5D7XA

Crystal structure of the human brpf1 bromodomain in complex with xz08
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title The "Gatekeeper" Residue Influences the Mode of Binding of Acetyl Indoles to Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5d7xA00
4YYMA 4E96A 5IG6A 4C66A 3UW9A 4LDFA 4MEQA 5E3DA 1N72A 4J1PA 4NQMA 4CLBA 1F68A 5C89A 5I1QA 4J0RA 4PY6A 4A9EA 4NRBA 5IBNA 5E9IA 5IGMA 4NR9A 5C85A 3HMHA 4CFLA 2RO1A 5E0RA 3UVXA 2YQDA 5D3JA 2G4AA 3MUKA 4C67A 3JVLA 4A9OA 5L8TA 2E3KA 2DVQA 5F5ZA 4MR3A 5FG6A 2GRCA 4QR4A 5D0CA 4QSTA 5HLSA 5LJ2A 3LQJA 2MJVB 4O7AA 5EU1A 4TZ8A 5EISA 4Q0OA 3UVDA 4HBYA 5CUGA 4IR4A 4PCIA 2RFJA 4NRAA 5C7NA 4ZW1A 5DYCA 5DLZA 5DYXA 5KTXA 5II1A 5CQ7A 5F60A 4NXJA 5CUAA 5EWDA 4CL9A 4O72A 3UV2A 2DATA 5A5PA 4A9FA 4OGJA 2WP2A 5JWMA 4N4IA 1E6IA 5I7XA 4LZSA 5KO4A 2R10A 4BW3A 5LKZA 4YYGA 4UIZA 4QY4A 5ENBA 5FE5A 4NUDA 5ETDA 5LJ1A 4XUAA 4LR6A 4XUBA 5A83A 4PKLA 3U5JA 5D3RA 4BW1A 5CU8A 1EQFA 5ENHA 3FKMX 5DBMA 4NR8A 5F36A 5EP7A 3UVYA 4WHWA 4YH4A 5CP5A 5L99A 4HXKA 3MULA 3JVMA 5FFYA 5LKTA 5D3HA 3SVHA 4J3IA 5I29A 4YY4A 5E7DA 5EQ1A 4FLPA 4YYNA 4KV1A 5HQ7A 3Q2EA 5TB6A 4J0SA 2L5EA 4Z93A 4ALHA 4TU4A 5EI4A 2WP1A 4YYJA 1JM4B 4TTEA 2I8NA 3JVKA 3MB3A 3LXJA 5EPSA 4PS5A 5F3AA 5CFWA 4QYLA 4UIYA 4CUTA 1WUGA 1ZS5A 1X0JA 5DKCA 2DKWA 5F1LA 5FE7A 5FFVA 4YC9A 4HXMA 3U5KA 2DWWA 4HXRA 5CRMA 5C4QA 5CUEA 4BW2A 4N3WA 5HFQA 4UYFB 2L84A 4QYDA 4NRCA 5CQ6A 4O77A 3UVWA 3P5OA 5BT5A 5HQ6A 3MXFA 5FDZA 4QEVA 5FBXA 5KTWA 5DKHA 5CUBA 5DW2A 4QSXA 4QSVA 5EM3A 5IIDA 5ETBA 2N9GA 2F6JA 4A9MA 3O35A 5H85A 2D82A 4TU6A 4ZQLA 1WUMA 4YYDA 5HJCA 1JSPB 3P1FA 4IR6A 2I7KA 5LVQA 5C8GA 4CFKA 5IGNA 4CUQA 5LJ0A 5I88A 2RNYA 3NXBA 4WIVA 4MEOA 5DFCA 5EVAA 5LKUA 2R0VA 4IR5A 4Z6HA 5FE4A 4QC1A 5D7XA 5LKXA 5FE6A 4HXNA 5BT3A 4HXLA 4NYXA 2RI7A 4N4FA 4TS8A 5EPRA 3S92A 2L85A 3U5PA 5I83A 5FFWA 5CQAA 5D3NA 5DFDA 4TQNA 5FE1A 4UYFA 3O34A 4YYIA 3GG3A 3IU6A 2E7OA 5DX4A 5FE3A 5FE0A 5ENCA 2YELA 5L98A 3HMFA 4Z1QA 3QZVA 4IOQA 4QUUA 4LYSA 4ZC9A 5FH6A 4NUEA 4MR5A 4QSRA 5CQTA 4LZ2A 4IOOA 4LRGA 5EV9A 4XY8A 5LVRA 4NR6A 4O78A 2RNXA 4Y03A 5EWVA 4QSUA 4A9IA 3U5MA 5EA1A 5A5SA 4YADA 5F61A 5HEMA 5E9YA 2LSPB 5HRVA 5A5NA 4NUCA 5E74A 4YATA 4MR6A 5HRXA 3UV5A 4UIWA 5IGKA 3ONIA 5BT4A 5C87A 5EK9A 5I89A 2YDWA 4HXSA 5ENIA 5D25A 4O71A 4TYLA 3D7CA 5AMFA 3LJWA 5ACYA 2YYNA 4QBMA 4TT4A 4TT2A 4XY9A 4YK0A 4LYWA 5FE2A 5II2A 2RS9B 5JI8A 5E9VA 4PTBA 4CURA 4YYKA 4N4GA 4GPJA 5A7CA 4YABA 2R0YA 3U5OA 5CZGA 4YBMA 4MEPA 5F2PA 5AD3A 5AMEA 2NXBA 2DVVA 5A5RA 3G0JA 5DYAA 5I86A 3Q2FA 3O36A 4NR5A 3O33A 3LQHA 3UV4A 4Z1SA 3MB4A 4NS5A 5TCMA 4LC2A 5F62A 5L96A 4NYWA 4O7EA 4Z6IA 5CPEA 3QZTA 5L97A 5F25A 5D3TA 4YBTA 5D3LA 4QR5A 5KHMA 4QNSA 3SVGA 4UYHA 4A9JA 5ENFA 2F6NA 3DAIA 5H1TA 5FG4A 5A85A 3P1CA 2YEKA 3LQIA 5HFRA 4Q0NA 3U5LA 4QB3A 4LZRA 5K29A 5E9KA 5I80A 3HMEA 5L8UA 3RCWA 2KTBB 5EWHA 4YAXA 5DW1A 2DVSA 4QR3A 4KV4A 4N4HA 5G4RA 5LUUA 4HBXA 4KCXA 4UYGA 5HELA 4UYEA 4YY6A 3AQAA 5ENGA 4A9NA 4TT6A 4IORA 4HXPA 4BJXA 4O7CA 5CQ3A 4O74A 5A82A 2YW5A 2RNWA 4LYIA 5COIA 3SVFA 5CS8A 4WHUA 3P1DA 5A5QA 2E7NA 4QSQA 3JVJA 5CGPA 2OUOA 3AADA 5CQ8A 5CY9A 4UITA 3ZYUA 5IGLA 5FH8A 4YBSA 4YH3A 4CUSA 2DVRA 4O76A 4ALGA 2OSSA 5E9LA 5H1VA 5A5OA 4CUUA 5HM0A 5DLXA 3S91A 5DFBA 5DYUA 4OUFA 5FG5A 4CUPA 3I3JA 2H60A 4NR7A 4IR3A 5EWWA 4BHWA 4OGIA 4MENA 4O7FA 5E9MA 4PCEA 4X2IA 5E73A 4QEWA 4HBWA 4QC3A 5J0DA 5CQ4A 4QSSA 4NR4A 4XYAA 5G4SA 5DKDA 5CUDA 3TLPA 4NQNA 4QUTA 2R0SA 5ENEA 5F1HA 4QSWA 5EGUA 2OO1A 5A81A 5AD2A 4A9KA 4A9HA 5CUCA 4O70A 5HRWA 2FSAA 4HBVA 4MR4A 5CRZA 5EWCA 4UIXA 4F3IA 4AKNA 5CTLA 3K2JA 4UYDA 2YEMA 3MQMA 5FH7A 5ENJA 5D3SA 4UIUA 3G0LA 4QSPA 5HQ5A 3P1EA 5H1UA 5E3GA 5FB1A 2D9EA 4NYVA 5EPBA 3IU5A 5EICA 5I40A 5I7YA 4BW4A 4O7BA 4O75A 3DWYA 5D3PA 5D24A 4TZ2A 4A9LA 4RVRA 5HENA 4UIVA 5FB0A 3O37A 5D26A 5FE8A 5FE9A 5DY7A 5KU3A 5F63A 4DONA 4HXOA 4QZSA 5KTUA 4YYHA 5HCLA 5CQ5A 4QEUA 3QZSA 3U5NA
