5NA 4HBVA 5IBNA 5D26A 3S92A 5LKTA 4UYDA 5TB6A 4A9FA 5HCLA 4O77A 3LQIA 3D1DA 2F6JA 2F6NA 4MR5A 4A9JA 5KU3A 1X0JA 4NYVA 4IOQA 3SVFA 4O7BA 5L99A 3P5OA 3D7CA 4BW1A 4YYKA 3Q2FA 3U5LA 4UYEA 2DKWA 5DBMA 4UIXA 4LC2A 5E0RA 3U5OA 1N72A 4AKIA 3QZTA 5FB0A 5C7NA 5FH6A 4QSWA 5FE6A 5A7CA 4UIWA 4LYWA 5I1QA 5CQAA 2R0YA 1F68A 3DAIA 5L96A 4NRCA 5DW2A 5EA1A 4NUDA 4LZ2A 4A9EA 4XYAA 1EQFA 5IGMA 4QUUA 3DWYA 3LQJA 5KTWA 3MQMA 4QYLA 5DLXA 2RFJA 5JI8A 5G4SA 3QZSA 5A5RA 4MEQA 5C85A 5EPSA 5EISA 4YATA 3K2JA 4YH4A 3ERRA 3UW9A 2YEMA 2WP2A 4C66A 4LYSA 4PCEA 4Y03A 5CQTA 5FDZA 4TS8A 4ZC9A 4CL9A 2OSSA 5HJCA 5HQ5A 2DVQA 5AMEA 4QZSA 4FLPA 2E7NA 5HEMA 3TLPA 5HFRA 4TT4A 4PS5A 5CGPA 4NRAA 4NR7A 3UV2A 2OUOA 3HMEA 2R0VA 5CQ6A 4QB3A 4YY4A 5EWVA 5G4RA 4YBMA 4AKHA 4HBXA 2L85A 4PY6A 4YADA 5IGLA 5DYCA 5E9IA 5D3PA 4ZW1A 5I86A 5FE7A 4BW2A 2RNWA 4NRBA 4O7CA 5JWMA 4YYMA 4YYIA 1E6IA 5EM3A 4CUSA 4AKGA 4HXOA 4NR8A 2OO1A 4HXRA 5IGKA 3HMFA 5EI4A 4Q0OA 5EP7A 3ONIA 4LR6A 4NR6A 4N4GA 4A9OA 4IORA 3UVXA 4BHWA 5HRVA 5CY9A 3UV5A 5A81A 5H1TA 5F63A 4QEWA 5ENCA 2YW5A 4PCIA 2MJVB 2RNXA 5E9VA 5ETBA 4PTBA 5FE0A 5FFVA 5FH7A 4QUTA 5L98A 4WHUA 3D1BA 4TTEA 4KCXA 5ENHA 5EU1A 5K29A 3P1EA 2YELA 4Z1QA 4YABA 5AMFA 4QBMA 5HRXA 5F1HA 5FE3A 5EK9A 4HXMA 3AQAA 4OGJA 5HM0A 1ZS5A 5ENEA 5DFCA 4NQNA 4N4FA 5DKDA 4CLBA 4XUAA 4N3WA 5FE1A 5D3SA 5F1LA 2L84A 5H1VA 4YYNA 5FE4A 5I88A 5HLSA 4IR4A 5D3JA 4Z93A 4NUCA 2FSAA 2YQDA 5E74A 2WP1A 5EPBA 3O33A 3U5JA 4NS5A 4CUPA 4YYHA 4TT2A 5E9LA 5H1UA 5KTXA 5AD3A 5E3GA 5EV9A 4O72A 4A9HA 2DVSA 3ZYUA 1ZKRA 5HQ7A 3P1CA 5D0CA 4O7EA 4NUEA 4QR4A 5DW1A 2R0SA 4QC1A 4NR4A 2GRCA 4TU6A 5FE5A 5DKCA 5C4QA 5LKZA 4TZ2A 2I8NA 3JVJA 5BT4A 4J1PA 4YC9A 5F2PA 4NYXA 5L97A 5CTLA 2D9EA 4KV4A 5ETDA 5HQ6A 4IR5A 1JSPB 4O70A 4MENA 4PKLA 3P1DA 4A9IA 5LVRA 5J0DA 4O74A 4UIVA 5E9MA 5EQ1A 3UVWA 2YEKA 5ENGA 4O7AA 4CFLA 2LSPB 4HXLA 4E96A 4NR9A 2YDWA 5CFWA 5I83A 5CU8A 5ENIA 5FBXA 2RI7A 3IU6A 4ALHA 5A5PA 5C8GA 4O76A 4A9LA 5CQ7A 3U5MA 5CUBA 5FE8A 5I40A 4QNSA 3G0JA 4YBSA 2L5EA 3UVDA 5D3HA 4YK0A 5D24A 4OUFA 2DVRA 4CUQA 5D3NA 5FG6A 3RCWA 3O37A 5CQ4A 3U5KA 5ACYA 5I29A 4YBTA 5ENJA 4QSUA 5I80A 4GPJA 5LJ1A 4TQNA 5DX4A 2DWWA 5CQ5A 3MUKA 5CPEA 5A5QA 1WUGA 5C87A 5F25A 4YYJA 5CUDA 2I7KA 5I89A 5A82A 5FG5A 4QSRA 4IR3A 4IR6A 5F3AA 5DYAA 5LUUA 5D3TA 5FB1A 5L8TA 5F61A 5IGNA 4QEVA 5CQ8A 5LJ2A 4Q0NA 2D82A 5DFDA 3O36A 5DYXA 4QR3A 5KO4A 4XY8A 4UYFA 4CFKA 3AADA 4A9MA 4O71A 4BW3A 5FFWA 5II2A 4F3IA 3Q2EA 4MEOA 5A83A 4LZSA 4TT6A 2R10A 2KTBB 5FG4A 4Z1SA 3G0LA 5CS8A 4ZQLA 4Z6HA 3O34A 5FFYA 5EWHA 5LJ0A 1WUMA 5D25A 5DFBA 2DATA 2E3KA 5DKHA 4HXPA 4NYWA 5EWCA 3O35A 3SVGA 5I7YA 5DLZA 3LXJA 5A5NA 3U5PA 4XY9A 5LVQA 4A9KA 5EGUA 4CURA 4TU4A 4XUBA 4J0SA 2RO1A 3UVYA 4N4HA 3JVLA 4QSTA 4Z6IA 5D3LA 5ENBA 5D3RA 4O78A 5ENFA 5E9YA 4AKNA 4X2IA 5CUCA 5HELA 5A5OA 3MULA 4HXSA 4LDFA 4QSVA
chains in the Genus database with same CATH topology
