3MULA

Crystal structure of brd4 bromodomain 1 with butyrylated histone h3-k(buty)14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
MGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Interaction of propionylated and butyrylated histone H3 lysine marks with Brd4 bromodomains
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mulA01
5FH7A 4LYIA 4Y03A 5D25A 5LVRA 5DFCA 4QYLA 5EPBA 5EQ1A 5LKZA 3MULA 4LC2A 5AD2A 4QSVA 4BW3A 4X2IA 5EVAA 3UV5A 3HMFA 1N72A 1WUGA 5HQ7A 5FBXA 4A9FA 5BT3A 4WIVA 4TT2A 5E9MA 5C8GA 4YYIA 5CU8A 4UIXA 5CQ6A 4UYFA 3P1CA 5ETBA 5KTUA 4TQNA 5F61A 4PS5A 4O7CA 5A5PA 5IGKA 4QSPA 4YADA 5CQ3A 4YATA 4WHUA 5ENJA 4Z1SA 5A5OA 4PY6A 2OO1A 3TLPA 5D3SA 5H1TA 5II1A 5CGPA 5CQ8A 3NXBA 5EWDA 4HXOA 5FG6A 5LKUA 2RO1A 3SVHA 2YQDA 4QSUA 4NQNA 5ENHA 2RS9B 3K2JA 4PCEA 5DY7A 5EISA 4NR6A 5EWHA 5HRVA 5HM0A 1JM4B 4KV1A 5G4SA 2DWWA 5D3PA 4UYEA 5F5ZA 2YEKA 5DKHA 5CUDA 4A9JA 5HFRA 4PKLA 5D3LA 5CY9A 3D7CA 4NYVA 2E3KA 4YAXA 5ETDA 5F1LA 3G0LA 5E74A 5E9KA 2FSAA 4O77A 4MENA 2WP2A 5DLXA 4YH3A 5BT5A 4QB3A 4ZQLA 5C7NA 3U5OA 5D24A 2G4AA 4HBYA 5I88A 5A81A 3HMHA 4NUEA 5I7XA 4UIWA 4UIYA 5II2A 5L8TA 3O36A 4N4IA 2DVVA 5ENIA 5ENEA 4UITA 4O7EA 3HMEA 4MEQA 4KV4A 5COIA 3LQIA 3JVMA 4ALGA 3IU5A 5CUEA 2GRCA 3MB3A 4UIVA 5HRXA 4O76A 2L5EA 3P1EA 5IGLA 4F3IA 5EGUA 4NQMA 5FFWA 4UIUA 5AD3A 5HRWA 4NS5A 5I40A 5TCMA 3P5OA 5JWMA 5C87A 5A5SA 5EP7A 2RI7A 4O71A 5J0DA 4YC9A 4LR6A 5FFYA 4J3IA 4YYKA 5AMFA 4NR7A 5HELA 4OGIA 5DKCA 3S91A 5KHMA 5LUUA 4NUDA 4QSRA 2DVQA 4O70A 5L96A 5LVQA 5FFVA 5HLSA 5FE2A 3O33A 3JVLA 3JVKA 5H1VA 4AKNA 4IR5A 2I8NA 5DBMA 5L8UA 5FE7A 2LSPB 4C66A 4XUAA 4YH4A 5G4RA 5LJ2A 5EICA 5FE4A 5KU3A 5F62A 5EPRA 5IIDA 5D3RA 5E9LA 4CFLA 3GG3A 5I80A 5CPEA 5F1HA 4NR5A 2YYNA 4YABA 4A9IA 5L99A 3LQHA 3AQAA 4C67A 5EWCA 2WP1A 2E7OA 4YYNA 5BT4A 5A83A 5IGNA 5CTLA 5EV9A 5DYCA 5DLZA 4UYFB 5HEMA 4UIZA 3O37A 5I89A 4UYHA 5ENGA 4PCIA 4QUUA 5CQ4A 2RFJA 5A82A 5C89A 5EU1A 3U5JA 4QUTA 4CUTA 4NYWA 4A9HA 5D3NA 5I1QA 4MR3A 5A5NA 5FB0A 3UVDA 1F68A 2RNXA 5D3JA 3QZSA 5I7YA 5D3TA 5IG6A 5AMEA 4J0SA 4A9EA 2R0YA 5FE1A 5LJ1A 5E9IA 3U5LA 4NR8A 5A5RA 5EI4A 5L97A 4QSWA 4DONA 5FE9A 3U5PA 5E0RA 5HQ5A 4HXPA 4IR4A 4A9OA 5KTXA 3U5MA 5FE8A 4TU6A 5FG5A 4BHWA 5FE0A 5CRMA 4PTBA 3O34A 5DFBA 3UVXA 4TYLA 5CUCA 4N3WA 4ZW1A 4IOQA 4NRBA 4QYDA 5IGMA 2KTBB 5CZGA 2MJVB 2DATA 4TT4A 3U5NA 3MXFA 4MR4A 4XY8A 3MQMA 4HXNA 5CQ7A 5F36A 3ONIA 2RNWA 2L84A 4NYXA 4QR3A 4QSSA 2YELA 2R0VA 3LXJA 4ZC9A 3UVWA 5A7CA 3QZVA 4E96A 4QC1A 5H1UA 2YDWA 5F63A 5F60A 2YEMA 4MEPA 5JI8A 4MR5A 4YK0A 4QZSA 3UW9A 4MEOA 4N4FA 5CRZA 3DWYA 3MB4A 4QY4A 3IU6A 5E73A 4UYDA 5A5QA 5FH8A 5DW1A 4HBWA 4OUFA 5FB1A 5I86A 2OSSA 5DX4A 3U5KA 5CQ5A 1ZS5A 4YBTA 4O78A 5ENFA 2D9EA 5CUAA 4BW4A 4QR4A 5LJ0A 4KCXA 4HXLA 4FLPA 5LKXA 2DKWA 4NRAA 4N4GA 4J1PA 5CQAA 2R10A 3AADA 3FKMX 5KO4A 4QSQA 5F25A 4YYJA 2L85A 4TTEA 4HXKA 5F3AA 4HBVA 5FG4A 4LZ2A 5CQTA 4N4HA 5ENBA 4HXMA 5TB6A 5E3DA 5C85A 4Q0OA 4O7AA 5CP5A 5HFQA 4YY6A 3S92A 4O74A 4TZ2A 1X0JA 4YYGA 5LKTA 4UYGA 5D7XA 3G0JA 3O35A 4QEVA 5FE5A 5EK9A 4IR3A 4QNSA 5E9YA 5EWVA 4GPJA 2RNYA 5FH6A 5HJCA 4CLBA 5EPSA 5C4QA 4QBMA 5D3HA 3UV4A 3LJWA 3UV2A 4CFKA 4YYDA 4MR6A 3MUKA 3DAIA 5CFWA 5K29A 3Q2FA 4HXRA 4BW2A 5EM3A 5EWWA 4O72A 4QSTA 2DVSA 3LQJA 4Z6HA 5DYAA 5A85A 4CUQA 5H85A 4IORA 1EQFA 4XY9A 5DKDA 3SVGA 3UVYA 5CS8A 3P1FA 5F2PA 4TT6A 4O7BA 3QZTA 5CUGA 5KTWA 5FE6A 4LDFA 4A9LA 4HXSA 4LYWA 5HENA 4YBSA 5FE3A 2D82A 2YW5A 4TU4A 4CUUA 5EA1A 4XUBA 4ALHA 4YY4A 4YYHA 4QEWA 4OGJA 3JVJA 5I29A 5E7DA 4Z93A 4J0RA 4NUCA 4Q0NA 4NXJA 4QR5A 2E7NA 4Z6IA 4QEUA 3ZYUA 5IBNA 2F6JA 1WUMA 3P1DA 3I3JA 5L98A 1JSPB 5CUBA 5DFDA 4TS8A 4QC3A 4NR9A 3Q2EA 4HBXA 4LZSA 4CUPA 5ENCA 5I83A 3RCWA 4LRGA 4O75A 4TZ8A 5D26A 4RVRA 2DVRA 4Z1QA 4WHWA 4CURA 4A9MA 2OUOA 2R0SA 4NR4A 4IR6A 4NRCA 4XYAA 4CL9A 2F6NA 4A9NA 4YBMA 2N9GA 4LZRA 2NXBA 5DYUA 4LYSA 5HCLA 4A9KA 4CUSA 5E9VA 2I7KA 4QSXA 5FDZA 5DYXA 5HQ6A 4O7FA 2H60A 5DW2A 4BJXA 5E3GA 1E6IA 4YYMA 4IOOA 5D0CA 5ACYA 3SVFA 4BW1A
