5D7XA

Crystal structure of the human brpf1 bromodomain in complex with xz08
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title The "Gatekeeper" Residue Influences the Mode of Binding of Acetyl Indoles to Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5d7xA00
5F25A 4QSTA 5KTUA 3HMFA 3I3JA 4Z1QA 4UIWA 4NYVA 5L99A 5G4SA 4ALGA 4WHUA 4FLPA 4Q0OA 5EICA 4IOOA 3P1EA 5H1UA 4TS8A 4TZ8A 4XUBA 2OO1A 1X0JA 5FE2A 4UITA 4NQMA 5FE1A 5E9MA 2OSSA 5JI8A 4QSPA 5FB1A 3U5KA 4QSRA 5TCMA 4BHWA 2L85A 4HXSA 4QR3A 3U5JA 5FH8A 5FH7A 4HXOA 2YELA 5EK9A 2F6JA 3MB3A 3Q2EA 5C8GA 5E9IA 2WP2A 4TT6A 5E9LA 3UW9A 5L8UA 5A83A 4Z6HA 5EI4A 4CURA 4TYLA 5I80A 5IGNA 3IU5A 4Z1SA 5FDZA 3O35A 5D26A 5FG6A 5EISA 4MEOA 3UV4A 5D3JA 5C87A 4Y03A 4LRGA 4NYWA 2RFJA 3P1FA 4KV1A 4QSUA 5DFCA 4LZSA 5FH6A 3MB4A 4HXLA 4UIXA 4E96A 4CUSA 4NRCA 1WUGA 4PKLA 3TLPA 5K29A 3UVYA 3U5PA 3SVGA 3UVXA 5CQ3A 5D3PA 5FB0A 1JM4B 4A9FA 5D3TA 5I7XA 5BT5A 1ZS5A 4A9OA 4BW4A 5ETDA 5HM0A 2RNYA 5C89A 4XY9A 3MUKA 4IR4A 5EGUA 4Z6IA 4CFLA 5F1LA 5ACYA 5ENEA 3SVHA 2E7OA 5LKZA 3P1DA 5CQTA 2G4AA 4UIYA 5IBNA 4O76A 5FE6A 4J1PA 2YEMA 2RNXA 4QNSA 4A9MA 4IORA 4MR4A 5A5QA 5I29A 5CTLA 5DYAA 5ENCA 2I8NA 4HBVA 2DVVA 4LYSA 5HELA 5FE7A 2F6NA 5I1QA 4LDFA 5I88A 5HFQA 4A9IA 2RO1A 5CUCA 5KHMA 5C85A 4YYNA 4UYDA 5E3DA 2YEKA 4QEUA 1N72A 3ZYUA 3FKMX 5FE8A 5IIDA 5EWHA 2DVQA 5A7CA 5CUBA 5F1HA 5ENFA 5AD2A 4QYDA 4CUPA 4YC9A 3GG3A 4UYGA 3D7CA 2YW5A 5II1A 4YYJA 4TU6A 1F68A 5ETBA 5L96A 4NUCA 4ZC9A 4TT2A 5LKXA 5DW2A 3NXBA 5FFYA 3S92A 4YYIA 5C7NA 5D3HA 5CZGA 5KO4A 4KCXA 4WIVA 5FE9A 5LUUA 4LYIA 2GRCA 4NRAA 4O71A 3JVLA 4PTBA 4PY6A 4MR3A 5LJ2A 4O70A 3MULA 3U5MA 5AMFA 4HXMA 4Q0NA 5EWVA 4UYEA 5EP7A 2YDWA 4N4HA 5D3NA 5EPSA 2FSAA 3O37A 3O36A 4AKNA 4YH3A 5CS8A 2DATA 3IU6A 5CQ6A 4QYLA 5KU3A 5ENGA 5FG5A 5CRMA 5DLZA 5EWCA 4LR6A 5ENBA 3LJWA 5EM3A 3UV2A 5CPEA 4N4IA 2D82A 4NR5A 3UV5A 2YQDA 4J3IA 4O75A 2DVSA 4NR7A 4TTEA 5CQ7A 3G0LA 2I7KA 4TU4A 5HLSA 2DWWA 4QUTA 5CQ4A 4ZW1A 4CFKA 5AD3A 4A9KA 5CU8A 5F36A 2L84A 5C4QA 5D7XA 4HXPA 4XY8A 1E6IA 2OUOA 4KV4A 3AQAA 4UYFB 5F3AA 5FE3A 5E9KA 5L8TA 5FBXA 4CUTA 5LJ1A 4RVRA 4HBXA 4YBTA 5H1VA 2MJVB 5HQ6A 3AADA 5II2A 4LC2A 4QC1A 4A9NA 5FG4A 5E9YA 3UVDA 4MENA 5E3GA 3LQIA 5F2PA 5HRWA 3U5OA 5DFDA 4WHWA 5F61A 5FFVA 3MXFA 4YK0A 5HJCA 2R0SA 4OGIA 3QZSA 4IR6A 5D24A 5J0DA 3O34A 3P1CA 1WUMA 5DKCA 4O7FA 3HMHA 5EPRA 5DKHA 5I89A 4J0RA 3DAIA 2R0YA 5D3RA 4QR5A 3HMEA 4HXNA 5HENA 4YBSA 4NRBA 3SVFA 5CQAA 2RS9B 5LKUA 5LKTA 4O7BA 5E7DA 4YYGA 4IR3A 4QSXA 4YATA 1EQFA 4QB3A 3LXJA 4NR8A 4BW1A 4N3WA 3Q2FA 2L5EA 5CP5A 4GPJA 5LJ0A 3U5NA 5ENIA 3G0JA 4QSWA 4YYHA 4YY4A 5EV9A 4PS5A 2NXBA 3P5OA 4LYWA 4O72A 5IGLA 2LSPB 4NR6A 4UYHA 5IGKA 4O74A 4DONA 5D3SA 5COIA 5E0RA 5EU1A 4ZQLA 4PCIA 4ALHA 4LZ2A 2R0VA 4YYMA 3QZTA 5ENJA 5CUEA 5ENHA 5KTXA 2E7NA 4NYXA 4QSVA 5FE0A 4QC3A 5A5RA 5FE4A 4HXRA 4TZ2A 5A81A 4O77A 5CRZA 4C67A 5A5PA 5I83A 4NR4A 5F60A 4YADA 4MEQA 3QZVA 4YBMA 5HEMA 4NS5A 4YH4A 3MQMA 4O7CA 5EWDA 5L97A 5D25A 4CUQA 4C66A 4YYDA 5KTWA 4NUDA 4QUUA 4UYFA 4QSQA 4N4GA 5A85A 5G4RA 2RI7A 2E3KA 3U5LA 4YABA 4YY6A 4TQNA 2R10A 4A9EA 3UVWA 3K2JA 4LZRA 5DYXA 4UIVA 2WP1A 5JWMA 4YAXA 5CGPA 5F62A 4MR5A 5A5NA 5D0CA 5IGMA 3ONIA 3DWYA 4XYAA 3LQJA 5I86A 5CQ8A 4QR4A 4HBWA 5L98A 4BW2A 5DFBA 3RCWA 4A9JA 3S91A 5CUAA 5EWWA 5A82A 2H60A 5DX4A 5HRVA 4J0SA 5EVAA 4Z93A 5TB6A 5F5ZA 4O7AA 4OGJA 5E9VA 3JVMA 5LVQA 4CUUA 4CL9A 4HBYA 4NXJA 5H1TA 2DVRA 4NQNA 4QEWA 5HCLA 5A5OA 4MR6A 4UIZA 4PCEA 5DY7A 4N4FA 5CUGA 2D9EA 5HQ5A 4OUFA 5CUDA 5CQ5A 5CFWA 3JVJA 4UIUA 4QEVA 5BT3A 4NUEA 5BT4A 5F63A 5DKDA 5EA1A 2N9GA 5H85A 4A9HA 3LQHA 2DKWA 5I7YA 5FE5A 4BW3A 2RNWA 4NR9A 5E74A 2KTBB 4O7EA 5IG6A 4XUAA 1JSPB 5DW1A 5EQ1A 5EPBA 5HQ7A 4IR5A 4CLBA 4HXKA 4X2IA 5DLXA 4MEPA 4F3IA 4BJXA 3O33A 5DBMA 5AMEA 5HFRA 5DYCA 2YYNA 5I40A 4YYKA 5DYUA 4QY4A 5CY9A 4O78A 4QSSA 4QBMA 5HRXA 5LVRA 5A5SA 4IOQA 5E73A 5D3LA 4TT4A 5FFWA 3JVKA 4QZSA 4A9LA
