3D1DA

Hexagonal crystal structure of tas3 c-terminal alpha motif
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
109
structure length
109
Chain Sequence
NDLYINWLKSLSFFQTNSSCAEALVKVIPHYHNKLIDFSQVLQLVFSASEKFPIQENQPLPEQLMFLSNLEKQTPFAKAVGSSIYKLVTGKNLSLDFASQILKEASILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords RNA-induced transcriptional silencing complex protein tas3
publication title An alpha motif at Tas3 C terminus mediates RITS cis spreading and promotes heterochromatic gene silencing.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 45
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.40 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 3d1dA00
3D1BA 3D1DA
chains in the Genus database with same CATH superfamily
5CUBA 4YYIA 2L5EA 4NR9A 5IIDA 4AKIA 3UV2A 4YYKA 5A5RA 4N3WA 5CQ8A 5CGPA 4KCXA 4HXSA 3LXJA 3JVKA 5HENA 4NYXA 5CU8A 5CZGA 3UVXA 5D24A 4QSWA 5FDZA 5LUUA 5E9IA 2LSPB 3P1DA 4HXLA 3TLPA 3G0JA 4BW1A 5C7NA 4KV4A 4BW4A 4PCIA 2RO1A 5L97A 4NR4A 3FKMX 5HCLA 5F61A 5I86A 5AMFA 4QZSA 5D3PA 3HMFA 2YW5A 4N4GA 4UIWA 4QBMA 5EWWA 4A9KA 4YY4A 4QR5A 4LYSA 4QC1A 1N72A 3U5KA 4LDFA 4YBMA 4O7BA 5LJ2A 2DWWA 4MR4A 5ENGA 5KU3A 5CRZA 5G4RA 4NR8A 4TZ2A 4UYDA 4YYJA 5K29A 3U5PA 3MQMA 2YEMA 5D25A 5EA1A 1JM4B 3I3JA 4UYEA 4WHWA 5AD3A 5A5QA 5DW1A 4QSPA 5A81A 2I7KA 5ENFA 4HXKA 5FE1A 5FE3A 5KO4A 4TT4A 5HELA 4LRGA 3VKHA 4O72A 4NQNA 3MB4A 4Z6IA 4HBVA 4O71A 4HXNA 3NXBA 4UIUA 5C85A 4YYGA 5FE2A 5ENIA 3GG3A 5FH8A 5HLSA 2YYNA 4QEUA 1WUMA 5DYCA 4MENA 5FH7A 4QC3A 4AI6A 5F2PA 5EV9A 3UV4A 3LJWA 5F25A 3JVLA 3AQAA 3P1EA 5DKCA 2FSAA 2YELA 4O7AA 4O76A 4Y03A 4HXRA 5I40A 5CUEA 3JVMA 5I7XA 3MB3A 5CQ6A 5CQ3A 2MJVB 5EVAA 5L8TA 5CS8A 4F3IA 5LKZA 2DATA 4KV1A 5ETDA 3QZVA 5CTLA 5I88A 4YYDA 2F6JA 4QR3A 4UIZA 4PS5A 4YABA 4NS5A 4AKHA 2G4AA 5A5NA 5LJ1A 4HXPA 2YDWA 5LVQA 4O77A 5EGUA 5CPEA 5H1TA 2R0VA 4OUFA 3P5OA 5CQ4A 4UYFB 5DLZA 4UIVA 4UYGA 5ENHA 5EWDA 5DKDA 5EWHA 5DLXA 5HFQA 2RNXA 5KTXA 4NRCA 5FE8A 3P1FA 5EICA 1WUGA 5J0DA 3D1BA 5C87A 4CUSA 3QZSA 4BHWA 4AKNA 4IOOA 5D3HA 5CUCA 5EPRA 4TT2A 5E7DA 5KTUA 5ENJA 3HMHA 3DWYA 4CUUA 5F36A 3DAIA 5F63A 4LC2A 4QUTA 5CFWA 5D7XA 5BT3A 3LQJA 4NRBA 5C8GA 4A9FA 4QSQA 5CY9A 5F5ZA 5CQTA 4O7FA 2KTBB 3HMEA 5A82A 