chains in the Genus database with same CATH superfamily
5FH7A 4LYIA 4Y03A 5D25A 5LVRA 5DFCA 4QYLA 5EPBA 5EQ1A 5LKZA 3MULA 4LC2A 5AD2A 4QSVA 4BW3A 4X2IA 5EVAA 3UV5A 3HMFA 1N72A 1WUGA 5HQ7A 5FBXA 4A9FA 5BT3A 4WIVA 4TT2A 3D1DA 1ZKRA 5E9MA 5C8GA 2EJNA 4YYIA 5CU8A 4UIXA 5CQ6A 4UYFA 3P1CA 5ETBA 5KTUA 4TQNA 5F61A 4PS5A 1PUOA 3D1BA 4O7CA 5A5PA 5IGKA 4QSPA 4YADA 5CQ3A 4YATA 4WHUA 5ENJA 4Z1SA 5A5OA 4PY6A 2OO1A 4AKIA 3TLPA 5D3SA 5H1TA 5II1A 5CGPA 5CQ8A 3NXBA 5EWDA 4HXOA 5FG6A 5LKUA 2RO1A 3SVHA 2YQDA 4QSUA 4NQNA 5ENHA 2RS9B 3K2JA 4PCEA 5DY7A 5EISA 4NR6A 5EWHA 5HRVA 5HM0A 1JM4B 4KV1A 5G4SA 2DWWA 5D3PA 4UYEA 5F5ZA 2YEKA 5DKHA 5CUDA 4A9JA 5HFRA 4PKLA 5D3LA 5CY9A 3D7CA 4NYVA 2E3KA 4YAXA 5ETDA 5F1LA 3G0LA 5E74A 5E9KA 2FSAA 4O77A 4MENA 2WP2A 5DLXA 4YH3A 5BT5A 4QB3A 4ZQLA 5C7NA 3U5OA 5D24A 2G4AA 4HBYA 5I88A 5A81A 3HMHA 4NUEA 5I7XA 4UIWA 4UIYA 5II2A 5L8TA 3O36A 4N4IA 2DVVA 5ENIA 5ENEA 4UITA 4O7EA 3HMEA 4MEQA 4KV4A 5COIA 3LQIA 3JVMA 4ALGA 3IU5A 5CUEA 2GRCA 3MB3A 4UIVA 5HRXA 4O76A 2L5EA 3P1EA 5IGLA 4F3IA 5EGUA 4NQMA 5FFWA 4UIUA 5AD3A 5HRWA 4NS5A 5I40A 5TCMA 3P5OA 5JWMA 5C87A 5A5SA 5EP7A 2RI7A 4O71A 5J0DA 4YC9A 4LR6A 5FFYA 4J3IA 4YYKA 5AMFA 4NR7A 5HELA 4OGIA 5DKCA 3S91A 5KHMA 5LUUA 4NUDA 4QSRA 2DVQA 4O70A 5L96A 5LVQA 5FFVA 5HLSA 5FE2A 3O33A 3JVLA 3JVKA 5H1VA 4AKNA 4IR5A 2I8NA 5DBMA 5L8UA 5FE7A 2LSPB 4C66A 4XUAA 4YH4A 4AI6A 5G4RA 5LJ2A 5EICA 5FE4A 5KU3A 5F62A 5EPRA 5IIDA 5D3RA 5E9LA 4CFLA 3GG3A 5I80A 5CPEA 5F1HA 4NR5A 2YYNA 4YABA 4A9IA 5L99A 3LQHA 3AQAA 4C67A 5EWCA 2WP1A 2E7OA 4YYNA 5BT4A 5A83A 5IGNA 5CTLA 5EV9A 5DYCA 5DLZA 4UYFB 5HEMA 4UIZA 3O37A 5I89A 4UYHA 5ENGA 4PCIA 4QUUA 5CQ4A 2RFJA 5A82A 5C89A 5EU1A 3U5JA 4QUTA 4CUTA 4NYWA 4A9HA 5D3NA 5I1QA 4MR3A 5A5NA 5FB0A 3UVDA 3VKHA 1F68A 2RNXA 5D3JA 3QZSA 5I7YA 5D3TA 5IG6A 5AMEA 4AKHA 4J0SA 4A9EA 2R0YA 5FE1A 5LJ1A 5E9IA 3U5LA 4NR8A 5A5RA 5EI4A 5L97A 4QSWA 4DONA 5FE9A 3U5PA 5E0RA 5HQ5A 4HXPA 4IR4A 4A9OA 5KTXA 3U5MA 5FE8A 4TU6A 5FG5A 4BHWA 5FE0A 5CRMA 4PTBA 3O34A 5DFBA 3UVXA 4TYLA 5CUCA 4N3WA 4ZW1A 4IOQA 4NRBA 4QYDA 5IGMA 2KTBB 5CZGA 2MJVB 2DATA 4TT4A 3U5NA 3MXFA 4MR4A 4XY8A 3MQMA 4HXNA 5CQ7A 5F36A 3ONIA 2RNWA 2L84A 4NYXA 4QR3A 4QSSA 2YELA 2R0VA 3LXJA 4ZC9A 3UVWA 5A7CA 3QZVA 4E96A 4QC1A 5H1UA 2YDWA 5F63A 5F60A 2YEMA 4MEPA 5JI8A 4MR5A 4YK0A 4QZSA 3UW9A 4MEOA 4N4FA 5CRZA 3DWYA 3MB4A 4AKGA 4QY4A 3IU6A 5E73A 4UYDA 5A5QA 5FH8A 5DW1A 4HBWA 4OUFA 5FB1A 5I86A 2OSSA 5DX4A 3U5KA 5CQ5A 1ZS5A 4YBTA 4O78A 5ENFA 2D9EA 5CUAA 4BW4A 4QR4A 5LJ0A 4KCXA 4HXLA 4FLPA 5LKXA 2DKWA 4NRAA 4N4GA 4J1PA 5CQAA 2R10A 3AADA 3FKMX 5KO4A 4QSQA 5F25A 4YYJA 2L85A 4TTEA 4HXKA 5F3AA 4HBVA 5FG4A 3ERRA 4LZ2A 5CQTA 4N4HA 5ENBA 4HXMA 5TB6A 5E3DA 5C85A 4Q0OA 4O7AA 5CP5A 5HFQA 4YY6A 3S92A 4O74A 4TZ2A 1X0JA 4YYGA 5LKTA 4UYGA 5D7XA 3G0JA 3O35A 4QEVA 5FE5A 5EK9A 4IR3A 4QNSA 5E9YA 5EWVA 4GPJA 2RNYA 5FH6A 5HJCA 4CLBA 5EPSA 5C4QA 4QBMA 5D3HA 3UV4A 3LJWA 3UV2A 4CFKA 4YYDA 4MR6A 3MUKA 3DAIA 5CFWA 5K29A 3Q2FA 4HXRA 4BW2A 5EM3A 5EWWA 4O72A 4QSTA 2DVSA 3LQJA 4Z6HA 