chains in the Genus database with same CATH superfamily
5F25A 4QSTA 5KTUA 3HMFA 3I3JA 4Z1QA 4UIWA 4NYVA 5L99A 5G4SA 4ALGA 4WHUA 4FLPA 4Q0OA 5EICA 4IOOA 3P1EA 5H1UA 4TS8A 4TZ8A 4XUBA 2OO1A 1X0JA 5FE2A 4UITA 4NQMA 5FE1A 5E9MA 2OSSA 5JI8A 4QSPA 5FB1A 3U5KA 4QSRA 5TCMA 4BHWA 2L85A 4HXSA 4QR3A 3U5JA 5FH8A 5FH7A 4HXOA 2YELA 5EK9A 2F6JA 3MB3A 3Q2EA 5C8GA 5E9IA 2WP2A 4TT6A 5E9LA 3UW9A 5L8UA 5A83A 4Z6HA 5EI4A 4CURA 4TYLA 5I80A 5IGNA 3IU5A 4Z1SA 5FDZA 3O35A 5D26A 5FG6A 5EISA 4MEOA 3UV4A 5D3JA 5C87A 4Y03A 4LRGA 4NYWA 2RFJA 3P1FA 4KV1A 4QSUA 5DFCA 4LZSA 5FH6A 3MB4A 4HXLA 4UIXA 4E96A 4CUSA 4NRCA 1WUGA 4PKLA 3TLPA 5K29A 3UVYA 3U5PA 3SVGA 3UVXA 5CQ3A 5D3PA 5FB0A 1JM4B 4A9FA 5D3TA 5I7XA 5BT5A 1ZS5A 4A9OA 4BW4A 5ETDA 5HM0A 2RNYA 5C89A 4XY9A 3MUKA 4IR4A 5EGUA 4Z6IA 4CFLA 5F1LA 5ACYA 5ENEA 3SVHA 2E7OA 5LKZA 3P1DA 1ZKRA 5CQTA 2G4AA 4UIYA 5IBNA 4O76A 5FE6A 4J1PA 2YEMA 2RNXA 4QNSA 4AKHA 4A9MA 4IORA 4MR4A 5A5QA 3ERRA 5CTLA 5DYAA 5ENCA 2I8NA 4HBVA 5I29A 2DVVA 4LYSA 5HELA 5FE7A 2F6NA 5I1QA 4LDFA 5I88A 5HFQA 4A9IA 2RO1A 5CUCA 5KHMA 5C85A 4YYNA 4UYDA 5E3DA 2YEKA 4QEUA 1N72A 3ZYUA 3FKMX 5FE8A 5IIDA 5EWHA 2DVQA 5A7CA 5CUBA 5F1HA 5ENFA 5AD2A 4QYDA 3D1DA 4CUPA 4YC9A 3GG3A 4UYGA 3D7CA 2YW5A 5II1A 4YYJA 4TU6A 1F68A 5ETBA 5L96A 4NUCA 4ZC9A 4TT2A 5LKXA 5DW2A 3NXBA 5FFYA 3S92A 4YYIA 5C7NA 5D3HA 5CZGA 5KO4A 4KCXA 4WIVA 5FE9A 5LUUA 4LYIA 2GRCA 4NRAA 4O71A 3JVLA 4PTBA 4PY6A 4MR3A 5LJ2A 4O70A 3MULA 3U5MA 2EJNA 5AMFA 4HXMA 4Q0NA 5EWVA 4UYEA 5EP7A 2YDWA 4N4HA 5D3NA 5EPSA 2FSAA 3O37A 3O36A 4AKNA 4YH3A 5CS8A 2DATA 3IU6A 5CQ6A 4QYLA 5KU3A 5ENGA 5FG5A 5CRMA 5DLZA 5EWCA 1PUOA 4LR6A 5ENBA 3LJWA 5EM3A 3UV2A 5CPEA 4N4IA 2D82A 4NR5A 3UV5A 2YQDA 4J3IA 4O75A 2DVSA 4NR7A 4TTEA 5CQ7A 3G0LA 2I7KA 4TU4A 5HLSA 2DWWA 4QUTA 5CQ4A 4ZW1A 4CFKA 5AD3A 4A9KA 5CU8A 5F36A 2L84A 5C4QA 5D7XA 4HXPA 4XY8A 1E6IA 2OUOA 4KV4A 3AQAA 4UYFB 5F3AA 5FE3A 5E9KA 5L8TA 5FBXA 4CUTA 5LJ1A 4RVRA 4HBXA 4YBTA 5H1VA 2MJVB 5HQ6A 3AADA 5II2A 4LC2A 4QC1A 4A9NA 5FG4A 5E9YA 3UVDA 4MENA 5E3GA 3LQIA 5F2PA 5HRWA 3U5OA 5DFDA 4WHWA 5F61A 5FFVA 3MXFA 4YK0A 5HJCA 2R0SA 4OGIA 3QZSA 4IR6A 5D24A 5J0DA 3O34A 3P1CA 1WUMA 5DKCA 4O7FA 3HMHA 5EPRA 5DKHA 5I89A 4J0RA 3DAIA 2R0YA 5D3RA 4QR5A 3HMEA 4HXNA 5HENA 4YBSA 4NRBA 3SVFA 5CQAA 2RS9B 5LKUA 5LKTA 4O7BA 5E7DA 4YYGA 4IR3A 4QSXA 4YATA 1EQFA 4QB3A 3LXJA 4NR8A 4BW1A 4N3WA 3Q2FA 2L5EA 5CP5A 4GPJA 5LJ0A 3U5NA 5ENIA 3G0JA 4QSWA 4YYHA 4YY4A 5EV9A 4PS5A 2NXBA 3P5OA 4LYWA 4O72A 5IGLA 2LSPB 4NR6A 4UYHA 5IGKA 4O74A 4DONA 5D3SA 5COIA 5E0RA 5EU1A 4ZQLA 4PCIA 4ALHA 4LZ2A 2R0VA 4YYMA 3QZTA 5ENJA 5CUEA 5ENHA 5KTXA 2E7NA 4NYXA 4QSVA 5FE0A 4QC3A 5A5RA 5FE4A 4HXRA 4TZ2A 5A81A 4O77A 5CRZA 4C67A 5A5PA 4AI6A 5I83A 4NR4A 5F60A 4YADA 4MEQA 3QZVA 4YBMA 5HEMA 4NS5A 4YH4A 3MQMA 4O7CA 5EWDA 5L97A 5D25A 4CUQA 4C66A 4YYDA 5KTWA 4NUDA 4QUUA 4UYFA 4QSQA 4N4GA 5A85A 5G4RA 2RI7A 2E3KA 3U5LA 4YABA 4YY6A 4TQNA 2R10A 4A9EA 3UVWA 3K2JA 4AKIA 4LZRA 5DYXA 4UIVA 2WP1A 5JWMA 4YAXA 5CGPA 5F62A 4MR5A 5A5NA 5D0CA 5IGMA 3ONIA 3DWYA 3VKHA 4XYAA 3LQJA 5I86A 5CQ8A 4QR4A 4HBWA 5L98A 4BW2A 