5A5SA 5BT5A 4UIZA 5CUAA 4J0RA 3HMHA 5FE2A 4O75A 2H60A 2N9GA 4HXKA 4QEUA 4QSPA 4HBYA 4IOOA 5LKXA 4MR6A 2NXBA 4LYIA 5I7XA 2YYNA 4HBWA 4UITA 3FKMX 3IU5A 4WHWA 5CUGA 5F60A 2E7OA 4NR5A 3P1FA 4MEPA 2DVVA 4C67A 5L8UA 5FH8A 5DYUA 5F62A 4BJXA 4QY4A 5HENA 5LKUA 3S91A 3JVKA 4O7FA 4YYDA 3MB4A 4J3IA 3SVHA 4LZRA 4KV1A 4DONA 4QC3A 4A9NA 4RVRA 3MB3A 3UV4A 5F5ZA 5II1A 4UYGA 4YYGA 5KHMA 5CP5A 5CUEA 4TYLA 5FE9A 4YH3A 4OGIA 2G4AA 3MXFA 4QYDA 5CRZA 5TCMA 5EWDA 4ALGA 5E73A 3GG3A 3JVMA 5CRMA 4UIUA 5KTUA 2RNYA 4WIVA 4QSXA 5EICA 4CUTA 5EVAA 4NXJA 4QSSA 4UIYA 4UYFB 5IG6A 2RS9B 4YY6A 5HFQA 5BT3A 5COIA 5E3DA 5HRWA 4N4IA 5EPRA 5IIDA 4MR3A 4BW4A 4NQMA 5CZGA 5DY7A 4YAXA 5D7XA 3LJWA 5E7DA 4UYHA 5CQ3A 1JM4B 4QR5A 5C89A 4QSQA 4HXNA 3LQHA 5AD2A 4CUUA 5A85A 5F36A 3QZVA 4MR4A 5EWWA 3I3JA 5H85A 3NXBA 4TZ8A 4LRGA 5E9KA 3U5NA 4HBVA 5IBNA 5D26A 3S92A 5LKTA 4UYDA 5TB6A 4A9FA 5HCLA 4O77A 3LQIA 2F6JA 2F6NA 4MR5A 4A9JA 5KU3A 1X0JA 4NYVA 4IOQA 3SVFA 4O7BA 5L99A 3P5OA 3D7CA 4BW1A 4YYKA 3Q2FA 3U5LA 4UYEA 2DKWA 5DBMA 4UIXA 4LC2A 5E0RA 3U5OA 1N72A 3QZTA 5FB0A 5C7NA 5FH6A 4QSWA 5FE6A 5A7CA 4UIWA 4LYWA 5I1QA 5CQAA 2R0YA 1F68A 3DAIA 5L96A 4NRCA 5DW2A 5EA1A 4NUDA 4LZ2A 4A9EA 4XYAA 1EQFA 5IGMA 4QUUA 3DWYA 3LQJA 5KTWA 3MQMA 4QYLA 5DLXA 2RFJA 5JI8A 5G4SA 3QZSA 5A5RA 4MEQA 5C85A 5EPSA 5EISA 4YATA 3K2JA 4YH4A 3UW9A 2YEMA 2WP2A 4C66A 4LYSA 4PCEA 4Y03A 5CQTA 5FDZA 4TS8A 4ZC9A 4CL9A 2OSSA 5HJCA 5HQ5A 2DVQA 5AMEA 4QZSA 4FLPA 2E7NA 5HEMA 3TLPA 5HFRA 4TT4A 4PS5A 5CGPA 4NRAA 4NR7A 3UV2A 2OUOA 3HMEA 2R0VA 5CQ6A 4QB3A 4YY4A 5EWVA 5G4RA 4YBMA 4HBXA 2L85A 4PY6A 4YADA 5IGLA 5DYCA 5E9IA 5D3PA 4ZW1A 5I86A 5FE7A 4BW2A 2RNWA 4NRBA 4O7CA 5JWMA 4YYMA 4YYIA 1E6IA 5EM3A 4CUSA 4HXOA 4NR8A 2OO1A 4HXRA 5IGKA 3HMFA 5EI4A 4Q0OA 5EP7A 3ONIA 4LR6A 4NR6A 4N4GA 4A9OA 4IORA 3UVXA 4BHWA 5HRVA 5CY9A 3UV5A 5A81A 5H1TA 5F63A 4QEWA 5ENCA 2YW5A 4PCIA 2MJVB 2RNXA 5E9VA 5ETBA 4PTBA 5FE0A 5FFVA 5FH7A 4QUTA 5L98A 4WHUA 4TTEA 4KCXA 5ENHA 5EU1A 5K29A 3P1EA 2YELA 4Z1QA 4YABA 5AMFA 4QBMA 5HRXA 5F1HA 5FE3A 5EK9A 4HXMA 3AQAA 4OGJA 5HM0A 1ZS5A 5ENEA 5DFCA 4NQNA 4N4FA 5DKDA 4CLBA 4XUAA 4N3WA 5FE1A 5D3SA 5F1LA 2L84A 5H1VA 4YYNA 5FE4A 5I88A 5HLSA 4IR4A 5D3JA 4Z93A 4NUCA 2FSAA 2YQDA 5E74A 2WP1A 5EPBA 3O33A 3U5JA 4NS5A 4CUPA 4YYHA 4TT2A 5E9LA 5H1UA 5KTXA 5AD3A 5E3GA 5EV9A 4O72A 4A9HA 2DVSA 3ZYUA 5HQ7A 3P1CA 5D0CA 4O7EA 4NUEA 4QR4A 5DW1A 2R0SA 4QC1A 4NR4A 2GRCA 4TU6A 5FE5A 5DKCA 5C4QA 5LKZA 4TZ2A 2I8NA 3JVJA 5BT4A 4J1PA 4YC9A 5F2PA 4NYXA 5L97A 5CTLA 2D9EA 4KV4A 5ETDA 5HQ6A 4IR5A 1JSPB 4O70A 4MENA 4PKLA 3P1DA 4A9IA 5LVRA 5J0DA 4O74A 4UIVA 5E9MA 5EQ1A 3UVWA 2YEKA 5ENGA 4O7AA 4CFLA 2LSPB 4HXLA 4E96A 4NR9A 2YDWA 5CFWA 5I83A 5CU8A 5ENIA 5FBXA 2RI7A 3IU6A 4ALHA 5A5PA 5C8GA 4O76A 4A9LA 5CQ7A 3U5MA 5CUBA 5FE8A 5I40A 4QNSA 3G0JA 4YBSA 2L5EA 3UVDA 5D3HA 4YK0A 5D24A 4OUFA 2DVRA 4CUQA 5D3NA 5FG6A 3RCWA 3O37A 5CQ4A 3U5KA 5ACYA 5I29A 