5DYAA 5A85A 4CUQA 5H85A 4IORA 1EQFA 4XY9A 5DKDA 3SVGA 3UVYA 5CS8A 3P1FA 5F2PA 4TT6A 4O7BA 3QZTA 5CUGA 5KTWA 5FE6A 4LDFA 4A9LA 4HXSA 4LYWA 5HENA 4YBSA 5FE3A 2D82A 2YW5A 4TU4A 4CUUA 5EA1A 4XUBA 4ALHA 4YY4A 4YYHA 4QEWA 4OGJA 3VKGA 3JVJA 5I29A 5E7DA 4Z93A 4J0RA 4NUCA 4Q0NA 4NXJA 4QR5A 2E7NA 4Z6IA 4QEUA 3ZYUA 5IBNA 2F6JA 1WUMA 3P1DA 3I3JA 5L98A 1JSPB 5CUBA 5DFDA 4TS8A 4QC3A 4NR9A 3Q2EA 4HBXA 4LZSA 4CUPA 5ENCA 5I83A 3RCWA 4LRGA 4O75A 4TZ8A 5D26A 4RVRA 2DVRA 4Z1QA 4WHWA 4CURA 4A9MA 2OUOA 2R0SA 4NR4A 4IR6A 4NRCA 4XYAA 4CL9A 2F6NA 4A9NA 4YBMA 2N9GA 4LZRA 2NXBA 5DYUA 4LYSA 5HCLA 4A9KA 4CUSA 5E9VA 2I7KA 4QSXA 5FDZA 5DYXA 5HQ6A 4O7FA 2H60A 5DW2A 4BJXA 5E3GA 1E6IA 4YYMA 4IOOA 5D0CA 5ACYA 3SVFA 4BW1A
chains in the Genus database with same CATH topology
5FH7A 4LYIA 4Y03A 5D25A 5LVRA 5DFCA 4QYLA 5EPBA 5EQ1A 5LKZA 3MULA 4LC2A 5AD2A 4QSVA 4BW3A 4X2IA 5EVAA 3UV5A 3HMFA 1N72A 1WUGA 5HQ7A 5FBXA 4A9FA 5BT3A 4WIVA 4TT2A 5E9MA 5C8GA 4YYIA 5CU8A 4UIXA 5CQ6A 4UYFA 3P1CA 5ETBA 5KTUA 4TQNA 5F61A 4PS5A 4O7CA 5A5PA 5IGKA 4QSPA 4YADA 5CQ3A 4YATA 4WHUA 5ENJA 4Z1SA 5A5OA 4PY6A 2OO1A 3TLPA 5D3SA 5H1TA 5II1A 5CGPA 5CQ8A 3NXBA 5EWDA 4HXOA 5FG6A 5LKUA 2RO1A 3SVHA 2YQDA 4QSUA 4NQNA 5ENHA 2RS9B 3K2JA 4PCEA 5DY7A 5EISA 4NR6A 5EWHA 5HRVA 5HM0A 1JM4B 4KV1A 5G4SA 2DWWA 5D3PA 4UYEA 5F5ZA 2YEKA 5DKHA 5CUDA 4A9JA 5HFRA 4PKLA 5D3LA 5CY9A 3D7CA 4NYVA 2E3KA 4YAXA 5ETDA 5F1LA 3G0LA 5E74A 5E9KA 2FSAA 4O77A 4MENA 2WP2A 5DLXA 4YH3A 5BT5A 4QB3A 4ZQLA 5C7NA 3U5OA 5D24A 2G4AA 4HBYA 5I88A 5A81A 3HMHA 4NUEA 5I7XA 4UIWA 4UIYA 5II2A 5L8TA 3O36A 4N4IA 2DVVA 5ENIA 5ENEA 4UITA 4O7EA 3HMEA 4MEQA 4KV4A 5COIA 3LQIA 3JVMA 4ALGA 3IU5A 5CUEA 2GRCA 3MB3A 4UIVA 5HRXA 4O76A 2L5EA 3P1EA 5IGLA 4F3IA 5EGUA 4NQMA 5FFWA 4UIUA 5AD3A 5HRWA 4NS5A 5I40A 5TCMA 3P5OA 5JWMA 5C87A 5A5SA 5EP7A 2RI7A 4O71A 5J0DA 4YC9A 4LR6A 5FFYA 4J3IA 4YYKA 5AMFA 4NR7A 5HELA 4OGIA 5DKCA 3S91A 5KHMA 5LUUA 4NUDA 4QSRA 2DVQA 4O70A 5L96A 5LVQA 5FFVA 5HLSA 5FE2A 3O33A 3JVLA 3JVKA 5H1VA 4AKNA 4IR5A 2I8NA 5DBMA 5L8UA 5FE7A 2LSPB 4C66A 4XUAA 4YH4A 5G4RA 5LJ2A 5EICA 5FE4A 5KU3A 5F62A 5EPRA 5IIDA 5D3RA 5E9LA 4CFLA 3GG3A 5I80A 5CPEA 5F1HA 4NR5A 2YYNA 4YABA 4A9IA 5L99A 3LQHA 3AQAA 4C67A 5EWCA 2WP1A 2E7OA 4YYNA 5BT4A 5A83A 5IGNA 5CTLA 5EV9A 5DYCA 5DLZA 4UYFB 5HEMA 4UIZA 3O37A 5I89A 4UYHA 5ENGA 4PCIA 4QUUA 5CQ4A 2RFJA 5A82A 5C89A 5EU1A 3U5JA 4QUTA 4CUTA 4NYWA 4A9HA 5D3NA 5I1QA 4MR3A 5A5NA 5FB0A 3UVDA 1F68A 2RNXA 5D3JA 3QZSA 5I7YA 5D3TA 5IG6A 5AMEA 4J0SA 4A9EA 2R0YA 5FE1A 5LJ1A 5E9IA 3U5LA 4NR8A 5A5RA 5EI4A 5L97A 4QSWA 4DONA 5FE9A 3U5PA 5E0RA 5HQ5A 4HXPA 4IR4A 4A9OA 5KTXA 3U5MA 5FE8A 4TU6A 5FG5A 4BHWA 5FE0A 5CRMA 4PTBA 3O34A 5DFBA 3UVXA 4TYLA 5CUCA 4N3WA 4ZW1A 4IOQA 4NRBA 4QYDA 5IGMA 2KTBB 5CZGA 2MJVB 2DATA 4TT4A 3U5NA 3MXFA 4MR4A 4XY8A 3MQMA 4HXNA 5CQ7A 5F36A 3ONIA 2RNWA 2L84A 4NYXA 4QR3A 4QSSA 2YELA 2R0VA 3LXJA 4ZC9A 3UVWA 5A7CA 3QZVA 4E96A 4QC1A 5H1UA 2YDWA 5F63A 5F60A 2YEMA 4MEPA 5JI8A 4MR5A 4YK0A 4QZSA 3UW9A 4MEOA 4N4FA 5CRZA 3DWYA 3MB4A 4QY4A 3IU6A 5E73A 4UYDA 5A5QA 5FH8A 5DW1A 4HBWA 4OUFA 5FB1A 5I86A 2OSSA 5DX4A 3U5KA 5CQ5A 1ZS5A 4YBTA 4O78A 5ENFA 2D9EA 5CUAA 4BW4A 4QR4A 5LJ0A 4KCXA 4HXLA 4FLPA 5LKXA 2DKWA 4NRAA 4N4GA 4J1PA 5CQAA 2R10A 3AADA 3FKMX 5KO4A 4QSQA 5F25A 4YYJA 2L85A 4TTEA 4HXKA 5F3AA 4HBVA 5FG4A 4LZ2A 5CQTA 4N4HA 5ENBA 4HXMA 5TB6A 5E3DA 5C85A 4Q0OA 4O7AA 5CP5A 5HFQA 4YY6A 3S92A 4O74A 4TZ2A 1X0JA 4YYGA 5LKTA 4UYGA 5D7XA 3G0JA 3O35A 4QEVA 5FE5A 5EK9A 4IR3A 4QNSA 5E9YA 5EWVA 4GPJA 