5DFBA 3RCWA 4A9JA 3S91A 5CUAA 5EWWA 5A82A 4AKGA 2H60A 5DX4A 5HRVA 4J0SA 5EVAA 4Z93A 5TB6A 5F5ZA 4O7AA 4OGJA 5E9VA 3JVMA 5LVQA 4CUUA 4CL9A 4HBYA 4NXJA 5H1TA 2DVRA 4NQNA 4QEWA 5HCLA 5A5OA 4MR6A 4UIZA 4PCEA 5DY7A 4N4FA 5CUGA 3D1BA 2D9EA 5HQ5A 4OUFA 5CUDA 5CQ5A 5CFWA 3JVJA 4UIUA 4QEVA 5BT3A 4NUEA 5BT4A 5F63A 5DKDA 5EA1A 2N9GA 5H85A 4A9HA 3LQHA 2DKWA 5I7YA 5FE5A 4BW3A 2RNWA 4NR9A 5E74A 2KTBB 4O7EA 5IG6A 4XUAA 1JSPB 5DW1A 5EQ1A 5EPBA 5HQ7A 4IR5A 4CLBA 4HXKA 4X2IA 5DLXA 4MEPA 4F3IA 4BJXA 3O33A 5DBMA 5AMEA 5HFRA 5DYCA 2YYNA 5I40A 4YYKA 5DYUA 4QY4A 5CY9A 4O78A 4QSSA 4QBMA 5HRXA 5LVRA 5A5SA 4IOQA 5E73A 5D3LA 4TT4A 5FFWA 3VKGA 3JVKA 4QZSA 4A9LA
chains in the Genus database with same CATH topology
5F25A 4QSTA 5KTUA 3HMFA 3I3JA 4Z1QA 4UIWA 4NYVA 5L99A 5G4SA 4ALGA 4WHUA 4FLPA 4Q0OA 5EICA 4IOOA 3P1EA 5H1UA 4TS8A 4TZ8A 4XUBA 2OO1A 1X0JA 5FE2A 4UITA 4NQMA 5FE1A 5E9MA 2OSSA 5JI8A 4QSPA 5FB1A 3U5KA 4QSRA 5TCMA 4BHWA 2L85A 4HXSA 4QR3A 3U5JA 5FH8A 5FH7A 4HXOA 2YELA 5EK9A 2F6JA 3MB3A 3Q2EA 5C8GA 5E9IA 2WP2A 4TT6A 5E9LA 3UW9A 5L8UA 5A83A 4Z6HA 5EI4A 4CURA 4TYLA 5I80A 5IGNA 3IU5A 4Z1SA 5FDZA 3O35A 5D26A 5FG6A 5EISA 4MEOA 3UV4A 5D3JA 5C87A 4Y03A 4LRGA 4NYWA 2RFJA 3P1FA 4KV1A 4QSUA 5DFCA 4LZSA 5FH6A 3MB4A 4HXLA 4UIXA 4E96A 4CUSA 4NRCA 1WUGA 4PKLA 3TLPA 5K29A 3UVYA 3U5PA 3SVGA 3UVXA 5CQ3A 5D3PA 5FB0A 1JM4B 4A9FA 5D3TA 5I7XA 5BT5A 1ZS5A 4A9OA 4BW4A 5ETDA 5HM0A 2RNYA 5C89A 4XY9A 3MUKA 4IR4A 5EGUA 4Z6IA 4CFLA 5F1LA 5ACYA 5ENEA 3SVHA 2E7OA 5LKZA 3P1DA 5CQTA 2G4AA 4UIYA 5IBNA 4O76A 5FE6A 4J1PA 2YEMA 2RNXA 4QNSA 4A9MA 4IORA 4MR4A 5A5QA 5I29A 5CTLA 5DYAA 5ENCA 2I8NA 4HBVA 2DVVA 4LYSA 5HELA 5FE7A 2F6NA 5I1QA 4LDFA 5I88A 5HFQA 4A9IA 2RO1A 5CUCA 5KHMA 5C85A 4YYNA 4UYDA 5E3DA 2YEKA 4QEUA 1N72A 3ZYUA 3FKMX 5FE8A 5IIDA 5EWHA 2DVQA 5A7CA 5CUBA 5F1HA 5ENFA 5AD2A 4QYDA 4CUPA 4YC9A 3GG3A 4UYGA 3D7CA 2YW5A 5II1A 4YYJA 4TU6A 1F68A 5ETBA 5L96A 4NUCA 4ZC9A 4TT2A 5LKXA 5DW2A 3NXBA 5FFYA 3S92A 4YYIA 5C7NA 5D3HA 5CZGA 5KO4A 4KCXA 4WIVA 5FE9A 5LUUA 4LYIA 2GRCA 4NRAA 4O71A 3JVLA 4PTBA 4PY6A 4MR3A 5LJ2A 4O70A 3MULA 3U5MA 5AMFA 4HXMA 4Q0NA 5EWVA 4UYEA 5EP7A 2YDWA 4N4HA 5D3NA 5EPSA 2FSAA 3O37A 3O36A 4AKNA 4YH3A 5CS8A 2DATA 3IU6A 5CQ6A 4QYLA 5KU3A 5ENGA 5FG5A 5CRMA 5DLZA 5EWCA 4LR6A 5ENBA 3LJWA 5EM3A 3UV2A 5CPEA 4N4IA 2D82A 4NR5A 3UV5A 2YQDA 4J3IA 4O75A 2DVSA 4NR7A 4TTEA 5CQ7A 3G0LA 2I7KA 4TU4A 5HLSA 2DWWA 4QUTA 5CQ4A 4ZW1A 4CFKA 5AD3A 4A9KA 5CU8A 5F36A 2L84A 5C4QA 5D7XA 4HXPA 4XY8A 1E6IA 2OUOA 4KV4A 3AQAA 4UYFB 5F3AA 5FE3A 5E9KA 5L8TA 5FBXA 4CUTA 5LJ1A 4RVRA 4HBXA 4YBTA 5H1VA 2MJVB 5HQ6A 3AADA 5II2A 4LC2A 4QC1A 4A9NA 5FG4A 5E9YA 3UVDA 4MENA 5E3GA 3LQIA 5F2PA 5HRWA 3U5OA 5DFDA 4WHWA 5F61A 5FFVA 3MXFA 4YK0A 5HJCA 2R0SA 4OGIA 3QZSA 4IR6A 5D24A 5J0DA 3O34A 3P1CA 1WUMA 5DKCA 4O7FA 3HMHA 5EPRA 5DKHA 5I89A 4J0RA 3DAIA 2R0YA 5D3RA 4QR5A 3HMEA 4HXNA 5HENA 4YBSA 4NRBA 3SVFA 5CQAA 2RS9B 5LKUA 5LKTA 4O7BA 5E7DA 4YYGA 4IR3A 4QSXA 4YATA 1EQFA 4QB3A 3LXJA 4NR8A 4BW1A 4N3WA 3Q2FA 2L5EA 5CP5A 4GPJA 5LJ0A 3U5NA 5ENIA 3G0JA 4QSWA 4YYHA 4YY4A 5EV9A 4PS5A 2NXBA 3P5OA 4LYWA 4O72A 5IGLA 2LSPB 4NR6A 4UYHA 5IGKA 4O74A 4DONA 5D3SA 5COIA 5E0RA 5EU1A 4ZQLA 4PCIA 4ALHA 4LZ2A 2R0VA 4YYMA 3QZTA 5ENJA 5CUEA 5ENHA 5KTXA 2E7NA 4NYXA 4QSVA 5FE0A 4QC3A 5A5RA 5FE4A 4HXRA 4TZ2A 5A81A 4O77A 5CRZA 4C67A 5A5PA 5I83A 4NR4A 5F60A 4YADA 4MEQA 3QZVA 4YBMA 5HEMA 4NS5A 4YH4A 3MQMA 4O7CA 5EWDA 5L97A 5D25A 4CUQA 4C66A 4YYDA 5KTWA 4NUDA 4QUUA 4UYFA 4QSQA 4N4GA 5A85A 5G4RA 2RI7A 