chains in the Genus database with same CATH superfamily
4YYMA 4E96A 5IG6A 4C66A 3VKGA 3UW9A 4AKHA 4LDFA 4MEQA 5E3DA 1N72A 4J1PA 4NQMA 4CLBA 1F68A 5C89A 5I1QA 4J0RA 4PY6A 4A9EA 4NRBA 5IBNA 5E9IA 5IGMA 4NR9A 5C85A 3HMHA 4CFLA 2RO1A 5E0RA 3UVXA 2YQDA 5D3JA 2G4AA 3MUKA 4C67A 3JVLA 4A9OA 5L8TA 2E3KA 2DVQA 5F5ZA 4MR3A 5FG6A 2GRCA 4QR4A 5D0CA 4QSTA 5HLSA 5LJ2A 3LQJA 2MJVB 4O7AA 5EU1A 4TZ8A 5EISA 4Q0OA 3UVDA 4HBYA 5CUGA 1ZKRA 4IR4A 4PCIA 2RFJA 4NRAA 5C7NA 4ZW1A 5DYCA 5DLZA 5DYXA 5KTXA 5II1A 5CQ7A 5F60A 4NXJA 5CUAA 5EWDA 4CL9A 4O72A 3UV2A 4AKGA 2DATA 5A5PA 4A9FA 4OGJA 2WP2A 5JWMA 4N4IA 1E6IA 5I7XA 4LZSA 5KO4A 2R10A 4BW3A 5LKZA 4YYGA 4UIZA 4QY4A 5ENBA 5FE5A 4NUDA 5ETDA 5LJ1A 4XUAA 4LR6A 4XUBA 5A83A 4PKLA 3U5JA 5D3RA 4BW1A 5CU8A 1EQFA 5ENHA 3FKMX 5DBMA 4NR8A 5F36A 5EP7A 3UVYA 4WHWA 4YH4A 5CP5A 5L99A 4HXKA 3MULA 3JVMA 5FFYA 5LKTA 5D3HA 3SVHA 4J3IA 5I29A 4YY4A 5E7DA 5EQ1A 4FLPA 4YYNA 4KV1A 5HQ7A 3Q2EA 2EJNA 5TB6A 4J0SA 2L5EA 4Z93A 4ALHA 4TU4A 5EI4A 2WP1A 4YYJA 1JM4B 4TTEA 2I8NA 3JVKA 3MB3A 3LXJA 5EPSA 4PS5A 5F3AA 5CFWA 4QYLA 4UIYA 4CUTA 1WUGA 1ZS5A 1X0JA 5DKCA 2DKWA 5F1LA 5FE7A 5FFVA 4YC9A 4HXMA 3U5KA 2DWWA 1PUOA 4HXRA 5CRMA 5C4QA 5CUEA 4BW2A 4N3WA 5HFQA 4UYFB 2L84A 4QYDA 4NRCA 5CQ6A 4O77A 3UVWA 3P5OA 5BT5A 5HQ6A 3MXFA 5FDZA 4QEVA 5FBXA 5KTWA 5DKHA 5CUBA 5DW2A 4QSXA 4QSVA 5EM3A 5IIDA 5ETBA 2N9GA 2F6JA 4A9MA 3O35A 5H85A 2D82A 4TU6A 4ZQLA 1WUMA 4YYDA 5HJCA 1JSPB 3P1FA 4IR6A 2I7KA 5LVQA 5C8GA 4CFKA 5IGNA 4CUQA 5LJ0A 5I88A 2RNYA 3NXBA 4WIVA 4MEOA 5DFCA 5EVAA 5LKUA 2R0VA 4IR5A 4Z6HA 5FE4A 4QC1A 5D7XA 5LKXA 5FE6A 4HXNA 5BT3A 4HXLA 4NYXA 2RI7A 4N4FA 4TS8A 5EPRA 3S92A 2L85A 3U5PA 5I83A 5FFWA 5CQAA 5D3NA 5DFDA 4TQNA 5FE1A 4UYFA 3O34A 4YYIA 3GG3A 3IU6A 2E7OA 5DX4A 5FE3A 5FE0A 5ENCA 2YELA 5L98A 3HMFA 4Z1QA 3QZVA 4IOQA 4QUUA 4LYSA 4ZC9A 3D1BA 5FH6A 4NUEA 4MR5A 4QSRA 5CQTA 4LZ2A 4IOOA 4LRGA 5EV9A 4XY8A 5LVRA 4NR6A 4O78A 2RNXA 4Y03A 5EWVA 4QSUA 4A9IA 3U5MA 5EA1A 5A5SA 4YADA 5F61A 5HEMA 5E9YA 2LSPB 5HRVA 3D1DA 5A5NA 4NUCA 5E74A 4YATA 4MR6A 5HRXA 3UV5A 4UIWA 5IGKA 3ONIA 5BT4A 5C87A 5EK9A 5I89A 2YDWA 4HXSA 5ENIA 5D25A 4O71A 4TYLA 3D7CA 5AMFA 3LJWA 5ACYA 2YYNA 4AKIA 4QBMA 4TT4A 4TT2A 4XY9A 4YK0A 4LYWA 5FE2A 5II2A 2RS9B 5JI8A 5E9VA 4PTBA 3ERRA 4CURA 4YYKA 4N4GA 4GPJA 5A7CA 4YABA 2R0YA 3U5OA 5CZGA 4YBMA 4MEPA 5F2PA 5AD3A 5AMEA 2NXBA 2DVVA 5A5RA 3G0JA 5DYAA 5I86A 3Q2FA 3O36A 4NR5A 3O33A 3LQHA 3UV4A 4Z1SA 3MB4A 4NS5A 5TCMA 4LC2A 5F62A 5L96A 4NYWA 4O7EA 4Z6IA 5CPEA 3QZTA 5L97A 5F25A 5D3TA 4YBTA 5D3LA 4QR5A 5KHMA 4QNSA 3SVGA 4UYHA 4A9JA 5ENFA 2F6NA 3DAIA 5H1TA 5FG4A 5A85A 3P1CA 2YEKA 3LQIA 5HFRA 4Q0NA 3U5LA 4QB3A 4LZRA 5K29A 5E9KA 5I80A 3HMEA 5L8UA 3RCWA 2KTBB 5EWHA 4YAXA 5DW1A 2DVSA 4QR3A 4KV4A 4N4HA 5G4RA 5LUUA 4HBXA 4KCXA 4UYGA 5HELA 4UYEA 4YY6A 3AQAA 5ENGA 4A9NA 4TT6A 4IORA 4HXPA 4BJXA 4O7CA 5CQ3A 4O74A 5A82A 2YW5A 2RNWA 4LYIA 5COIA 3SVFA 5CS8A 4WHUA 3P1DA 5A5QA 2E7NA 4QSQA 3JVJA 5CGPA 2OUOA 3AADA 5CQ8A 5CY9A 4UITA 3ZYUA 5IGLA 5FH8A 4YBSA 4YH3A 4CUSA 2DVRA 4O76A 4ALGA 2OSSA 5E9LA 5H1VA 5A5OA 4CUUA 5HM0A 5DLXA 3S91A 