2RNYA 5FH6A 5HJCA 4CLBA 5EPSA 5C4QA 4QBMA 5D3HA 3UV4A 3LJWA 3UV2A 4CFKA 4YYDA 4MR6A 3MUKA 3DAIA 5CFWA 5K29A 3Q2FA 4HXRA 4BW2A 5EM3A 5EWWA 4O72A 4QSTA 2DVSA 3LQJA 4Z6HA 5DYAA 5A85A 4CUQA 5H85A 4IORA 1EQFA 4XY9A 5DKDA 3SVGA 3UVYA 5CS8A 3P1FA 5F2PA 4TT6A 4O7BA 3QZTA 5CUGA 5KTWA 5FE6A 4LDFA 4A9LA 4HXSA 4LYWA 5HENA 4YBSA 5FE3A 2D82A 2YW5A 4TU4A 4CUUA 5EA1A 4XUBA 4ALHA 4YY4A 4YYHA 4QEWA 4OGJA 3JVJA 5I29A 5E7DA 4Z93A 4J0RA 4NUCA 4Q0NA 4NXJA 4QR5A 2E7NA 4Z6IA 4QEUA 3ZYUA 5IBNA 2F6JA 1WUMA 3P1DA 3I3JA 5L98A 1JSPB 5CUBA 5DFDA 4TS8A 4QC3A 4NR9A 3Q2EA 4HBXA 4LZSA 4CUPA 5ENCA 5I83A 3RCWA 4LRGA 4O75A 4TZ8A 5D26A 4RVRA 2DVRA 4Z1QA 4WHWA 4CURA 4A9MA 2OUOA 2R0SA 4NR4A 4IR6A 4NRCA 4XYAA 4CL9A 2F6NA 4A9NA 4YBMA 2N9GA 4LZRA 2NXBA 5DYUA 4LYSA 5HCLA 4A9KA 4CUSA 5E9VA 2I7KA 4QSXA 5FDZA 5DYXA 5HQ6A 4O7FA 2H60A 5DW2A 4BJXA 5E3GA 1E6IA 4YYMA 4IOOA 5D0CA 5ACYA 3SVFA 4BW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH7 A;  4LYI A;  4Y03 A;  5D25 A;  5LVR A;  5DFC A;  4QYL A;  5EPB A;  5EQ1 A;  5LKZ A;  3MUL A;  4LC2 A;  5AD2 A;  4QSV A;  4BW3 A;  4X2I A;  5EVA A;  3UV5 A;  3HMF A;  1N72 A;  1WUG A;  5HQ7 A;  5FBX A;  4A9F A;  5BT3 A;  4WIV A;  4TT2 A;  5E9M A;  5C8G A;  4YYI A;  5CU8 A;  4UIX A;  5CQ6 A;  4UYF A;  3P1C A;  5ETB A;  5KTU A;  4TQN A;  5F61 A;  4PS5 A;  4O7C A;  5A5P A;  5IGK A;  4QSP A;  4YAD A;  5CQ3 A;  4YAT A;  4WHU A;  5ENJ A;  4Z1S A;  5A5O A;  4PY6 A;  2OO1 A;  3TLP A;  5D3S A;  5H1T A;  5II1 A;  5CGP A;  5CQ8 A;  3NXB A;  5EWD A;  4HXO A;  5FG6 A;  5LKU A;  2RO1 A;  3SVH A;  2YQD A;  4QSU A;  4NQN A;  5ENH A;  2RS9 B;  3K2J A;  4PCE A;  5DY7 A;  5EIS A;  4NR6 A;  5EWH A;  5HRV A;  5HM0 A;  1JM4 B;  4KV1 A;  5G4S A;  2DWW A;  5D3P A;  4UYE A;  5F5Z A;  2YEK A;  5DKH A;  5CUD A;  4A9J A;  5HFR A;  4PKL A;  5D3L A;  5CY9 A;  3D7C A;  4NYV A;  2E3K A;  4YAX A;  5ETD A;  5F1L A;  3G0L A;  5E74 A;  5E9K A;  2FSA A;  4O77 A;  4MEN A;  2WP2 A;  5DLX A;  4YH3 A;  5BT5 A;  4QB3 A;  4ZQL A;  5C7N A;  3U5O A;  5D24 A;  2G4A A;  4HBY A;  5I88 A;  5A81 A;  3HMH A;  4NUE A;  5I7X A;  4UIW A;  4UIY A;  5II2 A;  5L8T A;  3O36 A;  4N4I A;  2DVV A;  5ENI A;  5ENE A;  4UIT A;  4O7E A;  3HME A;  4MEQ A;  4KV4 A;  5COI A;  3LQI A;  3JVM A;  4ALG A;  3IU5 A;  5CUE A;  2GRC A;  3MB3 A;  4UIV A;  5HRX A;  4O76 A;  2L5E A;  3P1E A;  5IGL A;  4F3I A;  5EGU A;  4NQM A;  5FFW A;  4UIU A;  5AD3 A;  5HRW A;  4NS5 A;  5I40 A;  5TCM A;  3P5O A;  5JWM A;  5C87 A;  5A5S A;  5EP7 A;  2RI7 A;  4O71 A;  5J0D A;  4YC9 A;  4LR6 A;  5FFY A;  4J3I A;  4YYK A;  5AMF A;  4NR7 A;  5HEL A;  4OGI A;  5DKC A;  3S91 A;  5KHM A;  5LUU A;  4NUD A;  4QSR A;  2DVQ A;  4O70 A;  5L96 A;  5LVQ A;  5FFV A;  5HLS A;  5FE2 A;  3O33 A;  3JVL A;  3JVK A;  5H1V A;  4AKN A;  4IR5 A;  2I8N A;  5DBM A;  5L8U A;  5FE7 A;  2LSP B;  4C66 A;  4XUA A;  4YH4 A;  5G4R A;  5LJ2 A;  5EIC A;  5FE4 A;  5KU3 A;  5F62 A;  5EPR A;  5IID A;  5D3R A;  5E9L A;  4CFL A;  3GG3 A;  5I80 A;  5CPE A;  5F1H A;  4NR5 A;  2YYN A;  4YAB A;  4A9I A;  5L99 A;  3LQH A;  3AQA A;  4C67 A;  5EWC A;  2WP1 A;  2E7O A;  4YYN A;  5BT4 A;  5A83 A;  5IGN A;  5CTL A;  5EV9 A;  5DYC A;  5DLZ A;  4UYF B;  5HEM A;  4UIZ A;  3O37 A;  5I89 A;  4UYH A;  5ENG A;  4PCI A;  4QUU A;  5CQ4 A;  2RFJ A;  5A82 A;  5C89 A;  5EU1 A;  3U5J A;  4QUT A;  4CUT A;  4NYW A;  4A9H A;  5D3N A;  5I1Q A;  4MR3 A;  5A5N A;  5FB0 A;  3UVD A;  1F68 A;  2RNX A;  5D3J A;  3QZS A;  5I7Y A;  5D3T A;  5IG6 A;  5AME