2E3KA 3U5LA 4YABA 4YY6A 4TQNA 2R10A 4A9EA 3UVWA 3K2JA 4LZRA 5DYXA 4UIVA 2WP1A 5JWMA 4YAXA 5CGPA 5F62A 4MR5A 5A5NA 5D0CA 5IGMA 3ONIA 3DWYA 4XYAA 3LQJA 5I86A 5CQ8A 4QR4A 4HBWA 5L98A 4BW2A 5DFBA 3RCWA 4A9JA 3S91A 5CUAA 5EWWA 5A82A 2H60A 5DX4A 5HRVA 4J0SA 5EVAA 4Z93A 5TB6A 5F5ZA 4O7AA 4OGJA 5E9VA 3JVMA 5LVQA 4CUUA 4CL9A 4HBYA 4NXJA 5H1TA 2DVRA 4NQNA 4QEWA 5HCLA 5A5OA 4MR6A 4UIZA 4PCEA 5DY7A 4N4FA 5CUGA 2D9EA 5HQ5A 4OUFA 5CUDA 5CQ5A 5CFWA 3JVJA 4UIUA 4QEVA 5BT3A 4NUEA 5BT4A 5F63A 5DKDA 5EA1A 2N9GA 5H85A 4A9HA 3LQHA 2DKWA 5I7YA 5FE5A 4BW3A 2RNWA 4NR9A 5E74A 2KTBB 4O7EA 5IG6A 4XUAA 1JSPB 5DW1A 5EQ1A 5EPBA 5HQ7A 4IR5A 4CLBA 4HXKA 4X2IA 5DLXA 4MEPA 4F3IA 4BJXA 3O33A 5DBMA 5AMEA 5HFRA 5DYCA 2YYNA 5I40A 4YYKA 5DYUA 4QY4A 5CY9A 4O78A 4QSSA 4QBMA 5HRXA 5LVRA 5A5SA 4IOQA 5E73A 5D3LA 4TT4A 5FFWA 3JVKA 4QZSA 4A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F25 A;  4QST A;  5KTU A;  3HMF A;  3I3J A;  4Z1Q A;  4UIW A;  4NYV A;  5L99 A;  5G4S A;  4ALG A;  4WHU A;  4FLP A;  4Q0O A;  5EIC A;  4IOO A;  3P1E A;  5H1U A;  4TS8 A;  4TZ8 A;  4XUB A;  2OO1 A;  1X0J A;  5FE2 A;  4UIT A;  4NQM A;  5FE1 A;  5E9M A;  2OSS A;  5JI8 A;  4QSP A;  5FB1 A;  3U5K A;  4QSR A;  5TCM A;  4BHW A;  2L85 A;  4HXS A;  4QR3 A;  3U5J A;  5FH8 A;  5FH7 A;  4HXO A;  2YEL A;  5EK9 A;  2F6J A;  3MB3 A;  3Q2E A;  5C8G A;  5E9I A;  2WP2 A;  4TT6 A;  5E9L A;  3UW9 A;  5L8U A;  5A83 A;  4Z6H A;  5EI4 A;  4CUR A;  4TYL A;  5I80 A;  5IGN A;  3IU5 A;  4Z1S A;  5FDZ A;  3O35 A;  5D26 A;  5FG6 A;  5EIS A;  4MEO A;  3UV4 A;  5D3J A;  5C87 A;  4Y03 A;  4LRG A;  4NYW A;  2RFJ A;  3P1F A;  4KV1 A;  4QSU A;  5DFC A;  4LZS A;  5FH6 A;  3MB4 A;  4HXL A;  4UIX A;  4E96 A;  4CUS A;  4NRC A;  1WUG A;  4PKL A;  3TLP A;  5K29 A;  3UVY A;  3U5P A;  3SVG A;  3UVX A;  5CQ3 A;  5D3P A;  5FB0 A;  1JM4 B;  4A9F A;  5D3T A;  5I7X A;  5BT5 A;  1ZS5 A;  4A9O A;  4BW4 A;  5ETD A;  5HM0 A;  2RNY A;  5C89 A;  4XY9 A;  3MUK A;  4IR4 A;  5EGU A;  4Z6I A;  4CFL A;  5F1L A;  5ACY A;  5ENE A;  3SVH A;  2E7O A;  5LKZ A;  3P1D A;  5CQT A;  2G4A A;  4UIY A;  5IBN A;  4O76 A;  5FE6 A;  4J1P A;  2YEM A;  2RNX A;  4QNS A;  4A9M A;  4IOR A;  4MR4 A;  5A5Q A;  5I29 A;  5CTL A;  5DYA A;  5ENC A;  2I8N A;  4HBV A;  2DVV A;  4LYS A;  5HEL A;  5FE7 A;  2F6N A;  5I1Q A;  4LDF A;  5I88 A;  5HFQ A;  4A9I A;  2RO1 A;  5CUC A;  5KHM A;  5C85 A;  4YYN A;  4UYD A;  5E3D A;  2YEK A;  4QEU A;  1N72 A;  3ZYU A;  3FKM X;  5FE8 A;  5IID A;  5EWH A;  2DVQ A;  5A7C A;  5CUB A;  5F1H A;  5ENF A;  5AD2 A;  4QYD A;  4CUP A;  4YC9 A;  3GG3 A;  4UYG A;  3D7C A;  2YW5 A;  5II1 A;  4YYJ A;  4TU6 A;  1F68 A;  5ETB A;  5L96 A;  4NUC A;  4ZC9 A;  4TT2 A;  5LKX A;  5DW2 A;  3NXB A;  5FFY A;  3S92 A;  4YYI A;  5C7N A;  5D3H A;  5CZG A;  5KO4 A;  4KCX A;  4WIV A;  5FE9 A;  5LUU A;  4LYI A;  2GRC A;  4NRA A;  4O71 A;  3JVL A;  4PTB A;  4PY6 A;  4MR3 A;  5LJ2 A;  4O70 A;  3MUL A;  3U5M A;  5AMF A;  4HXM A;  4Q0N A;  5EWV A;  4UYE A;  5EP7 A;  2YDW A;  4N4H A;  5D3N A;  5EPS A;  2FSA A;  3O37 A;  3O36 A;  4AKN A;  4YH3 A;  5CS8 A;  2DAT A;  3IU6 A;  5CQ6 A;  4QYL A;  5KU3 A;  5ENG A;  5FG5 A;  5CRM A;  5DLZ A;  5EWC A;  4LR6 A;  5ENB A;  3LJW A;  5EM3 A;  3UV2 A;  5CPE A;  4N4I A;  2D82 A;  4NR5 A;  3UV5 A;  2YQD A;  4J3I A;  4O75 A;  2DVS A;  4NR7 A;  4TTE A;  5CQ7 A;  3G0L A;  2I7K A;  4TU4 A;  5HLS A;  2DWW A;  4QUT A;  5CQ4 A;  4ZW1 A;  4CFK A;  5AD3 A;  4A9K A;  5CU8 A;  5F36 A;  2L84 