4ALHA 4CFKA 4WIVA 4C67A 4QEVA 4MEPA 4YC9A 4NUEA 5HM0A 5FE9A 5FE7A 2I8NA 3O35A 4J1PA 5I29A 3JVJA 4PY6A 3O33A 4UITA 5FG6A 4QEWA 2YEKA 2D9EA 5CQAA 3P1CA 5II1A 4QSRA 5TB6A 2RFJA 4YBTA 5FFVA 4QSVA 5HJCA 5FFYA 4YK0A 5IGLA 2F6NA 2DVQA 3G0LA 2NXBA 4XYAA 4TTEA 3K2JA 3ZYUA 5CUDA 3ONIA 5D3RA 5LKUA 5DYXA 4A9NA 5EQ1A 3LQIA 5BT4A 5F60A 3U5OA 5CP5A 3SVHA 2H60A 5FE0A 4IR6A 2OUOA 4NYWA 5FE6A 4CURA 4DONA 5FFWA 4CUTA 5D3LA 5D0CA 5IGKA 3VKGA 5H1VA 2DKWA 4ZQLA 2L84A 5EU1A 3O34A 3Q2EA 5DFDA 5EM3A 5A5OA 2OSSA 5HQ6A 4A9HA 4LYWA 4AKGA 5L98A 4BJXA 4FLPA 4CFLA 4QSUA 4Z6HA 3U5MA 4PKLA 5CUAA 5C4QA 4YH4A 3QZTA 4YYMA 5I83A 3UV5A 5DKHA 3D1DA 4X2IA 3UVYA 4MEQA 4J0SA 4Q0OA 4NRAA 4YY6A 5FG4A 5E9LA 5F62A 5JI8A 4NR7A 4A9OA 5EPBA 4IORA 4HBXA 4QY4A 4QSTA 4TQNA 4QSSA 4LZRA 5FB0A 4ALGA 5EWCA 3U5JA 5D3JA 3UVDA 4BW2A 5HFRA 4GPJA 4NUCA 4XY8A 4J0RA 5E73A 5I7YA 4XUBA 4ZW1A 5EI4A 2RNYA 5EISA 5E3DA 4UIXA 5CQ7A 4NUDA 3O37A 4HXMA 5HQ5A 5I1QA 2RNWA 3ERRA 5A85A 5KTWA 4YADA 2R10A 4O78A 4MR3A 4A9EA 3Q2FA 4PTBA 5LVRA 5H1UA 4A9JA 5L99A 5FG5A 5DBMA 5D3TA 4CL9A 4YAXA 4WHUA 5EP7A 5CRMA 4Z1SA 5L8UA 4YATA 2OO1A 5E9MA 5ETBA 3UW9A 4TU4A 4XY9A 5IGMA 1X0JA 5ENEA 5EPSA 5HQ7A 1E6IA 4LZSA 5E3GA 4E96A 2D82A 5AMEA 5AD2A 1PUOA 4YBSA 5A5SA 4MEOA 4QYLA 3O36A 4Z93A 4CUQA 3RCWA 5A7CA 4C66A 2RI7A 4UYHA 4MR6A 4NYVA 4N4IA 4QNSA 4QYDA 3U5NA 4YYNA 4QSXA 5DFCA 4NQMA 5DX4A 5DYAA 5E9YA 5L96A 4MR5A 4Z1QA 2R0SA 5II2A 5IGNA 4IR5A 4N4FA 5H85A 4LR6A 4N4HA 5D3SA 5C89A 4QUUA 4TT6A 5E0RA 2R0YA 3MULA 5D3NA 5FE5A 5DW2A 5TCMA 5IBNA 4O70A 5F1HA 5HRVA 4UYFA 3IU6A 2E7NA 5FE4A 5LKTA 2E3KA 4HXOA 4J3IA 2DVRA 4IOQA 5EK9A 3D7CA 1ZKRA 5KHMA 5COIA 4CUPA 4HBYA 4TU6A 4CLBA 4O74A 3LQHA 5LKXA 4A9MA 4NR5A 4YH3A 2EJNA 3S91A 4HBWA 5ENBA 5IG6A 4LYIA 5G4SA 5BT5A 5A5PA 4TZ8A 2WP1A 2DVSA 4UIYA 3MUKA 2GRCA 5CUGA 3S92A 3SVFA 4A9IA 4QB3A 4IR4A 4A9LA 5DYUA 2WP2A 4TS8A 3AADA 1EQFA 1F68A 1ZS5A 4BW3A 3U5LA 3MXFA 5DY7A 4YYHA 2N9GA 5F1LA 5ACYA 3IU5A 4LZ2A 2L85A 5A83A 5I89A 4OGJA 5E74A 4ZC9A 4XUAA 4PCEA 3SVGA 5FB1A 5I80A 4RVRA 4O75A 5LJ0A 4IR3A 4O7EA 5ENCA 2DVVA 5E9KA 4OGIA 2YQDA 5HEMA 2E7OA 5HRWA 5DFBA 5HRXA 5FH6A 3UVWA 5F3AA 2RS9B 5D26A 5EWVA 4O7CA 4QR4A 5FBXA 4Q0NA 5CQ5A 4TYLA 4NXJA 5JWMA 5E9VA 1JSPB 4NR6A
chains in the Genus database with same CATH topology