A;  4J0S A;  4A9E A;  2R0Y A;  5FE1 A;  5LJ1 A;  5E9I A;  3U5L A;  4NR8 A;  5A5R A;  5EI4 A;  5L97 A;  4QSW A;  4DON A;  5FE9 A;  3U5P A;  5E0R A;  5HQ5 A;  4HXP A;  4IR4 A;  4A9O A;  5KTX A;  3U5M A;  5FE8 A;  4TU6 A;  5FG5 A;  4BHW A;  5FE0 A;  5CRM A;  4PTB A;  3O34 A;  5DFB A;  3UVX A;  4TYL A;  5CUC A;  4N3W A;  4ZW1 A;  4IOQ A;  4NRB A;  4QYD A;  5IGM A;  2KTB B;  5CZG A;  2MJV B;  2DAT A;  4TT4 A;  3U5N A;  3MXF A;  4MR4 A;  4XY8 A;  3MQM A;  4HXN A;  5CQ7 A;  5F36 A;  3ONI A;  2RNW A;  2L84 A;  4NYX A;  4QR3 A;  4QSS A;  2YEL A;  2R0V A;  3LXJ A;  4ZC9 A;  3UVW A;  5A7C A;  3QZV A;  4E96 A;  4QC1 A;  5H1U A;  2YDW A;  5F63 A;  5F60 A;  2YEM A;  4MEP A;  5JI8 A;  4MR5 A;  4YK0 A;  4QZS A;  3UW9 A;  4MEO A;  4N4F A;  5CRZ A;  3DWY A;  3MB4 A;  4QY4 A;  3IU6 A;  5E73 A;  4UYD A;  5A5Q A;  5FH8 A;  5DW1 A;  4HBW A;  4OUF A;  5FB1 A;  5I86 A;  2OSS A;  5DX4 A;  3U5K A;  5CQ5 A;  1ZS5 A;  4YBT A;  4O78 A;  5ENF A;  2D9E A;  5CUA A;  4BW4 A;  4QR4 A;  5LJ0 A;  4KCX A;  4HXL A;  4FLP A;  5LKX A;  2DKW A;  4NRA A;  4N4G A;  4J1P A;  5CQA A;  2R10 A;  3AAD A;  3FKM X;  5KO4 A;  4QSQ A;  5F25 A;  4YYJ A;  2L85 A;  4TTE A;  4HXK A;  5F3A A;  4HBV A;  5FG4 A;  4LZ2 A;  5CQT A;  4N4H A;  5ENB A;  4HXM A;  5TB6 A;  5E3D A;  5C85 A;  4Q0O A;  4O7A A;  5CP5 A;  5HFQ A;  4YY6 A;  3S92 A;  4O74 A;  4TZ2 A;  1X0J A;  4YYG A;  5LKT A;  4UYG A;  5D7X A;  3G0J A;  3O35 A;  4QEV A;  5FE5 A;  5EK9 A;  4IR3 A;  4QNS A;  5E9Y A;  5EWV A;  4GPJ A;  2RNY A;  5FH6 A;  5HJC A;  4CLB A;  5EPS A;  5C4Q A;  4QBM A;  5D3H A;  3UV4 A;  3LJW A;  3UV2 A;  4CFK A;  4YYD A;  4MR6 A;  3MUK A;  3DAI A;  5CFW A;  5K29 A;  3Q2F A;  4HXR A;  4BW2 A;  5EM3 A;  5EWW A;  4O72 A;  4QST A;  2DVS A;  3LQJ A;  4Z6H A;  5DYA A;  5A85 A;  4CUQ A;  5H85 A;  4IOR A;  1EQF A;  4XY9 A;  5DKD A;  3SVG A;  3UVY A;  5CS8 A;  3P1F A;  5F2P A;  4TT6 A;  4O7B A;  3QZT A;  5CUG A;  5KTW A;  5FE6 A;  4LDF A;  4A9L A;  4HXS A;  4LYW A;  5HEN A;  4YBS A;  5FE3 A;  2D82 A;  2YW5 A;  4TU4 A;  4CUU A;  5EA1 A;  4XUB A;  4ALH A;  4YY4 A;  4YYH A;  4QEW A;  4OGJ A;  3JVJ A;  5I29 A;  5E7D A;  4Z93 A;  4J0R A;  4NUC A;  4Q0N A;  4NXJ A;  4QR5 A;  2E7N A;  4Z6I A;  4QEU A;  3ZYU A;  5IBN A;  2F6J A;  1WUM A;  3P1D A;  3I3J A;  5L98 A;  1JSP B;  5CUB A;  5DFD A;  4TS8 A;  4QC3 A;  4NR9 A;  3Q2E A;  4HBX A;  4LZS A;  4CUP A;  5ENC A;  5I83 A;  3RCW A;  4LRG A;  4O75 A;  4TZ8 A;  5D26 A;  4RVR A;  2DVR A;  4Z1Q A;  4WHW A;  4CUR A;  4A9M A;  2OUO A;  2R0S A;  4NR4 A;  4IR6 A;  4NRC A;  4XYA A;  4CL9 A;  2F6N A;  4A9N A;  4YBM A;  2N9G A;  4LZR A;  2NXB A;  5DYU A;  4LYS A;  5HCL A;  4A9K A;  4CUS A;  5E9V A;  2I7K A;  4QSX A;  5FDZ A;  5DYX A;  5HQ6 A;  4O7F A;  2H60 A;  5DW2 A;  4BJX A;  5E3G A;  1E6I A;  4YYM A;  4IOO A;  5D0C A;  5ACY A;  3SVF A;  4BW1 A; 
#chains in the Genus database with same CATH topology
 5FH7 A;  4LYI A;  4Y03 A;  5D25 A;  5LVR A;  5DFC A;  4QYL A;  5EPB A;  5EQ1 A;  5LKZ A;  3MUL A;  4LC2 A;  5AD2 A;  4QSV A;  4BW3 A;  4X2I A;  5EVA A;  3UV5 A;  3HMF A;  1N72 A;  1WUG A;  5HQ7 A;  5FBX A;  4A9F A;  5BT3 A;  4WIV A;  4TT2 A;  3D1D A;  1ZKR A;  5E9M A;  5C8G A;  2EJN A;  4YYI A;  5CU8 A;  4UIX A;  5CQ6 A;  4UYF A;  3P1C A;  5ETB A;  5KTU A;  4TQN A;  5F61 A;  4PS5 A;  1PUO A;  3D1B A;  4O7C A;  5A5P A;  5IGK A;  4QSP A;  4YAD A;  5CQ3 A;  4YAT A;  4WHU A;  5ENJ A;  4Z1S A;  5A5O A;  4PY6 A;  2OO1 A;  4AKI A;  3TLP A;  5D3S