5DFBA 5DYUA 4OUFA 5FG5A 4CUPA 4AI6A 3I3JA 2H60A 4NR7A 4IR3A 5EWWA 4BHWA 4OGIA 4MENA 4O7FA 5E9MA 4PCEA 4X2IA 5E73A 4QEWA 4HBWA 4QC3A 5J0DA 5CQ4A 4QSSA 4NR4A 4XYAA 5G4SA 5DKDA 5CUDA 3TLPA 4NQNA 4QUTA 2R0SA 5ENEA 5F1HA 4QSWA 3VKHA 5EGUA 2OO1A 5A81A 5AD2A 4A9KA 4A9HA 5CUCA 4O70A 5HRWA 2FSAA 4HBVA 4MR4A 5CRZA 5EWCA 4UIXA 4F3IA 4AKNA 5CTLA 3K2JA 4UYDA 2YEMA 3MQMA 5FH7A 5ENJA 5D3SA 4UIUA 3G0LA 4QSPA 5HQ5A 3P1EA 5H1UA 5E3GA 5FB1A 2D9EA 4NYVA 5EPBA 3IU5A 5EICA 5I40A 5I7YA 4BW4A 4O7BA 4O75A 3DWYA 5D3PA 5D24A 4TZ2A 4A9LA 4RVRA 5HENA 4UIVA 5FB0A 3O37A 5D26A 5FE8A 5FE9A 5DY7A 5KU3A 5F63A 4DONA 4HXOA 4QZSA 5KTUA 4YYHA 5HCLA 5CQ5A 4QEUA 3QZSA 3U5NA
chains in the Genus database with same CATH topology
4YYMA 4E96A 5IG6A 4C66A 3UW9A 4LDFA 4MEQA 5E3DA 1N72A 4J1PA 4NQMA 4CLBA 1F68A 5C89A 5I1QA 4J0RA 4PY6A 4A9EA 4NRBA 5IBNA 5E9IA 5IGMA 4NR9A 5C85A 3HMHA 4CFLA 2RO1A 5E0RA 3UVXA 2YQDA 5D3JA 2G4AA 3MUKA 4C67A 3JVLA 4A9OA 5L8TA 2E3KA 2DVQA 5F5ZA 4MR3A 5FG6A 2GRCA 4QR4A 5D0CA 4QSTA 5HLSA 5LJ2A 3LQJA 2MJVB 4O7AA 5EU1A 4TZ8A 5EISA 4Q0OA 3UVDA 4HBYA 5CUGA 4IR4A 4PCIA 2RFJA 4NRAA 5C7NA 4ZW1A 5DYCA 5DLZA 5DYXA 5KTXA 5II1A 5CQ7A 5F60A 4NXJA 5CUAA 5EWDA 4CL9A 4O72A 3UV2A 2DATA 5A5PA 4A9FA 4OGJA 2WP2A 5JWMA 4N4IA 1E6IA 5I7XA 4LZSA 5KO4A 2R10A 4BW3A 5LKZA 4YYGA 4UIZA 4QY4A 5ENBA 5FE5A 4NUDA 5ETDA 5LJ1A 4XUAA 4LR6A 4XUBA 5A83A 4PKLA 3U5JA 5D3RA 4BW1A 5CU8A 1EQFA 5ENHA 3FKMX 5DBMA 4NR8A 5F36A 5EP7A 3UVYA 4WHWA 4YH4A 5CP5A 5L99A 4HXKA 3MULA 3JVMA 5FFYA 5LKTA 5D3HA 3SVHA 4J3IA 5I29A 4YY4A 5E7DA 5EQ1A 4FLPA 4YYNA 4KV1A 5HQ7A 3Q2EA 5TB6A 4J0SA 2L5EA 4Z93A 4ALHA 4TU4A 5EI4A 2WP1A 4YYJA 1JM4B 4TTEA 2I8NA 3JVKA 3MB3A 3LXJA 5EPSA 4PS5A 5F3AA 5CFWA 4QYLA 4UIYA 4CUTA 1WUGA 1ZS5A 1X0JA 5DKCA 2DKWA 5F1LA 5FE7A 5FFVA 4YC9A 4HXMA 3U5KA 2DWWA 4HXRA 5CRMA 5C4QA 5CUEA 4BW2A 4N3WA 5HFQA 4UYFB 2L84A 4QYDA 4NRCA 5CQ6A 4O77A 3UVWA 3P5OA 5BT5A 5HQ6A 3MXFA 5FDZA 4QEVA 5FBXA 5KTWA 5DKHA 5CUBA 5DW2A 4QSXA 4QSVA 5EM3A 5IIDA 5ETBA 2N9GA 2F6JA 4A9MA 3O35A 5H85A 2D82A 4TU6A 4ZQLA 1WUMA 4YYDA 5HJCA 1JSPB 3P1FA 4IR6A 2I7KA 5LVQA 5C8GA 4CFKA 5IGNA 4CUQA 5LJ0A 5I88A 2RNYA 3NXBA 4WIVA 4MEOA 5DFCA 5EVAA 5LKUA 2R0VA 4IR5A 4Z6HA 5FE4A 4QC1A 5D7XA 5LKXA 5FE6A 4HXNA 5BT3A 4HXLA 4NYXA 2RI7A 4N4FA 4TS8A 5EPRA 3S92A 2L85A 3U5PA 5I83A 5FFWA 5CQAA 5D3NA 5DFDA 4TQNA 5FE1A 4UYFA 3O34A 4YYIA 3GG3A 3IU6A 2E7OA 5DX4A 5FE3A 5FE0A 5ENCA 2YELA 5L98A 3HMFA 4Z1QA 3QZVA 4IOQA 4QUUA 4LYSA 4ZC9A 5FH6A 4NUEA 4MR5A 4QSRA 5CQTA 4LZ2A 4IOOA 4LRGA 5EV9A 4XY8A 5LVRA 4NR6A 4O78A 2RNXA 4Y03A 5EWVA 4QSUA 4A9IA 3U5MA 5EA1A 5A5SA 4YADA 5F61A 5HEMA 5E9YA 2LSPB 5HRVA 5A5NA 4NUCA 5E74A 4YATA 4MR6A 5HRXA 3UV5A 4UIWA 5IGKA 3ONIA 5BT4A 5C87A 5EK9A 5I89A 2YDWA 4HXSA 5ENIA 5D25A 4O71A 4TYLA 3D7CA 5AMFA 3LJWA 5ACYA 2YYNA 4QBMA 4TT4A 4TT2A 4XY9A 4YK0A 4LYWA 5FE2A 5II2A 2RS9B 5JI8A 5E9VA 4PTBA 4CURA 4YYKA 4N4GA 4GPJA 5A7CA 4YABA 2R0YA 3U5OA 5CZGA 4YBMA 4MEPA 5F2PA 5AD3A 5AMEA 2NXBA 2DVVA 5A5RA 3G0JA 5DYAA 5I86A 3Q2FA 3O36A 4NR5A 3O33A 3LQHA 3UV4A 4Z1SA 3MB4A 4NS5A 5TCMA 4LC2A 5F62A 5L96A 4NYWA 4O7EA 4Z6IA 5CPEA 3QZTA 5L97A 5F25A 5D3TA 4YBTA 5D3LA 4QR5A 5KHMA 4QNSA 3SVGA 4UYHA 4A9JA 5ENFA 2F6NA 3DAIA 5H1TA 5FG4A 5A85A 3P1CA 2YEKA 3LQIA 5HFRA 4Q0NA 3U5LA 4QB3A 4LZRA 5K29A 5E9KA 5I80A 3HMEA 5L8UA 3RCWA 2KTBB 5EWHA 4YAXA 5DW1A 2DVSA 4QR3A 4KV4A 4N4HA 5G4RA 5LUUA 4HBXA 4KCXA 4UYGA 5HELA 4UYEA 4YY6A 3AQAA 5ENGA 4A9NA 4TT6A 4IORA 4HXPA 4BJXA 4O7CA 5CQ3A 4O74A 5A82A 2YW5A 2RNWA 4LYIA 5COIA 