4YBTA 5ENJA 4QSUA 5I80A 4GPJA 5LJ1A 4TQNA 5DX4A 2DWWA 5CQ5A 3MUKA 5CPEA 5A5QA 1WUGA 5C87A 5F25A 4YYJA 5CUDA 2I7KA 5I89A 5A82A 5FG5A 4QSRA 4IR3A 4IR6A 5F3AA 5DYAA 5LUUA 5D3TA 5FB1A 5L8TA 5F61A 5IGNA 4QEVA 5CQ8A 5LJ2A 4Q0NA 2D82A 5DFDA 3O36A 5DYXA 4QR3A 5KO4A 4XY8A 4UYFA 4CFKA 3AADA 4A9MA 4O71A 4BW3A 5FFWA 5II2A 4F3IA 3Q2EA 4MEOA 5A83A 4LZSA 4TT6A 2R10A 2KTBB 5FG4A 4Z1SA 3G0LA 5CS8A 4ZQLA 4Z6HA 3O34A 5FFYA 5EWHA 5LJ0A 1WUMA 5D25A 5DFBA 2DATA 2E3KA 5DKHA 4HXPA 4NYWA 5EWCA 3O35A 3SVGA 5I7YA 5DLZA 3LXJA 5A5NA 3U5PA 4XY9A 5LVQA 4A9KA 5EGUA 4CURA 4TU4A 4XUBA 4J0SA 2RO1A 3UVYA 4N4HA 3JVLA 4QSTA 4Z6IA 5D3LA 5ENBA 5D3RA 4O78A 5ENFA 5E9YA 4AKNA 4X2IA 5CUCA 5HELA 5A5OA 3MULA 4HXSA 4LDFA 4QSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5S A;  5BT5 A;  4UIZ A;  5CUA A;  4J0R A;  3HMH A;  5FE2 A;  4O75 A;  2H60 A;  2N9G A;  4HXK A;  4QEU A;  4QSP A;  4HBY A;  4IOO A;  5LKX A;  4MR6 A;  2NXB A;  4LYI A;  5I7X A;  2YYN A;  4HBW A;  4UIT A;  3FKM X;  3IU5 A;  4WHW A;  5CUG A;  5F60 A;  2E7O A;  4NR5 A;  3P1F A;  4MEP A;  2DVV A;  4C67 A;  5L8U A;  5FH8 A;  5DYU A;  5F62 A;  4BJX A;  4QY4 A;  5HEN A;  5LKU A;  3S91 A;  3JVK A;  4O7F A;  4YYD A;  3MB4 A;  4J3I A;  3SVH A;  4LZR A;  4KV1 A;  4DON A;  4QC3 A;  4A9N A;  4RVR A;  3MB3 A;  3UV4 A;  5F5Z A;  5II1 A;  4UYG A;  4YYG A;  5KHM A;  5CP5 A;  5CUE A;  4TYL A;  5FE9 A;  4YH3 A;  4OGI A;  2G4A A;  3MXF A;  4QYD A;  5CRZ A;  5TCM A;  5EWD A;  4ALG A;  5E73 A;  3GG3 A;  3JVM A;  5CRM A;  4UIU A;  5KTU A;  2RNY A;  4WIV A;  4QSX A;  5EIC A;  4CUT A;  5EVA A;  4NXJ A;  4QSS A;  4UIY A;  4UYF B;  5IG6 A;  2RS9 B;  4YY6 A;  5HFQ A;  5BT3 A;  5COI A;  5E3D A;  5HRW A;  4N4I A;  5EPR A;  5IID A;  4MR3 A;  4BW4 A;  4NQM A;  5CZG A;  5DY7 A;  4YAX A;  5D7X A;  3LJW A;  5E7D A;  4UYH A;  5CQ3 A;  1JM4 B;  4QR5 A;  5C89 A;  4QSQ A;  4HXN A;  3LQH A;  5AD2 A;  4CUU A;  5A85 A;  5F36 A;  3QZV A;  4MR4 A;  5EWW A;  3I3J A;  5H85 A;  3NXB A;  4TZ8 A;  4LRG A;  5E9K A;  3U5N A;  4HBV A;  5IBN A;  5D26 A;  3S92 A;  5LKT A;  4UYD A;  5TB6 A;  4A9F A;  5HCL A;  4O77 A;  3LQI A;  2F6J A;  2F6N A;  4MR5 A;  4A9J A;  5KU3 A;  1X0J A;  4NYV A;  4IOQ A;  3SVF A;  4O7B A;  5L99 A;  3P5O A;  3D7C A;  4BW1 A;  4YYK A;  3Q2F A;  3U5L A;  4UYE A;  2DKW A;  5DBM A;  4UIX A;  4LC2 A;  5E0R A;  3U5O A;  1N72 A;  3QZT A;  5FB0 A;  5C7N A;  5FH6 A;  4QSW A;  5FE6 A;  5A7C A;  4UIW A;  4LYW A;  5I1Q A;  5CQA A;  2R0Y A;  1F68 A;  3DAI A;  5L96 A;  4NRC A;  5DW2 A;  5EA1 A;  4NUD A;  4LZ2 A;  4A9E A;  4XYA A;  1EQF A;  5IGM A;  4QUU A;  3DWY A;  3LQJ A;  5KTW A;  3MQM A;  4QYL A;  5DLX A;  2RFJ A;  5JI8 A;  5G4S A;  3QZS A;  5A5R A;  4MEQ A;  5C85 A;  5EPS A;  5EIS A;  4YAT A;  3K2J A;  4YH4 A;  3UW9 A;  2YEM A;  2WP2 A;  4C66 A;  4LYS A;  4PCE A;  4Y03 A;  5CQT A;  5FDZ A;  4TS8 A;  4ZC9 A;  4CL9 A;  