A;  5C4Q A;  5D7X A;  4HXP A;  4XY8 A;  1E6I A;  2OUO A;  4KV4 A;  3AQA A;  4UYF B;  5F3A A;  5FE3 A;  5E9K A;  5L8T A;  5FBX A;  4CUT A;  5LJ1 A;  4RVR A;  4HBX A;  4YBT A;  5H1V A;  2MJV B;  5HQ6 A;  3AAD A;  5II2 A;  4LC2 A;  4QC1 A;  4A9N A;  5FG4 A;  5E9Y A;  3UVD A;  4MEN A;  5E3G A;  3LQI A;  5F2P A;  5HRW A;  3U5O A;  5DFD A;  4WHW A;  5F61 A;  5FFV A;  3MXF A;  4YK0 A;  5HJC A;  2R0S A;  4OGI A;  3QZS A;  4IR6 A;  5D24 A;  5J0D A;  3O34 A;  3P1C A;  1WUM A;  5DKC A;  4O7F A;  3HMH A;  5EPR A;  5DKH A;  5I89 A;  4J0R A;  3DAI A;  2R0Y A;  5D3R A;  4QR5 A;  3HME A;  4HXN A;  5HEN A;  4YBS A;  4NRB A;  3SVF A;  5CQA A;  2RS9 B;  5LKU A;  5LKT A;  4O7B A;  5E7D A;  4YYG A;  4IR3 A;  4QSX A;  4YAT A;  1EQF A;  4QB3 A;  3LXJ A;  4NR8 A;  4BW1 A;  4N3W A;  3Q2F A;  2L5E A;  5CP5 A;  4GPJ A;  5LJ0 A;  3U5N A;  5ENI A;  3G0J A;  4QSW A;  4YYH A;  4YY4 A;  5EV9 A;  4PS5 A;  2NXB A;  3P5O A;  4LYW A;  4O72 A;  5IGL A;  2LSP B;  4NR6 A;  4UYH A;  5IGK A;  4O74 A;  4DON A;  5D3S A;  5COI A;  5E0R A;  5EU1 A;  4ZQL A;  4PCI A;  4ALH A;  4LZ2 A;  2R0V A;  4YYM A;  3QZT A;  5ENJ A;  5CUE A;  5ENH A;  5KTX A;  2E7N A;  4NYX A;  4QSV A;  5FE0 A;  4QC3 A;  5A5R A;  5FE4 A;  4HXR A;  4TZ2 A;  5A81 A;  4O77 A;  5CRZ A;  4C67 A;  5A5P A;  5I83 A;  4NR4 A;  5F60 A;  4YAD A;  4MEQ A;  3QZV A;  4YBM A;  5HEM A;  4NS5 A;  4YH4 A;  3MQM A;  4O7C A;  5EWD A;  5L97 A;  5D25 A;  4CUQ A;  4C66 A;  4YYD A;  5KTW A;  4NUD A;  4QUU A;  4UYF A;  4QSQ A;  4N4G A;  5A85 A;  5G4R A;  2RI7 A;  2E3K A;  3U5L A;  4YAB A;  4YY6 A;  4TQN A;  2R10 A;  4A9E A;  3UVW A;  3K2J A;  4LZR A;  5DYX A;  4UIV A;  2WP1 A;  5JWM A;  4YAX A;  5CGP A;  5F62 A;  4MR5 A;  5A5N A;  5D0C A;  5IGM A;  3ONI A;  3DWY A;  4XYA A;  3LQJ A;  5I86 A;  5CQ8 A;  4QR4 A;  4HBW A;  5L98 A;  4BW2 A;  5DFB A;  3RCW A;  4A9J A;  3S91 A;  5CUA A;  5EWW A;  5A82 A;  2H60 A;  5DX4 A;  5HRV A;  4J0S A;  5EVA A;  4Z93 A;  5TB6 A;  5F5Z A;  4O7A A;  4OGJ A;  5E9V A;  3JVM A;  5LVQ A;  4CUU A;  4CL9 A;  4HBY A;  4NXJ A;  5H1T A;  2DVR A;  4NQN A;  4QEW A;  5HCL A;  5A5O A;  4MR6 A;  4UIZ A;  4PCE A;  5DY7 A;  4N4F A;  5CUG A;  2D9E A;  5HQ5 A;  4OUF A;  5CUD A;  5CQ5 A;  5CFW A;  3JVJ A;  4UIU A;  4QEV A;  5BT3 A;  4NUE A;  5BT4 A;  5F63 A;  5DKD A;  5EA1 A;  2N9G A;  5H85 A;  4A9H A;  3LQH A;  2DKW A;  5I7Y A;  5FE5 A;  4BW3 A;  2RNW A;  4NR9 A;  5E74 A;  2KTB B;  4O7E A;  5IG6 A;  4XUA A;  1JSP B;  5DW1 A;  5EQ1 A;  5EPB A;  5HQ7 A;  4IR5 A;  4CLB A;  4HXK A;  4X2I A;  5DLX A;  4MEP A;  4F3I A;  4BJX A;  3O33 A;  5DBM A;  5AME A;  5HFR A;  5DYC A;  2YYN A;  5I40 A;  4YYK A;  5DYU A;  4QY4 A;  5CY9 A;  4O78 A;  4QSS A;  4QBM A;  5HRX A;  5LVR A;  5A5S A;  4IOQ A;  5E73 A;  5D3L A;  4TT4 A;  5FFW A;  3JVK A;  4QZS A;  4A9L A; 
#chains in the Genus database with same CATH topology
 5F25 A;  4QST A;  5KTU A;  3HMF A;  3I3J A;  4Z1Q A;  4UIW A;  4NYV A;  5L99 A;  5G4S A;  4ALG A;  4WHU A;  4FLP A;  4Q0O A;  5EIC A;  4IOO A;  3P1E A;  5H1U A;  4TS8 A;  4TZ8 A;  4XUB A;  2OO1 A;  1X0J A;  5FE2 A;  4UIT A;  4NQM A;  5FE1 A;  5E9M A;  2OSS A;  5JI8 A;  4QSP A;  5FB1 A;  3U5K A;  4QSR A;  5TCM A;  4BHW A;  2L85 A;  4HXS A;  4QR3 A;  3U5J A;  5FH8 A;  5FH7 A;  4HXO A;  2YEL A;  5EK9 A;  2F6J A;  3MB3 A;  3Q2E A;  5C8G A;  5E9I A;  2WP2 A;  4TT6 A;  5E9L A;  3UW9 A;  5L8U A;  5A83 A;  4Z6H A;  5EI4 A;  4CUR A;  4TYL A;  5I80 A;  5IGN A;  3IU5 A;  4Z1S