A;  5H1T A;  5II1 A;  5CGP A;  5CQ8 A;  3NXB A;  5EWD A;  4HXO A;  5FG6 A;  5LKU A;  2RO1 A;  3SVH A;  2YQD A;  4QSU A;  4NQN A;  5ENH A;  2RS9 B;  3K2J A;  4PCE A;  5DY7 A;  5EIS A;  4NR6 A;  5EWH A;  5HRV A;  5HM0 A;  1JM4 B;  4KV1 A;  5G4S A;  2DWW A;  5D3P A;  4UYE A;  5F5Z A;  2YEK A;  5DKH A;  5CUD A;  4A9J A;  5HFR A;  4PKL A;  5D3L A;  5CY9 A;  3D7C A;  4NYV A;  2E3K A;  4YAX A;  5ETD A;  5F1L A;  3G0L A;  5E74 A;  5E9K A;  2FSA A;  4O77 A;  4MEN A;  2WP2 A;  5DLX A;  4YH3 A;  5BT5 A;  4QB3 A;  4ZQL A;  5C7N A;  3U5O A;  5D24 A;  2G4A A;  4HBY A;  5I88 A;  5A81 A;  3HMH A;  4NUE A;  5I7X A;  4UIW A;  4UIY A;  5II2 A;  5L8T A;  3O36 A;  4N4I A;  2DVV A;  5ENI A;  5ENE A;  4UIT A;  4O7E A;  3HME A;  4MEQ A;  4KV4 A;  5COI A;  3LQI A;  3JVM A;  4ALG A;  3IU5 A;  5CUE A;  2GRC A;  3MB3 A;  4UIV A;  5HRX A;  4O76 A;  2L5E A;  3P1E A;  5IGL A;  4F3I A;  5EGU A;  4NQM A;  5FFW A;  4UIU A;  5AD3 A;  5HRW A;  4NS5 A;  5I40 A;  5TCM A;  3P5O A;  5JWM A;  5C87 A;  5A5S A;  5EP7 A;  2RI7 A;  4O71 A;  5J0D A;  4YC9 A;  4LR6 A;  5FFY A;  4J3I A;  4YYK A;  5AMF A;  4NR7 A;  5HEL A;  4OGI A;  5DKC A;  3S91 A;  5KHM A;  5LUU A;  4NUD A;  4QSR A;  2DVQ A;  4O70 A;  5L96 A;  5LVQ A;  5FFV A;  5HLS A;  5FE2 A;  3O33 A;  3JVL A;  3JVK A;  5H1V A;  4AKN A;  4IR5 A;  2I8N A;  5DBM A;  5L8U A;  5FE7 A;  2LSP B;  4C66 A;  4XUA A;  4YH4 A;  4AI6 A;  5G4R A;  5LJ2 A;  5EIC A;  5FE4 A;  5KU3 A;  5F62 A;  5EPR A;  5IID A;  5D3R A;  5E9L A;  4CFL A;  3GG3 A;  5I80 A;  5CPE A;  5F1H A;  4NR5 A;  2YYN A;  4YAB A;  4A9I A;  5L99 A;  3LQH A;  3AQA A;  4C67 A;  5EWC A;  2WP1 A;  2E7O A;  4YYN A;  5BT4 A;  5A83 A;  5IGN A;  5CTL A;  5EV9 A;  5DYC A;  5DLZ A;  4UYF B;  5HEM A;  4UIZ A;  3O37 A;  5I89 A;  4UYH A;  5ENG A;  4PCI A;  4QUU A;  5CQ4 A;  2RFJ A;  5A82 A;  5C89 A;  5EU1 A;  3U5J A;  4QUT A;  4CUT A;  4NYW A;  4A9H A;  5D3N A;  5I1Q A;  4MR3 A;  5A5N A;  5FB0 A;  3UVD A;  3VKH A;  1F68 A;  2RNX A;  5D3J A;  3QZS A;  5I7Y A;  5D3T A;  5IG6 A;  5AME A;  4AKH A;  4J0S A;  4A9E A;  2R0Y A;  5FE1 A;  5LJ1 A;  5E9I A;  3U5L A;  4NR8 A;  5A5R A;  5EI4 A;  5L97 A;  4QSW A;  4DON A;  5FE9 A;  3U5P A;  5E0R A;  5HQ5 A;  4HXP A;  4IR4 A;  4A9O A;  5KTX A;  3U5M A;  5FE8 A;  4TU6 A;  5FG5 A;  4BHW A;  5FE0 A;  5CRM A;  4PTB A;  3O34 A;  5DFB A;  3UVX A;  4TYL A;  5CUC A;  4N3W A;  4ZW1 A;  4IOQ A;  4NRB A;  4QYD A;  5IGM A;  2KTB B;  5CZG A;  2MJV B;  2DAT A;  4TT4 A;  3U5N A;  3MXF A;  4MR4 A;  4XY8 A;  3MQM A;  4HXN A;  5CQ7 A;  5F36 A;  3ONI A;  2RNW A;  2L84 A;  4NYX A;  4QR3 A;  4QSS A;  2YEL A;  2R0V A;  3LXJ A;  4ZC9 A;  3UVW A;  5A7C A;  3QZV A;  4E96 A;  4QC1 A;  5H1U A;  2YDW A;  5F63 A;  5F60 A;  2YEM A;  4MEP A;  5JI8 A;  4MR5 A;  4YK0 A;  4QZS A;  3UW9 A;  4MEO A;  4N4F A;  5CRZ A;  3DWY A;  3MB4 A;  4AKG A;  4QY4 A;  3IU6 A;  5E73 A;  4UYD A;  5A5Q A;  5FH8 A;  5DW1 A;  4HBW A;  4OUF A;  5FB1 A;  5I86 A;  2OSS A;  5DX4 A;  3U5K A;  5CQ5 A;  1ZS5 A;  4YBT A;  4O78 A;  5ENF A;  2D9E A;  5CUA A;  4BW4 A;  4QR4 A;  5LJ0 A;  4KCX A;  4HXL A;  4FLP A;  5LKX A;  2DKW A;  4NRA A;  4N4G A;  4J1P A;  5CQA A;  2R10 A;  3AAD A;  3FKM X;  5KO4 A;  4QSQ A;  5F25 A;  4YYJ A;  2L85 A;  4TTE A;  4HXK A;  5F3A A;  4HBV A;  5FG4 A;  3ERR A;  4LZ2 A;  5CQT A;  4N4H A;  5ENB A;  4HXM A;  5TB6 A;  5E3D A;  5C85 A;  4Q0O A;  4O7A A;  5CP5 A;  5HFQ A;  4YY6 A;  3S92 A;  4O74 A;  4TZ2 A;  1X0J A;  4YYG A;  5LKT A;  4UYG