2OSS A;  5HJC A;  5HQ5 A;  2DVQ A;  5AME A;  4QZS A;  4FLP A;  2E7N A;  5HEM A;  3TLP A;  5HFR A;  4TT4 A;  4PS5 A;  5CGP A;  4NRA A;  4NR7 A;  3UV2 A;  2OUO A;  3HME A;  2R0V A;  5CQ6 A;  4QB3 A;  4YY4 A;  5EWV A;  5G4R A;  4YBM A;  4HBX A;  2L85 A;  4PY6 A;  4YAD A;  5IGL A;  5DYC A;  5E9I A;  5D3P A;  4ZW1 A;  5I86 A;  5FE7 A;  4BW2 A;  2RNW A;  4NRB A;  4O7C A;  5JWM A;  4YYM A;  4YYI A;  1E6I A;  5EM3 A;  4CUS A;  4HXO A;  4NR8 A;  2OO1 A;  4HXR A;  5IGK A;  3HMF A;  5EI4 A;  4Q0O A;  5EP7 A;  3ONI A;  4LR6 A;  4NR6 A;  4N4G A;  4A9O A;  4IOR A;  3UVX A;  4BHW A;  5HRV A;  5CY9 A;  3UV5 A;  5A81 A;  5H1T A;  5F63 A;  4QEW A;  5ENC A;  2YW5 A;  4PCI A;  2MJV B;  2RNX A;  5E9V A;  5ETB A;  4PTB A;  5FE0 A;  5FFV A;  5FH7 A;  4QUT A;  5L98 A;  4WHU A;  4TTE A;  4KCX A;  5ENH A;  5EU1 A;  5K29 A;  3P1E A;  2YEL A;  4Z1Q A;  4YAB A;  5AMF A;  4QBM A;  5HRX A;  5F1H A;  5FE3 A;  5EK9 A;  4HXM A;  3AQA A;  4OGJ A;  5HM0 A;  1ZS5 A;  5ENE A;  5DFC A;  4NQN A;  4N4F A;  5DKD A;  4CLB A;  4XUA A;  4N3W A;  5FE1 A;  5D3S A;  5F1L A;  2L84 A;  5H1V A;  4YYN A;  5FE4 A;  5I88 A;  5HLS A;  4IR4 A;  5D3J A;  4Z93 A;  4NUC A;  2FSA A;  2YQD A;  5E74 A;  2WP1 A;  5EPB A;  3O33 A;  3U5J A;  4NS5 A;  4CUP A;  4YYH A;  4TT2 A;  5E9L A;  5H1U A;  5KTX A;  5AD3 A;  5E3G A;  5EV9 A;  4O72 A;  4A9H A;  2DVS A;  3ZYU A;  5HQ7 A;  3P1C A;  5D0C A;  4O7E A;  4NUE A;  4QR4 A;  5DW1 A;  2R0S A;  4QC1 A;  4NR4 A;  2GRC A;  4TU6 A;  5FE5 A;  5DKC A;  5C4Q A;  5LKZ A;  4TZ2 A;  2I8N A;  3JVJ A;  5BT4 A;  4J1P A;  4YC9 A;  5F2P A;  4NYX A;  5L97 A;  5CTL A;  2D9E A;  4KV4 A;  5ETD A;  5HQ6 A;  4IR5 A;  1JSP B;  4O70 A;  4MEN A;  4PKL A;  3P1D A;  4A9I A;  5LVR A;  5J0D A;  4O74 A;  4UIV A;  5E9M A;  5EQ1 A;  3UVW A;  2YEK A;  5ENG A;  4O7A A;  4CFL A;  2LSP B;  4HXL A;  4E96 A;  4NR9 A;  2YDW A;  5CFW A;  5I83 A;  5CU8 A;  5ENI A;  5FBX A;  2RI7 A;  3IU6 A;  4ALH A;  5A5P A;  5C8G A;  4O76 A;  4A9L A;  5CQ7 A;  3U5M A;  5CUB A;  5FE8 A;  5I40 A;  4QNS A;  3G0J A;  4YBS A;  2L5E A;  3UVD A;  5D3H A;  4YK0 A;  5D24 A;  4OUF A;  2DVR A;  4CUQ A;  5D3N A;  5FG6 A;  3RCW A;  3O37 A;  5CQ4 A;  3U5K A;  5ACY A;  5I29 A;  4YBT A;  5ENJ A;  4QSU A;  5I80 A;  4GPJ A;  5LJ1 A;  4TQN A;  5DX4 A;  2DWW A;  5CQ5 A;  3MUK A;  5CPE A;  5A5Q A;  1WUG A;  5C87 A;  5F25 A;  4YYJ A;  5CUD A;  2I7K A;  5I89 A;  5A82 A;  5FG5 A;  4QSR A;  4IR3 A;  4IR6 A;  5F3A A;  5DYA A;  5LUU A;  5D3T A;  5FB1 A;  5L8T A;  5F61 A;  5IGN A;  4QEV A;  5CQ8 A;  5LJ2 A;  4Q0N A;  2D82 A;  5DFD A;  3O36 A;  5DYX A;  4QR3 A;  5KO4 A;  4XY8 A;  4UYF A;  4CFK A;  3AAD A;  4A9M A;  4O71 A;  4BW3 A;  5FFW A;  5II2 A;  4F3I A;  3Q2E A;  4MEO A;  5A83 A;  4LZS A;  4TT6 A;  2R10 A;  2KTB B;  5FG4 A;  4Z1S A;  3G0L A;  5CS8 A;  4ZQL A;  4Z6H A;  3O34 A;  5FFY A;  5EWH A;  5LJ0 A;  1WUM A;  5D25 A;  5DFB A;  2DAT A;  2E3K A;  5DKH A;  4HXP A;  4NYW A;  5EWC A;  3O35 A;  3SVG A;  5I7Y A;  5DLZ A;  3LXJ A;  5A5N A;  3U5P A;  4XY9 A;  5LVQ A;  4A9K A;  5EGU A;  4CUR A;  4TU4 A;  4XUB A;  4J0S A;  2RO1 A;  3UVY A;  4N4H A;  3JVL A;  4QST A;  4Z6I A;  5D3L A;  5ENB A;  5D3R A;  4O78 A;  5ENF A;  5E9Y A;  4AKN A;  4X2I A;  5CUC A;  5HEL A;  5A5O A;  3MUL A;  4HXS A;  4LDF A;  4QSV A; 