3SVFA 5CS8A 4WHUA 3P1DA 5A5QA 2E7NA 4QSQA 3JVJA 5CGPA 2OUOA 3AADA 5CQ8A 5CY9A 4UITA 3ZYUA 5IGLA 5FH8A 4YBSA 4YH3A 4CUSA 2DVRA 4O76A 4ALGA 2OSSA 5E9LA 5H1VA 5A5OA 4CUUA 5HM0A 5DLXA 3S91A 5DFBA 5DYUA 4OUFA 5FG5A 4CUPA 3I3JA 2H60A 4NR7A 4IR3A 5EWWA 4BHWA 4OGIA 4MENA 4O7FA 5E9MA 4PCEA 4X2IA 5E73A 4QEWA 4HBWA 4QC3A 5J0DA 5CQ4A 4QSSA 4NR4A 4XYAA 5G4SA 5DKDA 5CUDA 3TLPA 4NQNA 4QUTA 2R0SA 5ENEA 5F1HA 4QSWA 5EGUA 2OO1A 5A81A 5AD2A 4A9KA 4A9HA 5CUCA 4O70A 5HRWA 2FSAA 4HBVA 4MR4A 5CRZA 5EWCA 4UIXA 4F3IA 4AKNA 5CTLA 3K2JA 4UYDA 2YEMA 3MQMA 5FH7A 5ENJA 5D3SA 4UIUA 3G0LA 4QSPA 5HQ5A 3P1EA 5H1UA 5E3GA 5FB1A 2D9EA 4NYVA 5EPBA 3IU5A 5EICA 5I40A 5I7YA 4BW4A 4O7BA 4O75A 3DWYA 5D3PA 5D24A 4TZ2A 4A9LA 4RVRA 5HENA 4UIVA 5FB0A 3O37A 5D26A 5FE8A 5FE9A 5DY7A 5KU3A 5F63A 4DONA 4HXOA 4QZSA 5KTUA 4YYHA 5HCLA 5CQ5A 4QEUA 3QZSA 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYM A;  4E96 A;  5IG6 A;  4C66 A;  3UW9 A;  4LDF A;  4MEQ A;  5E3D A;  1N72 A;  4J1P A;  4NQM A;  4CLB A;  1F68 A;  5C89 A;  5I1Q A;  4J0R A;  4PY6 A;  4A9E A;  4NRB A;  5IBN A;  5E9I A;  5IGM A;  4NR9 A;  5C85 A;  3HMH A;  4CFL A;  2RO1 A;  5E0R A;  3UVX A;  2YQD A;  5D3J A;  2G4A A;  3MUK A;  4C67 A;  3JVL A;  4A9O A;  5L8T A;  2E3K A;  2DVQ A;  5F5Z A;  4MR3 A;  5FG6 A;  2GRC A;  4QR4 A;  5D0C A;  4QST A;  5HLS A;  5LJ2 A;  3LQJ A;  2MJV B;  4O7A A;  5EU1 A;  4TZ8 A;  5EIS A;  4Q0O A;  3UVD A;  4HBY A;  5CUG A;  4IR4 A;  4PCI A;  2RFJ A;  4NRA A;  5C7N A;  4ZW1 A;  5DYC A;  5DLZ A;  5DYX A;  5KTX A;  5II1 A;  5CQ7 A;  5F60 A;  4NXJ A;  5CUA A;  5EWD A;  4CL9 A;  4O72 A;  3UV2 A;  2DAT A;  5A5P A;  4A9F A;  4OGJ A;  2WP2 A;  5JWM A;  4N4I A;  1E6I A;  5I7X A;  4LZS A;  5KO4 A;  2R10 A;  4BW3 A;  5LKZ A;  4YYG A;  4UIZ A;  4QY4 A;  5ENB A;  5FE5 A;  4NUD A;  5ETD A;  5LJ1 A;  4XUA A;  4LR6 A;  4XUB A;  5A83 A;  4PKL A;  3U5J A;  5D3R A;  4BW1 A;  5CU8 A;  1EQF A;  5ENH A;  3FKM X;  5DBM A;  4NR8 A;  5F36 A;  5EP7 A;  3UVY A;  4WHW A;  4YH4 A;  5CP5 A;  5L99 A;  4HXK A;  3MUL A;  3JVM A;  5FFY A;  5LKT A;  5D3H A;  3SVH A;  4J3I A;  5I29 A;  4YY4 A;  5E7D A;  5EQ1 A;  4FLP A;  4YYN A;  4KV1 A;  5HQ7 A;  3Q2E A;  5TB6 A;  4J0S A;  2L5E A;  4Z93 A;  4ALH A;  4TU4 A;  5EI4 A;  2WP1 A;  4YYJ A;  1JM4 B;  4TTE A;  2I8N A;  3JVK A;  3MB3 A;  3LXJ A;  5EPS A;  4PS5 A;  5F3A A;  5CFW A;  4QYL A;  4UIY A;  4CUT A;  1WUG A;  1ZS5 A;  1X0J A;  5DKC A;  2DKW A;  5F1L A;  5FE7 A;  5FFV A;  4YC9 A;  4HXM A;  3U5K A;  2DWW A;  4HXR A;  5CRM A;  5C4Q A;  5CUE A;  4BW2 A;  4N3W A;  5HFQ A;  4UYF B;  2L84 A;  4QYD A;  4NRC A;  5CQ6 A;  4O77 A;  3UVW A;  3P5O A;  5BT5 A;  5HQ6 A;  3MXF A;  5FDZ A;  4QEV A;  5FBX A;  5KTW A;  5DKH A;  5CUB A;  5DW2 A;  4QSX A;  4QSV A;  5EM3 A;  5IID A;  5ETB A;  2N9G A;  2F6J A;  4A9M A;  3O35 A;  5H85 A;  2D82 A;  4TU6 A;  4ZQL A;  1WUM A;  4YYD A;  5HJC A;  1JSP B;  3P1F A;  4IR6 A;  2I7K A;  5LVQ A;  5C8G A;  4CFK A;  5IGN A;  4CUQ A;  5LJ0 A;  5I88 A;  2RNY A;  3NXB A;  4WIV A;  4MEO A;  5DFC A;  5EVA A;  5LKU A;  2R0V A;  4IR5 A;  4Z6H A;  5FE4 A;  4QC1 A;  5D7X A;  5LKX A;  5FE6 A;  4HXN A;  5BT3 A;  4HXL A;  4NYX A;  2RI7 A;  4N4F A;  4TS8 A;  5EPR A;  3S92 A;  2L85 A;  3U5P A;  5I83 A;  5FFW A;  5CQA A;  5D3N A;  5DFD A;  4TQN A;  5FE1 A;  4UYF A;  3O34 A;  4YYI A;  3GG3 A;  3IU6 A;  2E7O A;  5DX4 A;  5FE3 A;  5FE0 A;  5ENC A;  2YEL A;  5L98 A;  3HMF A;  4Z1Q A;  3QZV A;  4IOQ A;  4QUU A;  4LYS A;  4ZC9 