A;  5D7X A;  3G0J A;  3O35 A;  4QEV A;  5FE5 A;  5EK9 A;  4IR3 A;  4QNS A;  5E9Y A;  5EWV A;  4GPJ A;  2RNY A;  5FH6 A;  5HJC A;  4CLB A;  5EPS A;  5C4Q A;  4QBM A;  5D3H A;  3UV4 A;  3LJW A;  3UV2 A;  4CFK A;  4YYD A;  4MR6 A;  3MUK A;  3DAI A;  5CFW A;  5K29 A;  3Q2F A;  4HXR A;  4BW2 A;  5EM3 A;  5EWW A;  4O72 A;  4QST A;  2DVS A;  3LQJ A;  4Z6H A;  5DYA A;  5A85 A;  4CUQ A;  5H85 A;  4IOR A;  1EQF A;  4XY9 A;  5DKD A;  3SVG A;  3UVY A;  5CS8 A;  3P1F A;  5F2P A;  4TT6 A;  4O7B A;  3QZT A;  5CUG A;  5KTW A;  5FE6 A;  4LDF A;  4A9L A;  4HXS A;  4LYW A;  5HEN A;  4YBS A;  5FE3 A;  2D82 A;  2YW5 A;  4TU4 A;  4CUU A;  5EA1 A;  4XUB A;  4ALH A;  4YY4 A;  4YYH A;  4QEW A;  4OGJ A;  3VKG A;  3JVJ A;  5I29 A;  5E7D A;  4Z93 A;  4J0R A;  4NUC A;  4Q0N A;  4NXJ A;  4QR5 A;  2E7N A;  4Z6I A;  4QEU A;  3ZYU A;  5IBN A;  2F6J A;  1WUM A;  3P1D A;  3I3J A;  5L98 A;  1JSP B;  5CUB A;  5DFD A;  4TS8 A;  4QC3 A;  4NR9 A;  3Q2E A;  4HBX A;  4LZS A;  4CUP A;  5ENC A;  5I83 A;  3RCW A;  4LRG A;  4O75 A;  4TZ8 A;  5D26 A;  4RVR A;  2DVR A;  4Z1Q A;  4WHW A;  4CUR A;  4A9M A;  2OUO A;  2R0S A;  4NR4 A;  4IR6 A;  4NRC A;  4XYA A;  4CL9 A;  2F6N A;  4A9N A;  4YBM A;  2N9G A;  4LZR A;  2NXB A;  5DYU A;  4LYS A;  5HCL A;  4A9K A;  4CUS A;  5E9V A;  2I7K A;  4QSX A;  5FDZ A;  5DYX A;  5HQ6 A;  4O7F A;  2H60 A;  5DW2 A;  4BJX A;  5E3G A;  1E6I A;  4YYM A;  4IOO A;  5D0C A;  5ACY A;  3SVF A;  4BW1 A; 
#chains in the Genus database with same CATH homology
 5FH7 A;  4LYI A;  4Y03 A;  5D25 A;  5LVR A;  5DFC A;  4QYL A;  5EPB A;  5EQ1 A;  5LKZ A;  3MUL A;  4LC2 A;  5AD2 A;  4QSV A;  4BW3 A;  4X2I A;  5EVA A;  3UV5 A;  3HMF A;  1N72 A;  1WUG A;  5HQ7 A;  5FBX A;  4A9F A;  5BT3 A;  4WIV A;  4TT2 A;  5E9M A;  5C8G A;  4YYI A;  5CU8 A;  4UIX A;  5CQ6 A;  4UYF A;  3P1C A;  5ETB A;  5KTU A;  4TQN A;  5F61 A;  4PS5 A;  4O7C A;  5A5P A;  5IGK A;  4QSP A;  4YAD A;  5CQ3 A;  4YAT A;  4WHU A;  5ENJ A;  4Z1S A;  5A5O A;  4PY6 A;  2OO1 A;  3TLP A;  5D3S A;  5H1T A;  5II1 A;  5CGP A;  5CQ8 A;  3NXB A;  5EWD A;  4HXO A;  5FG6 A;  5LKU A;  2RO1 A;  3SVH A;  2YQD A;  4QSU A;  4NQN A;  5ENH A;  2RS9 B;  3K2J A;  4PCE A;  5DY7 A;  5EIS A;  4NR6 A;  5EWH A;  5HRV A;  5HM0 A;  1JM4 B;  4KV1 A;  5G4S A;  2DWW A;  5D3P A;  4UYE A;  5F5Z A;  2YEK A;  5DKH A;  5CUD A;  4A9J A;  5HFR A;  4PKL A;  5D3L A;  5CY9 A;  3D7C A;  4NYV A;  2E3K A;  4YAX A;  5ETD A;  5F1L A;  3G0L A;  5E74 A;  5E9K A;  2FSA A;  4O77 A;  4MEN A;  2WP2 A;  5DLX A;  4YH3 A;  5BT5 A;  4QB3 A;  4ZQL A;  5C7N A;  3U5O A;  5D24 A;  2G4A A;  4HBY A;  5I88 A;  5A81 A;  3HMH A;  4NUE A;  5I7X A;  4UIW A;  4UIY A;  5II2 A;  5L8T A;  3O36 A;  4N4I A;  2DVV A;  5ENI A;  5ENE A;  4UIT A;  4O7E A;  3HME A;  4MEQ A;  4KV4 A;  5COI A;  3LQI A;  3JVM A;  4ALG A;  3IU5 A;  5CUE A;  2GRC A;  3MB3 A;  4UIV A;  5HRX A;  4O76 A;  2L5E A;  3P1E A;  5IGL A;  4F3I A;  5EGU A;  4NQM A;  5FFW A;  4UIU A;  5AD3 A;  5HRW A;  4NS5 A;  5I40 A;  5TCM A;  3P5O A;  5JWM A;  5C87 A;  5A5S A;  5EP7 A;  2RI7 A;  4O71 A;  5J0D A;  4YC9 A;  4LR6 A;  5FFY A;  4J3I A;  4YYK A;  5AMF A;  4NR7 A;  5HEL A;  4OGI A;  5DKC A;  3S91 A;  5KHM A;  5LUU A;  4NUD A;  4QSR A;  2DVQ A;  4O70 A;  5L96 A;  5LVQ A;  5FFV A;  5HLS A;  5FE2 A;  3O33 A;  3JVL A;  3JVK A;  5H1V A;  4AKN A;  4IR5 A;  2I8N A;  5DBM A;  5L8U A;  5FE7 A;  2LSP B;  4C66 A;  4XUA A;  4YH4 A;  5G4R A;  5LJ2 A;  5EIC A;  5FE4 A;  5KU3 A;  5F62 