#chains in the Genus database with same CATH topology
 5A5S A;  5BT5 A;  4UIZ A;  5CUA A;  4J0R A;  3HMH A;  5FE2 A;  4O75 A;  2H60 A;  2N9G A;  4HXK A;  4QEU A;  2EJN A;  4QSP A;  4HBY A;  4IOO A;  5LKX A;  4MR6 A;  2NXB A;  4LYI A;  5I7X A;  2YYN A;  4HBW A;  4UIT A;  4AI6 A;  3FKM X;  3IU5 A;  4WHW A;  5CUG A;  5F60 A;  2E7O A;  4NR5 A;  3P1F A;  4MEP A;  2DVV A;  4C67 A;  5L8U A;  5FH8 A;  5DYU A;  5F62 A;  4BJX A;  4QY4 A;  5HEN A;  5LKU A;  3S91 A;  3JVK A;  4O7F A;  4YYD A;  3MB4 A;  4J3I A;  3VKG A;  3SVH A;  4LZR A;  4KV1 A;  4DON A;  4QC3 A;  4A9N A;  4RVR A;  3MB3 A;  3UV4 A;  5F5Z A;  5II1 A;  4UYG A;  4YYG A;  5KHM A;  5CP5 A;  5CUE A;  4TYL A;  5FE9 A;  4YH3 A;  4OGI A;  2G4A A;  3MXF A;  4QYD A;  5CRZ A;  5TCM A;  5EWD A;  4ALG A;  5E73 A;  3GG3 A;  3JVM A;  5CRM A;  4UIU A;  5KTU A;  2RNY A;  4WIV A;  4QSX A;  5EIC A;  4CUT A;  5EVA A;  4NXJ A;  4QSS A;  4UIY A;  4UYF B;  5IG6 A;  2RS9 B;  4YY6 A;  5HFQ A;  5BT3 A;  5COI A;  5E3D A;  5HRW A;  1PUO A;  4N4I A;  5EPR A;  5IID A;  4MR3 A;  4BW4 A;  4NQM A;  5CZG A;  5DY7 A;  4YAX A;  5D7X A;  3LJW A;  5E7D A;  4UYH A;  5CQ3 A;  1JM4 B;  4QR5 A;  5C89 A;  4QSQ A;  4HXN A;  3LQH A;  5AD2 A;  4CUU A;  5A85 A;  5F36 A;  3QZV A;  4MR4 A;  5EWW A;  3I3J A;  3VKH A;  5H85 A;  3NXB A;  4TZ8 A;  4LRG A;  5E9K A;  3U5N A;  4HBV A;  5IBN A;  5D26 A;  3S92 A;  5LKT A;  4UYD A;  5TB6 A;  4A9F A;  5HCL A;  4O77 A;  3LQI A;  3D1D A;  2F6J A;  2F6N A;  4MR5 A;  4A9J A;  5KU3 A;  1X0J A;  4NYV A;  4IOQ A;  3SVF A;  4O7B A;  5L99 A;  3P5O A;  3D7C A;  4BW1 A;  4YYK A;  3Q2F A;  3U5L A;  4UYE A;  2DKW A;  5DBM A;  4UIX A;  4LC2 A;  5E0R A;  3U5O A;  1N72 A;  4AKI A;  3QZT A;  5FB0 A;  5C7N A;  5FH6 A;  4QSW A;  5FE6 A;  5A7C A;  4UIW A;  4LYW A;  5I1Q A;  5CQA A;  2R0Y A;  1F68 A;  3DAI A;  5L96 A;  4NRC A;  5DW2 A;  5EA1 A;  4NUD A;  4LZ2 A;  4A9E A;  4XYA A;  1EQF A;  5IGM A;  4QUU A;  3DWY A;  3LQJ A;  5KTW A;  3MQM A;  4QYL A;  5DLX A;  2RFJ A;  5JI8 A;  5G4S A;  3QZS A;  5A5R A;  4MEQ A;  5C85 A;  5EPS A;  5EIS A;  4YAT A;  3K2J A;  4YH4 A;  3ERR A;  3UW9 A;  2YEM A;  2WP2 A;  4C66 A;  4LYS A;  4PCE A;  4Y03 A;  5CQT A;  5FDZ A;  4TS8 A;  4ZC9 A;  4CL9 A;  2OSS A;  5HJC A;  5HQ5 A;  2DVQ A;  5AME A;  4QZS A;  4FLP A;  2E7N A;  5HEM A;  3TLP A;  5HFR A;  4TT4 A;  4PS5 A;  5CGP A;  4NRA A;  4NR7 A;  3UV2 A;  2OUO A;  3HME A;  2R0V A;  5CQ6 A;  4QB3 A;  4YY4 A;  