A;  5FH6 A;  4NUE A;  4MR5 A;  4QSR A;  5CQT A;  4LZ2 A;  4IOO A;  4LRG A;  5EV9 A;  4XY8 A;  5LVR A;  4NR6 A;  4O78 A;  2RNX A;  4Y03 A;  5EWV A;  4QSU A;  4A9I A;  3U5M A;  5EA1 A;  5A5S A;  4YAD A;  5F61 A;  5HEM A;  5E9Y A;  2LSP B;  5HRV A;  5A5N A;  4NUC A;  5E74 A;  4YAT A;  4MR6 A;  5HRX A;  3UV5 A;  4UIW A;  5IGK A;  3ONI A;  5BT4 A;  5C87 A;  5EK9 A;  5I89 A;  2YDW A;  4HXS A;  5ENI A;  5D25 A;  4O71 A;  4TYL A;  3D7C A;  5AMF A;  3LJW A;  5ACY A;  2YYN A;  4QBM A;  4TT4 A;  4TT2 A;  4XY9 A;  4YK0 A;  4LYW A;  5FE2 A;  5II2 A;  2RS9 B;  5JI8 A;  5E9V A;  4PTB A;  4CUR A;  4YYK A;  4N4G A;  4GPJ A;  5A7C A;  4YAB A;  2R0Y A;  3U5O A;  5CZG A;  4YBM A;  4MEP A;  5F2P A;  5AD3 A;  5AME A;  2NXB A;  2DVV A;  5A5R A;  3G0J A;  5DYA A;  5I86 A;  3Q2F A;  3O36 A;  4NR5 A;  3O33 A;  3LQH A;  3UV4 A;  4Z1S A;  3MB4 A;  4NS5 A;  5TCM A;  4LC2 A;  5F62 A;  5L96 A;  4NYW A;  4O7E A;  4Z6I A;  5CPE A;  3QZT A;  5L97 A;  5F25 A;  5D3T A;  4YBT A;  5D3L A;  4QR5 A;  5KHM A;  4QNS A;  3SVG A;  4UYH A;  4A9J A;  5ENF A;  2F6N A;  3DAI A;  5H1T A;  5FG4 A;  5A85 A;  3P1C A;  2YEK A;  3LQI A;  5HFR A;  4Q0N A;  3U5L A;  4QB3 A;  4LZR A;  5K29 A;  5E9K A;  5I80 A;  3HME A;  5L8U A;  3RCW A;  2KTB B;  5EWH A;  4YAX A;  5DW1 A;  2DVS A;  4QR3 A;  4KV4 A;  4N4H A;  5G4R A;  5LUU A;  4HBX A;  4KCX A;  4UYG A;  5HEL A;  4UYE A;  4YY6 A;  3AQA A;  5ENG A;  4A9N A;  4TT6 A;  4IOR A;  4HXP A;  4BJX A;  4O7C A;  5CQ3 A;  4O74 A;  5A82 A;  2YW5 A;  2RNW A;  4LYI A;  5COI A;  3SVF A;  5CS8 A;  4WHU A;  3P1D A;  5A5Q A;  2E7N A;  4QSQ A;  3JVJ A;  5CGP A;  2OUO A;  3AAD A;  5CQ8 A;  5CY9 A;  4UIT A;  3ZYU A;  5IGL A;  5FH8 A;  4YBS A;  4YH3 A;  4CUS A;  2DVR A;  4O76 A;  4ALG A;  2OSS A;  5E9L A;  5H1V A;  5A5O A;  4CUU A;  5HM0 A;  5DLX A;  3S91 A;  5DFB A;  5DYU A;  4OUF A;  5FG5 A;  4CUP A;  3I3J A;  2H60 A;  4NR7 A;  4IR3 A;  5EWW A;  4BHW A;  4OGI A;  4MEN A;  4O7F A;  5E9M A;  4PCE A;  4X2I A;  5E73 A;  4QEW A;  4HBW A;  4QC3 A;  5J0D A;  5CQ4 A;  4QSS A;  4NR4 A;  4XYA A;  5G4S A;  5DKD A;  5CUD A;  3TLP A;  4NQN A;  4QUT A;  2R0S A;  5ENE A;  5F1H A;  4QSW A;  5EGU A;  2OO1 A;  5A81 A;  5AD2 A;  4A9K A;  4A9H A;  5CUC A;  4O70 A;  5HRW A;  2FSA A;  4HBV A;  4MR4 A;  5CRZ A;  5EWC A;  4UIX A;  4F3I A;  4AKN A;  5CTL A;  3K2J A;  4UYD A;  2YEM A;  3MQM A;  5FH7 A;  5ENJ A;  5D3S A;  4UIU A;  3G0L A;  4QSP A;  5HQ5 A;  3P1E A;  5H1U A;  5E3G A;  5FB1 A;  2D9E A;  4NYV A;  5EPB A;  3IU5 A;  5EIC A;  5I40 A;  5I7Y A;  4BW4 A;  4O7B A;  4O75 A;  3DWY A;  5D3P A;  5D24 A;  4TZ2 A;  4A9L A;  4RVR A;  5HEN A;  4UIV A;  5FB0 A;  3O37 A;  5D26 A;  5FE8 A;  5FE9 A;  5DY7 A;  5KU3 A;  5F63 A;  4DON A;  4HXO A;  4QZS A;  5KTU A;  4YYH A;  5HCL A;  5CQ5 A;  4QEU A;  3QZS A;  3U5N A; 
#chains in the Genus database with same CATH topology
 4YYM A;  4E96 A;  5IG6 A;  4C66 A;  3VKG A;  3UW9 A;  4AKH A;  4LDF A;  4MEQ A;  5E3D A;  1N72 A;  4J1P A;  4NQM A;  4CLB A;  1F68 A;  5C89 A;  5I1Q A;  4J0R A;  4PY6 A;  4A9E A;  4NRB A;  5IBN A;  5E9I A;  5IGM A;  4NR9 A;  5C85 A;  3HMH A;  4CFL A;  2RO1 A;  5E0R A;  3UVX A;  2YQD A;  5D3J A;  2G4A A;  3MUK A;  4C67 A;  3JVL A;  4A9O A;  5L8T A;  2E3K A;  2DVQ A;  5F5Z A;  4MR3 A;  5FG6 A;  2GRC A;  4QR4 A;  5D0C A;  4QST A;  5HLS A;  5LJ2 A;  3LQJ A;  2MJV B;  4O7A A;  5EU1 A;  4TZ8 A;  5EIS A;  4Q0O A;  3UVD A;  4HBY A;  5CUG A;  1ZKR A;  4IR4 A;  4PCI A;  