A;  5FDZ A;  3O35 A;  5D26 A;  5FG6 A;  5EIS A;  4MEO A;  3UV4 A;  5D3J A;  5C87 A;  4Y03 A;  4LRG A;  4NYW A;  2RFJ A;  3P1F A;  4KV1 A;  4QSU A;  5DFC A;  4LZS A;  5FH6 A;  3MB4 A;  4HXL A;  4UIX A;  4E96 A;  4CUS A;  4NRC A;  1WUG A;  4PKL A;  3TLP A;  5K29 A;  3UVY A;  3U5P A;  3SVG A;  3UVX A;  5CQ3 A;  5D3P A;  5FB0 A;  1JM4 B;  4A9F A;  5D3T A;  5I7X A;  5BT5 A;  1ZS5 A;  4A9O A;  4BW4 A;  5ETD A;  5HM0 A;  2RNY A;  5C89 A;  4XY9 A;  3MUK A;  4IR4 A;  5EGU A;  4Z6I A;  4CFL A;  5F1L A;  5ACY A;  5ENE A;  3SVH A;  2E7O A;  5LKZ A;  3P1D A;  1ZKR A;  5CQT A;  2G4A A;  4UIY A;  5IBN A;  4O76 A;  5FE6 A;  4J1P A;  2YEM A;  2RNX A;  4QNS A;  4AKH A;  4A9M A;  4IOR A;  4MR4 A;  5A5Q A;  3ERR A;  5CTL A;  5DYA A;  5ENC A;  2I8N A;  4HBV A;  5I29 A;  2DVV A;  4LYS A;  5HEL A;  5FE7 A;  2F6N A;  5I1Q A;  4LDF A;  5I88 A;  5HFQ A;  4A9I A;  2RO1 A;  5CUC A;  5KHM A;  5C85 A;  4YYN A;  4UYD A;  5E3D A;  2YEK A;  4QEU A;  1N72 A;  3ZYU A;  3FKM X;  5FE8 A;  5IID A;  5EWH A;  2DVQ A;  5A7C A;  5CUB A;  5F1H A;  5ENF A;  5AD2 A;  4QYD A;  3D1D A;  4CUP A;  4YC9 A;  3GG3 A;  4UYG A;  3D7C A;  2YW5 A;  5II1 A;  4YYJ A;  4TU6 A;  1F68 A;  5ETB A;  5L96 A;  4NUC A;  4ZC9 A;  4TT2 A;  5LKX A;  5DW2 A;  3NXB A;  5FFY A;  3S92 A;  4YYI A;  5C7N A;  5D3H A;  5CZG A;  5KO4 A;  4KCX A;  4WIV A;  5FE9 A;  5LUU A;  4LYI A;  2GRC A;  4NRA A;  4O71 A;  3JVL A;  4PTB A;  4PY6 A;  4MR3 A;  5LJ2 A;  4O70 A;  3MUL A;  3U5M A;  2EJN A;  5AMF A;  4HXM A;  4Q0N A;  5EWV A;  4UYE A;  5EP7 A;  2YDW A;  4N4H A;  5D3N A;  5EPS A;  2FSA A;  3O37 A;  3O36 A;  4AKN A;  4YH3 A;  5CS8 A;  2DAT A;  3IU6 A;  5CQ6 A;  4QYL A;  5KU3 A;  5ENG A;  5FG5 A;  5CRM A;  5DLZ A;  5EWC A;  1PUO A;  4LR6 A;  5ENB A;  3LJW A;  5EM3 A;  3UV2 A;  5CPE A;  4N4I A;  2D82 A;  4NR5 A;  3UV5 A;  2YQD A;  4J3I A;  4O75 A;  2DVS A;  4NR7 A;  4TTE A;  5CQ7 A;  3G0L A;  2I7K A;  4TU4 A;  5HLS A;  2DWW A;  4QUT A;  5CQ4 A;  4ZW1 A;  4CFK A;  5AD3 A;  4A9K A;  5CU8 A;  5F36 A;  2L84 A;  5C4Q A;  5D7X A;  4HXP A;  4XY8 A;  1E6I A;  2OUO A;  4KV4 A;  3AQA A;  4UYF B;  5F3A A;  5FE3 A;  5E9K A;  5L8T A;  5FBX A;  4CUT A;  5LJ1 A;  4RVR A;  4HBX A;  4YBT A;  5H1V A;  2MJV B;  5HQ6 A;  3AAD A;  5II2 A;  4LC2 A;  4QC1 A;  4A9N A;  5FG4 A;  5E9Y A;  3UVD A;  4MEN A;  5E3G A;  3LQI A;  5F2P A;  5HRW A;  3U5O A;  5DFD A;  4WHW A;  5F61 A;  5FFV A;  3MXF A;  4YK0 A;  5HJC A;  2R0S A;  4OGI A;  3QZS A;  4IR6 A;  5D24 A;  5J0D A;  3O34 A;  3P1C A;  1WUM A;  5DKC A;  4O7F A;  3HMH A;  5EPR A;  5DKH A;  5I89 A;  4J0R A;  3DAI A;  2R0Y A;  5D3R A;  4QR5 A;  3HME A;  4HXN A;  5HEN A;  4YBS A;  4NRB A;  3SVF A;  5CQA A;  2RS9 B;  5LKU A;  5LKT A;  4O7B A;  5E7D A;  4YYG A;  4IR3 A;  4QSX A;  4YAT A;  1EQF A;  4QB3 A;  3LXJ A;  4NR8 A;  4BW1 A;  4N3W A;  3Q2F A;  2L5E A;  5CP5 A;  4GPJ A;  5LJ0 A;  3U5N A;  5ENI A;  3G0J A;  4QSW A;  4YYH A;  4YY4 A;  5EV9 A;  4PS5 A;  2NXB A;  3P5O A;  4LYW A;  4O72 A;  5IGL A;  2LSP B;  4NR6 A;  4UYH A;  5IGK A;  4O74 A;  4DON A;  5D3S A;  5COI A;  5E0R A;  5EU1 A;  4ZQL A;  4PCI A;  4ALH A;  4LZ2 A;  2R0V A;  4YYM A;  3QZT A;  5ENJ A;  5CUE A;  5ENH A;  5KTX A;  2E7N A;  4NYX A;  4QSV A;  5FE0 A;  4QC3 A;  5A5R A;  5FE4 A;  4HXR A;  4TZ2 A;  5A81 A;  4O77 A;  5CRZ A;  4C67 A;  5A5P A;  4AI6 A;  5I83 A;  4NR4 A;  5F60 A;  4YAD A;  4MEQ A;  3QZV A;  4YBM A;  5HEM A;  4NS5 A;  4YH4 A;  3MQM A;  4O7C A;  5EWD A;  5L97 