5EWV A;  5G4R A;  4YBM A;  4AKH A;  4HBX A;  2L85 A;  4PY6 A;  4YAD A;  5IGL A;  5DYC A;  5E9I A;  5D3P A;  4ZW1 A;  5I86 A;  5FE7 A;  4BW2 A;  2RNW A;  4NRB A;  4O7C A;  5JWM A;  4YYM A;  4YYI A;  1E6I A;  5EM3 A;  4CUS A;  4AKG A;  4HXO A;  4NR8 A;  2OO1 A;  4HXR A;  5IGK A;  3HMF A;  5EI4 A;  4Q0O A;  5EP7 A;  3ONI A;  4LR6 A;  4NR6 A;  4N4G A;  4A9O A;  4IOR A;  3UVX A;  4BHW A;  5HRV A;  5CY9 A;  3UV5 A;  5A81 A;  5H1T A;  5F63 A;  4QEW A;  5ENC A;  2YW5 A;  4PCI A;  2MJV B;  2RNX A;  5E9V A;  5ETB A;  4PTB A;  5FE0 A;  5FFV A;  5FH7 A;  4QUT A;  5L98 A;  4WHU A;  3D1B A;  4TTE A;  4KCX A;  5ENH A;  5EU1 A;  5K29 A;  3P1E A;  2YEL A;  4Z1Q A;  4YAB A;  5AMF A;  4QBM A;  5HRX A;  5F1H A;  5FE3 A;  5EK9 A;  4HXM A;  3AQA A;  4OGJ A;  5HM0 A;  1ZS5 A;  5ENE A;  5DFC A;  4NQN A;  4N4F A;  5DKD A;  4CLB A;  4XUA A;  4N3W A;  5FE1 A;  5D3S A;  5F1L A;  2L84 A;  5H1V A;  4YYN A;  5FE4 A;  5I88 A;  5HLS A;  4IR4 A;  5D3J A;  4Z93 A;  4NUC A;  2FSA A;  2YQD A;  5E74 A;  2WP1 A;  5EPB A;  3O33 A;  3U5J A;  4NS5 A;  4CUP A;  4YYH A;  4TT2 A;  5E9L A;  5H1U A;  5KTX A;  5AD3 A;  5E3G A;  5EV9 A;  4O72 A;  4A9H A;  2DVS A;  3ZYU A;  1ZKR A;  5HQ7 A;  3P1C A;  5D0C A;  4O7E A;  4NUE A;  4QR4 A;  5DW1 A;  2R0S A;  4QC1 A;  4NR4 A;  2GRC A;  4TU6 A;  5FE5 A;  5DKC A;  5C4Q A;  5LKZ A;  4TZ2 A;  2I8N A;  3JVJ A;  5BT4 A;  4J1P A;  4YC9 A;  5F2P A;  4NYX A;  5L97 A;  5CTL A;  2D9E A;  4KV4 A;  5ETD A;  5HQ6 A;  4IR5 A;  1JSP B;  4O70 A;  4MEN A;  4PKL A;  3P1D A;  4A9I A;  5LVR A;  5J0D A;  4O74 A;  4UIV A;  5E9M A;  5EQ1 A;  3UVW A;  2YEK A;  5ENG A;  4O7A A;  4CFL A;  2LSP B;  4HXL A;  4E96 A;  4NR9 A;  2YDW A;  5CFW A;  5I83 A;  5CU8 A;  5ENI A;  5FBX A;  2RI7 A;  3IU6 A;  4ALH A;  5A5P A;  5C8G A;  4O76 A;  4A9L A;  5CQ7 A;  3U5M A;  5CUB A;  5FE8 A;  5I40 A;  4QNS A;  3G0J A;  4YBS A;  2L5E A;  3UVD A;  5D3H A;  4YK0 A;  5D24 A;  4OUF A;  2DVR A;  4CUQ A;  5D3N A;  5FG6 A;  3RCW A;  3O37 A;  5CQ4 A;  3U5K A;  5ACY A;  5I29 A;  4YBT A;  5ENJ A;  4QSU A;  5I80 A;  4GPJ A;  5LJ1 A;  4TQN A;  5DX4 A;  2DWW A;  5CQ5 A;  3MUK A;  5CPE A;  5A5Q A;  1WUG A;  5C87 A;  5F25 A;  4YYJ A;  5CUD A;  2I7K A;  5I89 A;  5A82 A;  5FG5 A;  4QSR A;  4IR3 A;  4IR6 A;  5F3A A;  5DYA A;  5LUU A;  5D3T A;  5FB1 A;  5L8T A;  5F61 A;  5IGN A;  4QEV A;  5CQ8 A;  5LJ2 A;  4Q0N A;  2D82 A;  5DFD A;  3O36 A;  5DYX A;  4QR3 A;  5KO4 A;  4XY8 A;  4UYF A;  4CFK A;  3AAD A;  4A9M A;  4O71 A;  4BW3 A;  5FFW A;  5II2 A;  4F3I A;  3Q2E A;  4MEO A;  5A83 A;  4LZS A;  4TT6 A;  2R10 A;  2KTB B;  5FG4 A;  4Z1S A;  3G0L A;  5CS8 A;  4ZQL A;  4Z6H A;  3O34 A;  5FFY A;  5EWH A;  5LJ0 A;  1WUM A;  5D25 A;  5DFB A;  2DAT A;  2E3K A;  5DKH A;  4HXP A;  4NYW A;  5EWC A;  3O35 A;  3SVG A;  5I7Y A;  5DLZ A;  3LXJ A;  5A5N A;  3U5P A;  4XY9 A;  5LVQ A;  4A9K A;  5EGU A;  4CUR A;  4TU4 A;  4XUB A;  4J0S A;  2RO1 A;  3UVY A;  4N4H A;  3JVL A;  4QST A;  4Z6I A;  5D3L A;  5ENB A;  5D3R A;  4O78 A;  5ENF A;  5E9Y A;  4AKN A;  4X2I A;  5CUC A;  5HEL A;  5A5O A;  3MUL A;  4HXS A;  4LDF A;  4QSV A; 