A;  5EPR A;  5IID A;  5D3R A;  5E9L A;  4CFL A;  3GG3 A;  5I80 A;  5CPE A;  5F1H A;  4NR5 A;  2YYN A;  4YAB A;  4A9I A;  5L99 A;  3LQH A;  3AQA A;  4C67 A;  5EWC A;  2WP1 A;  2E7O A;  4YYN A;  5BT4 A;  5A83 A;  5IGN A;  5CTL A;  5EV9 A;  5DYC A;  5DLZ A;  4UYF B;  5HEM A;  4UIZ A;  3O37 A;  5I89 A;  4UYH A;  5ENG A;  4PCI A;  4QUU A;  5CQ4 A;  2RFJ A;  5A82 A;  5C89 A;  5EU1 A;  3U5J A;  4QUT A;  4CUT A;  4NYW A;  4A9H A;  5D3N A;  5I1Q A;  4MR3 A;  5A5N A;  5FB0 A;  3UVD A;  1F68 A;  2RNX A;  5D3J A;  3QZS A;  5I7Y A;  5D3T A;  5IG6 A;  5AME A;  4J0S A;  4A9E A;  2R0Y A;  5FE1 A;  5LJ1 A;  5E9I A;  3U5L A;  4NR8 A;  5A5R A;  5EI4 A;  5L97 A;  4QSW A;  4DON A;  5FE9 A;  3U5P A;  5E0R A;  5HQ5 A;  4HXP A;  4IR4 A;  4A9O A;  5KTX A;  3U5M A;  5FE8 A;  4TU6 A;  5FG5 A;  4BHW A;  5FE0 A;  5CRM A;  4PTB A;  3O34 A;  5DFB A;  3UVX A;  4TYL A;  5CUC A;  4N3W A;  4ZW1 A;  4IOQ A;  4NRB A;  4QYD A;  5IGM A;  2KTB B;  5CZG A;  2MJV B;  2DAT A;  4TT4 A;  3U5N A;  3MXF A;  4MR4 A;  4XY8 A;  3MQM A;  4HXN A;  5CQ7 A;  5F36 A;  3ONI A;  2RNW A;  2L84 A;  4NYX A;  4QR3 A;  4QSS A;  2YEL A;  2R0V A;  3LXJ A;  4ZC9 A;  3UVW A;  5A7C A;  3QZV A;  4E96 A;  4QC1 A;  5H1U A;  2YDW A;  5F63 A;  5F60 A;  2YEM A;  4MEP A;  5JI8 A;  4MR5 A;  4YK0 A;  4QZS A;  3UW9 A;  4MEO A;  4N4F A;  5CRZ A;  3DWY A;  3MB4 A;  4QY4 A;  3IU6 A;  5E73 A;  4UYD A;  5A5Q A;  5FH8 A;  5DW1 A;  4HBW A;  4OUF A;  5FB1 A;  5I86 A;  2OSS A;  5DX4 A;  3U5K A;  5CQ5 A;  1ZS5 A;  4YBT A;  4O78 A;  5ENF A;  2D9E A;  5CUA A;  4BW4 A;  4QR4 A;  5LJ0 A;  4KCX A;  4HXL A;  4FLP A;  5LKX A;  2DKW A;  4NRA A;  4N4G A;  4J1P A;  5CQA A;  2R10 A;  3AAD A;  3FKM X;  5KO4 A;  4QSQ A;  5F25 A;  4YYJ A;  2L85 A;  4TTE A;  4HXK A;  5F3A A;  4HBV A;  5FG4 A;  4LZ2 A;  5CQT A;  4N4H A;  5ENB A;  4HXM A;  5TB6 A;  5E3D A;  5C85 A;  4Q0O A;  4O7A A;  5CP5 A;  5HFQ A;  4YY6 A;  3S92 A;  4O74 A;  4TZ2 A;  1X0J A;  4YYG A;  5LKT A;  4UYG A;  5D7X A;  3G0J A;  3O35 A;  4QEV A;  5FE5 A;  5EK9 A;  4IR3 A;  4QNS A;  5E9Y A;  5EWV A;  4GPJ A;  2RNY A;  5FH6 A;  5HJC A;  4CLB A;  5EPS A;  5C4Q A;  4QBM A;  5D3H A;  3UV4 A;  3LJW A;  3UV2 A;  4CFK A;  4YYD A;  4MR6 A;  3MUK A;  3DAI A;  5CFW A;  5K29 A;  3Q2F A;  4HXR A;  4BW2 A;  5EM3 A;  5EWW A;  4O72 A;  4QST A;  2DVS A;  3LQJ A;  4Z6H A;  5DYA A;  5A85 A;  4CUQ A;  5H85 A;  4IOR A;  1EQF A;  4XY9 A;  5DKD A;  3SVG A;  3UVY A;  5CS8 A;  3P1F A;  5F2P A;  4TT6 A;  4O7B A;  3QZT A;  5CUG A;  5KTW A;  5FE6 A;  4LDF A;  4A9L A;  4HXS A;  4LYW A;  5HEN A;  4YBS A;  5FE3 A;  2D82 A;  2YW5 A;  4TU4 A;  4CUU A;  5EA1 A;  4XUB A;  4ALH A;  4YY4 A;  4YYH A;  4QEW A;  4OGJ A;  3JVJ A;  5I29 A;  5E7D A;  4Z93 A;  4J0R A;  4NUC A;  4Q0N A;  4NXJ A;  4QR5 A;  2E7N A;  4Z6I A;  4QEU A;  3ZYU A;  5IBN A;  2F6J A;  1WUM A;  3P1D A;  3I3J A;  5L98 A;  1JSP B;  5CUB A;  5DFD A;  4TS8 A;  4QC3 A;  4NR9 A;  3Q2E A;  4HBX A;  4LZS A;  4CUP A;  5ENC A;  5I83 A;  3RCW A;  4LRG A;  4O75 A;  4TZ8 A;  5D26 A;  4RVR A;  2DVR A;  4Z1Q A;  4WHW A;  4CUR A;  4A9M A;  2OUO A;  2R0S A;  4NR4 A;  4IR6 A;  4NRC A;  4XYA A;  4CL9 A;  2F6N A;  4A9N A;  4YBM A;  2N9G A;  4LZR A;  2NXB A;  5DYU A;  4LYS A;  5HCL A;  4A9K A;  4CUS A;  5E9V A;  2I7K A;  4QSX A;  5FDZ A;  5DYX A;  5HQ6 A;  4O7F A;  2H60 A;  5DW2 A;  4BJX A;  5E3G A;  1E6I A;  4YYM A;  4IOO A;  5D0C A;  5ACY A;  3SVF A;  4BW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...