2RFJ A;  4NRA A;  5C7N A;  4ZW1 A;  5DYC A;  5DLZ A;  5DYX A;  5KTX A;  5II1 A;  5CQ7 A;  5F60 A;  4NXJ A;  5CUA A;  5EWD A;  4CL9 A;  4O72 A;  3UV2 A;  4AKG A;  2DAT A;  5A5P A;  4A9F A;  4OGJ A;  2WP2 A;  5JWM A;  4N4I A;  1E6I A;  5I7X A;  4LZS A;  5KO4 A;  2R10 A;  4BW3 A;  5LKZ A;  4YYG A;  4UIZ A;  4QY4 A;  5ENB A;  5FE5 A;  4NUD A;  5ETD A;  5LJ1 A;  4XUA A;  4LR6 A;  4XUB A;  5A83 A;  4PKL A;  3U5J A;  5D3R A;  4BW1 A;  5CU8 A;  1EQF A;  5ENH A;  3FKM X;  5DBM A;  4NR8 A;  5F36 A;  5EP7 A;  3UVY A;  4WHW A;  4YH4 A;  5CP5 A;  5L99 A;  4HXK A;  3MUL A;  3JVM A;  5FFY A;  5LKT A;  5D3H A;  3SVH A;  4J3I A;  5I29 A;  4YY4 A;  5E7D A;  5EQ1 A;  4FLP A;  4YYN A;  4KV1 A;  5HQ7 A;  3Q2E A;  2EJN A;  5TB6 A;  4J0S A;  2L5E A;  4Z93 A;  4ALH A;  4TU4 A;  5EI4 A;  2WP1 A;  4YYJ A;  1JM4 B;  4TTE A;  2I8N A;  3JVK A;  3MB3 A;  3LXJ A;  5EPS A;  4PS5 A;  5F3A A;  5CFW A;  4QYL A;  4UIY A;  4CUT A;  1WUG A;  1ZS5 A;  1X0J A;  5DKC A;  2DKW A;  5F1L A;  5FE7 A;  5FFV A;  4YC9 A;  4HXM A;  3U5K A;  2DWW A;  1PUO A;  4HXR A;  5CRM A;  5C4Q A;  5CUE A;  4BW2 A;  4N3W A;  5HFQ A;  4UYF B;  2L84 A;  4QYD A;  4NRC A;  5CQ6 A;  4O77 A;  3UVW A;  3P5O A;  5BT5 A;  5HQ6 A;  3MXF A;  5FDZ A;  4QEV A;  5FBX A;  5KTW A;  5DKH A;  5CUB A;  5DW2 A;  4QSX A;  4QSV A;  5EM3 A;  5IID A;  5ETB A;  2N9G A;  2F6J A;  4A9M A;  3O35 A;  5H85 A;  2D82 A;  4TU6 A;  4ZQL A;  1WUM A;  4YYD A;  5HJC A;  1JSP B;  3P1F A;  4IR6 A;  2I7K A;  5LVQ A;  5C8G A;  4CFK A;  5IGN A;  4CUQ A;  5LJ0 A;  5I88 A;  2RNY A;  3NXB A;  4WIV A;  4MEO A;  5DFC A;  5EVA A;  5LKU A;  2R0V A;  4IR5 A;  4Z6H A;  5FE4 A;  4QC1 A;  5D7X A;  5LKX A;  5FE6 A;  4HXN A;  5BT3 A;  4HXL A;  4NYX A;  2RI7 A;  4N4F A;  4TS8 A;  5EPR A;  3S92 A;  2L85 A;  3U5P A;  5I83 A;  5FFW A;  5CQA A;  5D3N A;  5DFD A;  4TQN A;  5FE1 A;  4UYF A;  3O34 A;  4YYI A;  3GG3 A;  3IU6 A;  2E7O A;  5DX4 A;  5FE3 A;  5FE0 A;  5ENC A;  2YEL A;  5L98 A;  3HMF A;  4Z1Q A;  3QZV A;  4IOQ A;  4QUU A;  4LYS A;  4ZC9 A;  3D1B A;  5FH6 A;  4NUE A;  4MR5 A;  4QSR A;  5CQT A;  4LZ2 A;  4IOO A;  4LRG A;  5EV9 A;  4XY8 A;  5LVR A;  4NR6 A;  4O78 A;  2RNX A;  4Y03 A;  5EWV A;  4QSU A;  4A9I A;  3U5M A;  5EA1 A;  5A5S A;  4YAD A;  5F61 A;  5HEM A;  5E9Y A;  2LSP B;  5HRV A;  3D1D A;  5A5N A;  4NUC A;  5E74 A;  4YAT A;  4MR6 A;  5HRX A;  3UV5 A;  4UIW A;  5IGK A;  3ONI A;  5BT4 A;  5C87 A;  5EK9 A;  5I89 A;  2YDW A;  4HXS A;  5ENI A;  5D25 A;  4O71 A;  4TYL A;  3D7C A;  5AMF A;  3LJW A;  5ACY A;  2YYN A;  4AKI A;  4QBM A;  4TT4 A;  4TT2 A;  4XY9 A;  4YK0 A;  4LYW A;  5FE2 A;  5II2 A;  2RS9 B;  5JI8 A;  5E9V A;  4PTB A;  3ERR A;  4CUR A;  4YYK A;  4N4G A;  4GPJ A;  5A7C A;  4YAB A;  2R0Y A;  3U5O A;  5CZG A;  4YBM A;  4MEP A;  5F2P A;  5AD3 A;  5AME A;  2NXB A;  2DVV A;  5A5R A;  3G0J A;  5DYA A;  5I86 A;  3Q2F A;  3O36 A;  4NR5 A;  3O33 A;  3LQH A;  3UV4 A;  4Z1S A;  3MB4 A;  4NS5 A;  5TCM A;  4LC2 A;  5F62 A;  5L96 A;  4NYW A;  4O7E A;  4Z6I A;  5CPE A;  3QZT A;  5L97 A;  5F25 A;  5D3T A;  4YBT A;  5D3L A;  4QR5 A;  5KHM A;  4QNS A;  3SVG A;  4UYH A;  4A9J A;  5ENF A;  2F6N A;  3DAI A;  5H1T A;  5FG4 A;  5A85 A;  3P1C A;  2YEK A;  3LQI A;  5HFR A;  4Q0N A;  3U5L A;  4QB3 A;  4LZR A;  5K29 A;  5E9K A;  5I80 A;  3HME A;  5L8U A;  3RCW A;  2KTB B;  5EWH A;  4YAX A;  5DW1 A;  2DVS A;  4QR3 A;  4KV4 A;  4N4H A;  5G4R A;  5LUU A;  4HBX A;  4KCX A;  4UYG A;  5HEL A;  4UYE A;  