#chains in the Genus database with same CATH homology
 5A5S A;  5BT5 A;  4UIZ A;  5CUA A;  4J0R A;  3HMH A;  5FE2 A;  4O75 A;  2H60 A;  2N9G A;  4HXK A;  4QEU A;  4QSP A;  4HBY A;  4IOO A;  5LKX A;  4MR6 A;  2NXB A;  4LYI A;  5I7X A;  2YYN A;  4HBW A;  4UIT A;  3FKM X;  3IU5 A;  4WHW A;  5CUG A;  5F60 A;  2E7O A;  4NR5 A;  3P1F A;  4MEP A;  2DVV A;  4C67 A;  5L8U A;  5FH8 A;  5DYU A;  5F62 A;  4BJX A;  4QY4 A;  5HEN A;  5LKU A;  3S91 A;  3JVK A;  4O7F A;  4YYD A;  3MB4 A;  4J3I A;  3SVH A;  4LZR A;  4KV1 A;  4DON A;  4QC3 A;  4A9N A;  4RVR A;  3MB3 A;  3UV4 A;  5F5Z A;  5II1 A;  4UYG A;  4YYG A;  5KHM A;  5CP5 A;  5CUE A;  4TYL A;  5FE9 A;  4YH3 A;  4OGI A;  2G4A A;  3MXF A;  4QYD A;  5CRZ A;  5TCM A;  5EWD A;  4ALG A;  5E73 A;  3GG3 A;  3JVM A;  5CRM A;  4UIU A;  5KTU A;  2RNY A;  4WIV A;  4QSX A;  5EIC A;  4CUT A;  5EVA A;  4NXJ A;  4QSS A;  4UIY A;  4UYF B;  5IG6 A;  2RS9 B;  4YY6 A;  5HFQ A;  5BT3 A;  5COI A;  5E3D A;  5HRW A;  4N4I A;  5EPR A;  5IID A;  4MR3 A;  4BW4 A;  4NQM A;  5CZG A;  5DY7 A;  4YAX A;  5D7X A;  3LJW A;  5E7D A;  4UYH A;  5CQ3 A;  1JM4 B;  4QR5 A;  5C89 A;  4QSQ A;  4HXN A;  3LQH A;  5AD2 A;  4CUU A;  5A85 A;  5F36 A;  3QZV A;  4MR4 A;  5EWW A;  3I3J A;  5H85 A;  3NXB A;  4TZ8 A;  4LRG A;  5E9K A;  3U5N A;  4HBV A;  5IBN A;  5D26 A;  3S92 A;  5LKT A;  4UYD A;  5TB6 A;  4A9F A;  5HCL A;  4O77 A;  3LQI A;  2F6J A;  2F6N A;  4MR5 A;  4A9J A;  5KU3 A;  1X0J A;  4NYV A;  4IOQ A;  3SVF A;  4O7B A;  5L99 A;  3P5O A;  3D7C A;  4BW1 A;  4YYK A;  3Q2F A;  3U5L A;  4UYE A;  2DKW A;  5DBM A;  4UIX A;  4LC2 A;  5E0R A;  3U5O A;  1N72 A;  3QZT A;  5FB0 A;  5C7N A;  5FH6 A;  4QSW A;  5FE6 A;  5A7C A;  4UIW A;  4LYW A;  5I1Q A;  5CQA A;  2R0Y A;  1F68 A;  3DAI A;  5L96 A;  4NRC A;  5DW2 A;  5EA1 A;  4NUD A;  4LZ2 A;  4A9E A;  4XYA A;  1EQF A;  5IGM A;  4QUU A;  3DWY A;  3LQJ A;  5KTW A;  3MQM A;  4QYL A;  5DLX A;  2RFJ A;  5JI8 A;  5G4S A;  3QZS A;  5A5R A;  4MEQ A;  5C85 A;  5EPS A;  5EIS A;  4YAT A;  3K2J A;  4YH4 A;  3UW9 A;  2YEM A;  2WP2 A;  4C66 A;  4LYS A;  4PCE A;  4Y03 A;  5CQT A;  5FDZ A;  4TS8 A;  4ZC9 A;  4CL9 A;  2OSS A;  5HJC A;  5HQ5 A;  2DVQ A;  5AME A;  4QZS A;  4FLP A;  2E7N A;  5HEM A;  3TLP A;  5HFR A;  4TT4 A;  4PS5 A;  5CGP A;  4NRA A;  4NR7 A;  3UV2 A;  2OUO A;  3HME A;  2R0V A;  5CQ6 A;  4QB3 A;  4YY4 A;  5EWV A;  5G4R A;  4YBM A;  4HBX A;  2L85 A;  4PY6 A;  4YAD A;  5IGL A;  5DYC A;  5E9I A;  5D3P A;  4ZW1 A;  5I86 A;  5FE7 A;  4BW2 A;  2RNW A;  4NRB A;  4O7C A;  5JWM A;  4YYM A;  4YYI A;  1E6I A;  5EM3 A;  4CUS A;  4HXO A;  4NR8 A;  2OO1 A;  4HXR