A;  5D25 A;  4CUQ A;  4C66 A;  4YYD A;  5KTW A;  4NUD A;  4QUU A;  4UYF A;  4QSQ A;  4N4G A;  5A85 A;  5G4R A;  2RI7 A;  2E3K A;  3U5L A;  4YAB A;  4YY6 A;  4TQN A;  2R10 A;  4A9E A;  3UVW A;  3K2J A;  4AKI A;  4LZR A;  5DYX A;  4UIV A;  2WP1 A;  5JWM A;  4YAX A;  5CGP A;  5F62 A;  4MR5 A;  5A5N A;  5D0C A;  5IGM A;  3ONI A;  3DWY A;  3VKH A;  4XYA A;  3LQJ A;  5I86 A;  5CQ8 A;  4QR4 A;  4HBW A;  5L98 A;  4BW2 A;  5DFB A;  3RCW A;  4A9J A;  3S91 A;  5CUA A;  5EWW A;  5A82 A;  4AKG A;  2H60 A;  5DX4 A;  5HRV A;  4J0S A;  5EVA A;  4Z93 A;  5TB6 A;  5F5Z A;  4O7A A;  4OGJ A;  5E9V A;  3JVM A;  5LVQ A;  4CUU A;  4CL9 A;  4HBY A;  4NXJ A;  5H1T A;  2DVR A;  4NQN A;  4QEW A;  5HCL A;  5A5O A;  4MR6 A;  4UIZ A;  4PCE A;  5DY7 A;  4N4F A;  5CUG A;  3D1B A;  2D9E A;  5HQ5 A;  4OUF A;  5CUD A;  5CQ5 A;  5CFW A;  3JVJ A;  4UIU A;  4QEV A;  5BT3 A;  4NUE A;  5BT4 A;  5F63 A;  5DKD A;  5EA1 A;  2N9G A;  5H85 A;  4A9H A;  3LQH A;  2DKW A;  5I7Y A;  5FE5 A;  4BW3 A;  2RNW A;  4NR9 A;  5E74 A;  2KTB B;  4O7E A;  5IG6 A;  4XUA A;  1JSP B;  5DW1 A;  5EQ1 A;  5EPB A;  5HQ7 A;  4IR5 A;  4CLB A;  4HXK A;  4X2I A;  5DLX A;  4MEP A;  4F3I A;  4BJX A;  3O33 A;  5DBM A;  5AME A;  5HFR A;  5DYC A;  2YYN A;  5I40 A;  4YYK A;  5DYU A;  4QY4 A;  5CY9 A;  4O78 A;  4QSS A;  4QBM A;  5HRX A;  5LVR A;  5A5S A;  4IOQ A;  5E73 A;  5D3L A;  4TT4 A;  5FFW A;  3VKG A;  3JVK A;  4QZS A;  4A9L A; 
#chains in the Genus database with same CATH homology
 5F25 A;  4QST A;  5KTU A;  3HMF A;  3I3J A;  4Z1Q A;  4UIW A;  4NYV A;  5L99 A;  5G4S A;  4ALG A;  4WHU A;  4FLP A;  4Q0O A;  5EIC A;  4IOO A;  3P1E A;  5H1U A;  4TS8 A;  4TZ8 A;  4XUB A;  2OO1 A;  1X0J A;  5FE2 A;  4UIT A;  4NQM A;  5FE1 A;  5E9M A;  2OSS A;  5JI8 A;  4QSP A;  5FB1 A;  3U5K A;  4QSR A;  5TCM A;  4BHW A;  2L85 A;  4HXS A;  4QR3 A;  3U5J A;  5FH8 A;  5FH7 A;  4HXO A;  2YEL A;  5EK9 A;  2F6J A;  3MB3 A;  3Q2E A;  5C8G A;  5E9I A;  2WP2 A;  4TT6 A;  5E9L A;  3UW9 A;  5L8U A;  5A83 A;  4Z6H A;  5EI4 A;  4CUR A;  4TYL A;  5I80 A;  5IGN A;  3IU5 A;  4Z1S A;  5FDZ A;  3O35 A;  5D26 A;  5FG6 A;  5EIS A;  4MEO A;  3UV4 A;  5D3J A;  5C87 A;  4Y03 A;  4LRG A;  4NYW A;  2RFJ A;  3P1F A;  4KV1 A;  4QSU A;  5DFC A;  4LZS A;  5FH6 A;  3MB4 A;  4HXL A;  4UIX A;  4E96 A;  4CUS A;  4NRC A;  1WUG A;  4PKL A;  3TLP A;  5K29 A;  3UVY A;  3U5P A;  3SVG A;  3UVX A;  5CQ3 A;  5D3P A;  5FB0 A;  1JM4 B;  4A9F A;  5D3T A;  5I7X A;  5BT5 A;  1ZS5 A;  4A9O A;  4BW4 A;  5ETD A;  5HM0 A;  2RNY A;  5C89 A;  4XY9 A;  3MUK A;  4IR4 A;  5EGU A;  4Z6I A;  4CFL A;  5F1L A;  5ACY A;  5ENE A;  3SVH A;  2E7O A;  5LKZ A;  3P1D A;  5CQT A;  2G4A A;  4UIY A;  5IBN A;  4O76 A;  5FE6 A;  4J1P A;  2YEM A;  2RNX A;  4QNS A;  4A9M A;  4IOR A;  4MR4 A;  5A5Q A;  5I29 A;  5CTL A;  5DYA A;  5ENC A;  2I8N A;  4HBV A;  2DVV A;  4LYS A;  5HEL A;  5FE7 A;  2F6N A;  5I1Q A;  4LDF A;  5I88 A;  5HFQ A;  4A9I A;  2RO1 A;  5CUC A;  5KHM A;  5C85 A;  4YYN A;  4UYD A;  5E3D A;  2YEK A;  4QEU A;  1N72 A;  3ZYU A;  3FKM X;  5FE8 A;  5IID A;  5EWH A;  2DVQ A;  5A7C A;  5CUB A;  5F1H A;  5ENF A;  5AD2 A;  4QYD A;  4CUP A;  4YC9 A;  3GG3 A;  4UYG A;  3D7C A;  2YW5 A;  5II1 A;  4YYJ A;  4TU6 A;  1F68 A;  5ETB A;  5L96 A;  4NUC A;  4ZC9 A;  4TT2 A;  5LKX A;  5DW2 A;  3NXB A;  5FFY A;  3S92 A;  4YYI A;  5C7N A;  5D3H A;  5CZG A;  5KO4 A;  4KCX A;  4WIV A;  5FE9 A;  5LUU A;  4LYI A;  2GRC A;  4NRA A;  4O71 A;  3JVL