4YY6 A;  3AQA A;  5ENG A;  4A9N A;  4TT6 A;  4IOR A;  4HXP A;  4BJX A;  4O7C A;  5CQ3 A;  4O74 A;  5A82 A;  2YW5 A;  2RNW A;  4LYI A;  5COI A;  3SVF A;  5CS8 A;  4WHU A;  3P1D A;  5A5Q A;  2E7N A;  4QSQ A;  3JVJ A;  5CGP A;  2OUO A;  3AAD A;  5CQ8 A;  5CY9 A;  4UIT A;  3ZYU A;  5IGL A;  5FH8 A;  4YBS A;  4YH3 A;  4CUS A;  2DVR A;  4O76 A;  4ALG A;  2OSS A;  5E9L A;  5H1V A;  5A5O A;  4CUU A;  5HM0 A;  5DLX A;  3S91 A;  5DFB A;  5DYU A;  4OUF A;  5FG5 A;  4CUP A;  4AI6 A;  3I3J A;  2H60 A;  4NR7 A;  4IR3 A;  5EWW A;  4BHW A;  4OGI A;  4MEN A;  4O7F A;  5E9M A;  4PCE A;  4X2I A;  5E73 A;  4QEW A;  4HBW A;  4QC3 A;  5J0D A;  5CQ4 A;  4QSS A;  4NR4 A;  4XYA A;  5G4S A;  5DKD A;  5CUD A;  3TLP A;  4NQN A;  4QUT A;  2R0S A;  5ENE A;  5F1H A;  4QSW A;  3VKH A;  5EGU A;  2OO1 A;  5A81 A;  5AD2 A;  4A9K A;  4A9H A;  5CUC A;  4O70 A;  5HRW A;  2FSA A;  4HBV A;  4MR4 A;  5CRZ A;  5EWC A;  4UIX A;  4F3I A;  4AKN A;  5CTL A;  3K2J A;  4UYD A;  2YEM A;  3MQM A;  5FH7 A;  5ENJ A;  5D3S A;  4UIU A;  3G0L A;  4QSP A;  5HQ5 A;  3P1E A;  5H1U A;  5E3G A;  5FB1 A;  2D9E A;  4NYV A;  5EPB A;  3IU5 A;  5EIC A;  5I40 A;  5I7Y A;  4BW4 A;  4O7B A;  4O75 A;  3DWY A;  5D3P A;  5D24 A;  4TZ2 A;  4A9L A;  4RVR A;  5HEN A;  4UIV A;  5FB0 A;  3O37 A;  5D26 A;  5FE8 A;  5FE9 A;  5DY7 A;  5KU3 A;  5F63 A;  4DON A;  4HXO A;  4QZS A;  5KTU A;  4YYH A;  5HCL A;  5CQ5 A;  4QEU A;  3QZS A;  3U5N A; 
#chains in the Genus database with same CATH homology
 4YYM A;  4E96 A;  5IG6 A;  4C66 A;  3UW9 A;  4LDF A;  4MEQ A;  5E3D A;  1N72 A;  4J1P A;  4NQM A;  4CLB A;  1F68 A;  5C89 A;  5I1Q A;  4J0R A;  4PY6 A;  4A9E A;  4NRB A;  5IBN A;  5E9I A;  5IGM A;  4NR9 A;  5C85 A;  3HMH A;  4CFL A;  2RO1 A;  5E0R A;  3UVX A;  2YQD A;  5D3J A;  2G4A A;  3MUK A;  4C67 A;  3JVL A;  4A9O A;  5L8T A;  2E3K A;  2DVQ A;  5F5Z A;  4MR3 A;  5FG6 A;  2GRC A;  4QR4 A;  5D0C A;  4QST A;  5HLS A;  5LJ2 A;  3LQJ A;  2MJV B;  4O7A A;  5EU1 A;  4TZ8 A;  5EIS A;  4Q0O A;  3UVD A;  4HBY A;  5CUG A;  4IR4 A;  4PCI A;  2RFJ A;  4NRA A;  5C7N A;  4ZW1 A;  5DYC A;  5DLZ A;  5DYX A;  5KTX A;  5II1 A;  5CQ7 A;  5F60 A;  4NXJ A;  5CUA A;  5EWD A;  4CL9 A;  4O72 A;  3UV2 A;  2DAT A;  5A5P A;  4A9F A;  4OGJ A;  2WP2 A;  5JWM A;  4N4I A;  1E6I A;  5I7X A;  4LZS A;  5KO4 A;  2R10 A;  4BW3 A;  5LKZ A;  4YYG A;  4UIZ A;  4QY4 A;  5ENB A;  5FE5 A;  4NUD A;  5ETD A;  5LJ1 A;  4XUA A;  4LR6 A;  4XUB A;  5A83 A;  4PKL A;  3U5J A;  5D3R A;  4BW1 A;  5CU8 A;  1EQF A;  5ENH A;  3FKM X;  5DBM A;  4NR8 A;  5F36 A;  5EP7 A;  3UVY A;  4WHW A;  4YH4 A;  5CP5 A;  5L99 A;  4HXK A;  3MUL A;  3JVM A;  5FFY A;  5LKT A;  5D3H A;  3SVH A;  4J3I A;  5I29 A;  4YY4 A;  5E7D A;  5EQ1 A;  4FLP A;  4YYN A;  4KV1 A;  5HQ7 A;  3Q2E A;  5TB6 A;  4J0S A;  2L5E A;  4Z93 A;  4ALH A;  4TU4 A;  5EI4 A;  2WP1 A;  4YYJ A;  1JM4 B;  4TTE A;  2I8N A;  3JVK A;  3MB3 A;  3LXJ A;  5EPS A;  4PS5 A;  5F3A A;  5CFW A;  4QYL A;  4UIY A;  4CUT A;  1WUG A;  1ZS5 A;  1X0J A;  5DKC A;  2DKW A;  5F1L A;  5FE7 A;  5FFV A;  4YC9 A;  4HXM A;  3U5K A;  2DWW A;  4HXR A;  5CRM A;  5C4Q A;  5CUE A;  4BW2 A;  4N3W A;  5HFQ A;  4UYF B;  2L84 A;  4QYD A;  4NRC A;  5CQ6 A;  4O77 A;  3UVW A;  3P5O A;  5BT5 A;  5HQ6 A;  3MXF A;  5FDZ A;  4QEV A;  5FBX A;  5KTW A;  5DKH A;  5CUB A;  5DW2 A;  4QSX A;  4QSV A;  5EM3 A;  5IID A;  5ETB A;  2N9G A;  2F6J A;  4A9M A;  3O35 A;  5H85 A;  2D82 A;  4TU6 A;  4ZQL A;  1WUM A;  