A;  5IGK A;  3HMF A;  5EI4 A;  4Q0O A;  5EP7 A;  3ONI A;  4LR6 A;  4NR6 A;  4N4G A;  4A9O A;  4IOR A;  3UVX A;  4BHW A;  5HRV A;  5CY9 A;  3UV5 A;  5A81 A;  5H1T A;  5F63 A;  4QEW A;  5ENC A;  2YW5 A;  4PCI A;  2MJV B;  2RNX A;  5E9V A;  5ETB A;  4PTB A;  5FE0 A;  5FFV A;  5FH7 A;  4QUT A;  5L98 A;  4WHU A;  4TTE A;  4KCX A;  5ENH A;  5EU1 A;  5K29 A;  3P1E A;  2YEL A;  4Z1Q A;  4YAB A;  5AMF A;  4QBM A;  5HRX A;  5F1H A;  5FE3 A;  5EK9 A;  4HXM A;  3AQA A;  4OGJ A;  5HM0 A;  1ZS5 A;  5ENE A;  5DFC A;  4NQN A;  4N4F A;  5DKD A;  4CLB A;  4XUA A;  4N3W A;  5FE1 A;  5D3S A;  5F1L A;  2L84 A;  5H1V A;  4YYN A;  5FE4 A;  5I88 A;  5HLS A;  4IR4 A;  5D3J A;  4Z93 A;  4NUC A;  2FSA A;  2YQD A;  5E74 A;  2WP1 A;  5EPB A;  3O33 A;  3U5J A;  4NS5 A;  4CUP A;  4YYH A;  4TT2 A;  5E9L A;  5H1U A;  5KTX A;  5AD3 A;  5E3G A;  5EV9 A;  4O72 A;  4A9H A;  2DVS A;  3ZYU A;  5HQ7 A;  3P1C A;  5D0C A;  4O7E A;  4NUE A;  4QR4 A;  5DW1 A;  2R0S A;  4QC1 A;  4NR4 A;  2GRC A;  4TU6 A;  5FE5 A;  5DKC A;  5C4Q A;  5LKZ A;  4TZ2 A;  2I8N A;  3JVJ A;  5BT4 A;  4J1P A;  4YC9 A;  5F2P A;  4NYX A;  5L97 A;  5CTL A;  2D9E A;  4KV4 A;  5ETD A;  5HQ6 A;  4IR5 A;  1JSP B;  4O70 A;  4MEN A;  4PKL A;  3P1D A;  4A9I A;  5LVR A;  5J0D A;  4O74 A;  4UIV A;  5E9M A;  5EQ1 A;  3UVW A;  2YEK A;  5ENG A;  4O7A A;  4CFL A;  2LSP B;  4HXL A;  4E96 A;  4NR9 A;  2YDW A;  5CFW A;  5I83 A;  5CU8 A;  5ENI A;  5FBX A;  2RI7 A;  3IU6 A;  4ALH A;  5A5P A;  5C8G A;  4O76 A;  4A9L A;  5CQ7 A;  3U5M A;  5CUB A;  5FE8 A;  5I40 A;  4QNS A;  3G0J A;  4YBS A;  2L5E A;  3UVD A;  5D3H A;  4YK0 A;  5D24 A;  4OUF A;  2DVR A;  4CUQ A;  5D3N A;  5FG6 A;  3RCW A;  3O37 A;  5CQ4 A;  3U5K A;  5ACY A;  5I29 A;  4YBT A;  5ENJ A;  4QSU A;  5I80 A;  4GPJ A;  5LJ1 A;  4TQN A;  5DX4 A;  2DWW A;  5CQ5 A;  3MUK A;  5CPE A;  5A5Q A;  1WUG A;  5C87 A;  5F25 A;  4YYJ A;  5CUD A;  2I7K A;  5I89 A;  5A82 A;  5FG5 A;  4QSR A;  4IR3 A;  4IR6 A;  5F3A A;  5DYA A;  5LUU A;  5D3T A;  5FB1 A;  5L8T A;  5F61 A;  5IGN A;  4QEV A;  5CQ8 A;  5LJ2 A;  4Q0N A;  2D82 A;  5DFD A;  3O36 A;  5DYX A;  4QR3 A;  5KO4 A;  4XY8 A;  4UYF A;  4CFK A;  3AAD A;  4A9M A;  4O71 A;  4BW3 A;  5FFW A;  5II2 A;  4F3I A;  3Q2E A;  4MEO A;  5A83 A;  4LZS A;  4TT6 A;  2R10 A;  2KTB B;  5FG4 A;  4Z1S A;  3G0L A;  5CS8 A;  4ZQL A;  4Z6H A;  3O34 A;  5FFY A;  5EWH A;  5LJ0 A;  1WUM A;  5D25 A;  5DFB A;  2DAT A;  2E3K A;  5DKH A;  4HXP A;  4NYW A;  5EWC A;  3O35 A;  3SVG A;  5I7Y A;  5DLZ A;  3LXJ A;  5A5N A;  3U5P A;  4XY9 A;  5LVQ A;  4A9K A;  5EGU A;  4CUR A;  4TU4 A;  4XUB A;  4J0S A;  2RO1 A;  3UVY A;  4N4H A;  3JVL A;  4QST A;  4Z6I A;  5D3L A;  5ENB A;  5D3R A;  4O78 A;  5ENF A;  5E9Y A;  4AKN A;  4X2I A;  5CUC A;  5HEL A;  5A5O A;  3MUL A;  4HXS A;  4LDF A;  4QSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...