A;  4PTB A;  4PY6 A;  4MR3 A;  5LJ2 A;  4O70 A;  3MUL A;  3U5M A;  5AMF A;  4HXM A;  4Q0N A;  5EWV A;  4UYE A;  5EP7 A;  2YDW A;  4N4H A;  5D3N A;  5EPS A;  2FSA A;  3O37 A;  3O36 A;  4AKN A;  4YH3 A;  5CS8 A;  2DAT A;  3IU6 A;  5CQ6 A;  4QYL A;  5KU3 A;  5ENG A;  5FG5 A;  5CRM A;  5DLZ A;  5EWC A;  4LR6 A;  5ENB A;  3LJW A;  5EM3 A;  3UV2 A;  5CPE A;  4N4I A;  2D82 A;  4NR5 A;  3UV5 A;  2YQD A;  4J3I A;  4O75 A;  2DVS A;  4NR7 A;  4TTE A;  5CQ7 A;  3G0L A;  2I7K A;  4TU4 A;  5HLS A;  2DWW A;  4QUT A;  5CQ4 A;  4ZW1 A;  4CFK A;  5AD3 A;  4A9K A;  5CU8 A;  5F36 A;  2L84 A;  5C4Q A;  5D7X A;  4HXP A;  4XY8 A;  1E6I A;  2OUO A;  4KV4 A;  3AQA A;  4UYF B;  5F3A A;  5FE3 A;  5E9K A;  5L8T A;  5FBX A;  4CUT A;  5LJ1 A;  4RVR A;  4HBX A;  4YBT A;  5H1V A;  2MJV B;  5HQ6 A;  3AAD A;  5II2 A;  4LC2 A;  4QC1 A;  4A9N A;  5FG4 A;  5E9Y A;  3UVD A;  4MEN A;  5E3G A;  3LQI A;  5F2P A;  5HRW A;  3U5O A;  5DFD A;  4WHW A;  5F61 A;  5FFV A;  3MXF A;  4YK0 A;  5HJC A;  2R0S A;  4OGI A;  3QZS A;  4IR6 A;  5D24 A;  5J0D A;  3O34 A;  3P1C A;  1WUM A;  5DKC A;  4O7F A;  3HMH A;  5EPR A;  5DKH A;  5I89 A;  4J0R A;  3DAI A;  2R0Y A;  5D3R A;  4QR5 A;  3HME A;  4HXN A;  5HEN A;  4YBS A;  4NRB A;  3SVF A;  5CQA A;  2RS9 B;  5LKU A;  5LKT A;  4O7B A;  5E7D A;  4YYG A;  4IR3 A;  4QSX A;  4YAT A;  1EQF A;  4QB3 A;  3LXJ A;  4NR8 A;  4BW1 A;  4N3W A;  3Q2F A;  2L5E A;  5CP5 A;  4GPJ A;  5LJ0 A;  3U5N A;  5ENI A;  3G0J A;  4QSW A;  4YYH A;  4YY4 A;  5EV9 A;  4PS5 A;  2NXB A;  3P5O A;  4LYW A;  4O72 A;  5IGL A;  2LSP B;  4NR6 A;  4UYH A;  5IGK A;  4O74 A;  4DON A;  5D3S A;  5COI A;  5E0R A;  5EU1 A;  4ZQL A;  4PCI A;  4ALH A;  4LZ2 A;  2R0V A;  4YYM A;  3QZT A;  5ENJ A;  5CUE A;  5ENH A;  5KTX A;  2E7N A;  4NYX A;  4QSV A;  5FE0 A;  4QC3 A;  5A5R A;  5FE4 A;  4HXR A;  4TZ2 A;  5A81 A;  4O77 A;  5CRZ A;  4C67 A;  5A5P A;  5I83 A;  4NR4 A;  5F60 A;  4YAD A;  4MEQ A;  3QZV A;  4YBM A;  5HEM A;  4NS5 A;  4YH4 A;  3MQM A;  4O7C A;  5EWD A;  5L97 A;  5D25 A;  4CUQ A;  4C66 A;  4YYD A;  5KTW A;  4NUD A;  4QUU A;  4UYF A;  4QSQ A;  4N4G A;  5A85 A;  5G4R A;  2RI7 A;  2E3K A;  3U5L A;  4YAB A;  4YY6 A;  4TQN A;  2R10 A;  4A9E A;  3UVW A;  3K2J A;  4LZR A;  5DYX A;  4UIV A;  2WP1 A;  5JWM A;  4YAX A;  5CGP A;  5F62 A;  4MR5 A;  5A5N A;  5D0C A;  5IGM A;  3ONI A;  3DWY A;  4XYA A;  3LQJ A;  5I86 A;  5CQ8 A;  4QR4 A;  4HBW A;  5L98 A;  4BW2 A;  5DFB A;  3RCW A;  4A9J A;  3S91 A;  5CUA A;  5EWW A;  5A82 A;  2H60 A;  5DX4 A;  5HRV A;  4J0S A;  5EVA A;  4Z93 A;  5TB6 A;  5F5Z A;  4O7A A;  4OGJ A;  5E9V A;  3JVM A;  5LVQ A;  4CUU A;  4CL9 A;  4HBY A;  4NXJ A;  5H1T A;  2DVR A;  4NQN A;  4QEW A;  5HCL A;  5A5O A;  4MR6 A;  4UIZ A;  4PCE A;  5DY7 A;  4N4F A;  5CUG A;  2D9E A;  5HQ5 A;  4OUF A;  5CUD A;  5CQ5 A;  5CFW A;  3JVJ A;  4UIU A;  4QEV A;  5BT3 A;  4NUE A;  5BT4 A;  5F63 A;  5DKD A;  5EA1 A;  2N9G A;  5H85 A;  4A9H A;  3LQH A;  2DKW A;  5I7Y A;  5FE5 A;  4BW3 A;  2RNW A;  4NR9 A;  5E74 A;  2KTB B;  4O7E A;  5IG6 A;  4XUA A;  1JSP B;  5DW1 A;  5EQ1 A;  5EPB A;  5HQ7 A;  4IR5 A;  4CLB A;  4HXK A;  4X2I A;  5DLX A;  4MEP A;  4F3I A;  4BJX A;  3O33 A;  5DBM A;  5AME A;  5HFR A;  5DYC A;  2YYN A;  5I40 A;  4YYK A;  5DYU A;  4QY4 A;  5CY9 A;  4O78 A;  4QSS A;  4QBM A;  5HRX A;  5LVR A;  5A5S A;  4IOQ A;  5E73 A;  5D3L A;  4TT4 A;  5FFW A;  3JVK A;  4QZS A;  4A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...