4YYD A;  5HJC A;  1JSP B;  3P1F A;  4IR6 A;  2I7K A;  5LVQ A;  5C8G A;  4CFK A;  5IGN A;  4CUQ A;  5LJ0 A;  5I88 A;  2RNY A;  3NXB A;  4WIV A;  4MEO A;  5DFC A;  5EVA A;  5LKU A;  2R0V A;  4IR5 A;  4Z6H A;  5FE4 A;  4QC1 A;  5D7X A;  5LKX A;  5FE6 A;  4HXN A;  5BT3 A;  4HXL A;  4NYX A;  2RI7 A;  4N4F A;  4TS8 A;  5EPR A;  3S92 A;  2L85 A;  3U5P A;  5I83 A;  5FFW A;  5CQA A;  5D3N A;  5DFD A;  4TQN A;  5FE1 A;  4UYF A;  3O34 A;  4YYI A;  3GG3 A;  3IU6 A;  2E7O A;  5DX4 A;  5FE3 A;  5FE0 A;  5ENC A;  2YEL A;  5L98 A;  3HMF A;  4Z1Q A;  3QZV A;  4IOQ A;  4QUU A;  4LYS A;  4ZC9 A;  5FH6 A;  4NUE A;  4MR5 A;  4QSR A;  5CQT A;  4LZ2 A;  4IOO A;  4LRG A;  5EV9 A;  4XY8 A;  5LVR A;  4NR6 A;  4O78 A;  2RNX A;  4Y03 A;  5EWV A;  4QSU A;  4A9I A;  3U5M A;  5EA1 A;  5A5S A;  4YAD A;  5F61 A;  5HEM A;  5E9Y A;  2LSP B;  5HRV A;  5A5N A;  4NUC A;  5E74 A;  4YAT A;  4MR6 A;  5HRX A;  3UV5 A;  4UIW A;  5IGK A;  3ONI A;  5BT4 A;  5C87 A;  5EK9 A;  5I89 A;  2YDW A;  4HXS A;  5ENI A;  5D25 A;  4O71 A;  4TYL A;  3D7C A;  5AMF A;  3LJW A;  5ACY A;  2YYN A;  4QBM A;  4TT4 A;  4TT2 A;  4XY9 A;  4YK0 A;  4LYW A;  5FE2 A;  5II2 A;  2RS9 B;  5JI8 A;  5E9V A;  4PTB A;  4CUR A;  4YYK A;  4N4G A;  4GPJ A;  5A7C A;  4YAB A;  2R0Y A;  3U5O A;  5CZG A;  4YBM A;  4MEP A;  5F2P A;  5AD3 A;  5AME A;  2NXB A;  2DVV A;  5A5R A;  3G0J A;  5DYA A;  5I86 A;  3Q2F A;  3O36 A;  4NR5 A;  3O33 A;  3LQH A;  3UV4 A;  4Z1S A;  3MB4 A;  4NS5 A;  5TCM A;  4LC2 A;  5F62 A;  5L96 A;  4NYW A;  4O7E A;  4Z6I A;  5CPE A;  3QZT A;  5L97 A;  5F25 A;  5D3T A;  4YBT A;  5D3L A;  4QR5 A;  5KHM A;  4QNS A;  3SVG A;  4UYH A;  4A9J A;  5ENF A;  2F6N A;  3DAI A;  5H1T A;  5FG4 A;  5A85 A;  3P1C A;  2YEK A;  3LQI A;  5HFR A;  4Q0N A;  3U5L A;  4QB3 A;  4LZR A;  5K29 A;  5E9K A;  5I80 A;  3HME A;  5L8U A;  3RCW A;  2KTB B;  5EWH A;  4YAX A;  5DW1 A;  2DVS A;  4QR3 A;  4KV4 A;  4N4H A;  5G4R A;  5LUU A;  4HBX A;  4KCX A;  4UYG A;  5HEL A;  4UYE A;  4YY6 A;  3AQA A;  5ENG A;  4A9N A;  4TT6 A;  4IOR A;  4HXP A;  4BJX A;  4O7C A;  5CQ3 A;  4O74 A;  5A82 A;  2YW5 A;  2RNW A;  4LYI A;  5COI A;  3SVF A;  5CS8 A;  4WHU A;  3P1D A;  5A5Q A;  2E7N A;  4QSQ A;  3JVJ A;  5CGP A;  2OUO A;  3AAD A;  5CQ8 A;  5CY9 A;  4UIT A;  3ZYU A;  5IGL A;  5FH8 A;  4YBS A;  4YH3 A;  4CUS A;  2DVR A;  4O76 A;  4ALG A;  2OSS A;  5E9L A;  5H1V A;  5A5O A;  4CUU A;  5HM0 A;  5DLX A;  3S91 A;  5DFB A;  5DYU A;  4OUF A;  5FG5 A;  4CUP A;  3I3J A;  2H60 A;  4NR7 A;  4IR3 A;  5EWW A;  4BHW A;  4OGI A;  4MEN A;  4O7F A;  5E9M A;  4PCE A;  4X2I A;  5E73 A;  4QEW A;  4HBW A;  4QC3 A;  5J0D A;  5CQ4 A;  4QSS A;  4NR4 A;  4XYA A;  5G4S A;  5DKD A;  5CUD A;  3TLP A;  4NQN A;  4QUT A;  2R0S A;  5ENE A;  5F1H A;  4QSW A;  5EGU A;  2OO1 A;  5A81 A;  5AD2 A;  4A9K A;  4A9H A;  5CUC A;  4O70 A;  5HRW A;  2FSA A;  4HBV A;  4MR4 A;  5CRZ A;  5EWC A;  4UIX A;  4F3I A;  4AKN A;  5CTL A;  3K2J A;  4UYD A;  2YEM A;  3MQM A;  5FH7 A;  5ENJ A;  5D3S A;  4UIU A;  3G0L A;  4QSP A;  5HQ5 A;  3P1E A;  5H1U A;  5E3G A;  5FB1 A;  2D9E A;  4NYV A;  5EPB A;  3IU5 A;  5EIC A;  5I40 A;  5I7Y A;  4BW4 A;  4O7B A;  4O75 A;  3DWY A;  5D3P A;  5D24 A;  4TZ2 A;  4A9L A;  4RVR A;  5HEN A;  4UIV A;  5FB0 A;  3O37 A;  5D26 A;  5FE8 A;  5FE9 A;  5DY7 A;  5KU3 A;  5F63 A;  4DON A;  4HXO A;  4QZS A;  5KTU A;  4YYH A;  5HCL A;  5CQ5 A;  4QEU A;  3QZS A;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...