2EJNA 3ERRA 1PUOA 1ZKRA 4AKIA 3D1DA 4AI6A 3VKGA 4AKHA 3D1BA 4AKGA 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1B A;  3D1D A; 
#chains in the Genus database with same CATH topology
 5CUB A;  4YYI A;  2L5E A;  4NR9 A;  5IID A;  4AKI A;  3UV2 A;  4YYK A;  5A5R A;  4N3W A;  5CQ8 A;  5CGP A;  4KCX A;  4HXS A;  3LXJ A;  3JVK A;  5HEN A;  4NYX A;  5CU8 A;  5CZG A;  3UVX A;  5D24 A;  4QSW A;  5FDZ A;  5LUU A;  5E9I A;  2LSP B;  3P1D A;  4HXL A;  3TLP A;  3G0J A;  4BW1 A;  5C7N A;  4KV4 A;  4BW4 A;  4PCI A;  2RO1 A;  5L97 A;  4NR4 A;  3FKM X;  5HCL A;  5F61 A;  5I86 A;  5AMF A;  4QZS A;  5D3P A;  3HMF A;  2YW5 A;  4N4G A;  4UIW A;  4QBM A;  5EWW A;  4A9K A;  4YY4 A;  4QR5 A;  4LYS A;  4QC1 A;  1N72 A;  3U5K A;  4LDF A;  4YBM A;  4O7B A;  5LJ2 A;  2DWW A;  4MR4 A;  5ENG A;  5KU3 A;  5CRZ A;  5G4R A;  4NR8 A;  4TZ2 A;  4UYD A;  4YYJ A;  5K29 A;  3U5P A;  3MQM A;  2YEM A;  5D25 A;  5EA1 A;  1JM4 B;  3I3J A;  4UYE A;  4WHW A;  5AD3 A;  5A5Q A;  5DW1 A;  4QSP A;  5A81 A;  2I7K A;  5ENF A;  4HXK A;  5FE1 A;  5FE3 A;  5KO4 A;  4TT4 A;  5HEL A;  4LRG A;  3VKH A;  4O72 A;  4NQN A;  3MB4 A;  4Z6I A;  4HBV A;  4O71 A;  4HXN A;  3NXB A;  4UIU A;  5C85 A;  4YYG A;  5FE2 A;  5ENI A;  3GG3 A;  5FH8 A;  5HLS A;  2YYN A;  4QEU A;  1WUM A;  5DYC A;  4MEN A;  5FH7 A;  4QC3 A;  4AI6 A;  5F2P A;  5EV9 A;  3UV4 A;  3LJW A;  5F25 A;  3JVL A;  3AQA A;  3P1E A;  5DKC A;  2FSA A;  2YEL A;  4O7A A;  4O76 A;  4Y03 A;  4HXR A;  5I40 A;  5CUE A;  3JVM A;  5I7X A;  3MB3 A;  5CQ6 A;  5CQ3 A;  2MJV B;  5EVA A;  5L8T A;  5CS8 A;  4F3I A;  5LKZ A;  2DAT A;  4KV1 A;  5ETD A;  3QZV A;  5CTL A;  5I88 A;  4YYD A;  2F6J A;  4QR3 A;  4UIZ A;  4PS5 A;  4YAB A;  4NS5 A;  4AKH A;  2G4A A;  5A5N A;  5LJ1 A;  4HXP A;  2YDW A;  5LVQ A;  4O77 A;  5EGU A;  5CPE A;  5H1T A;  2R0V A;  4OUF A;  3P5O A;  5CQ4 A;  4UYF B;  5DLZ A;  4UIV A;  4UYG A;  5ENH A;  5EWD A;  5DKD A;  5EWH A;  5DLX A;  5HFQ A;  2RNX A;  5KTX A;  4NRC A;  5FE8 A;  3P1F A;  5EIC A;  1WUG A;  5J0D A;  3D1B A;  5C87 A;  4CUS A;  3QZS A;  4BHW A;  4AKN A;  4IOO A;  5D3H A;  5CUC A;  5EPR A;  4TT2 A;  5E7D A;  5KTU A;  5ENJ A;  3HMH A;  3DWY A;  4CUU A;  5F36 A;  3DAI A;  5F63 A;  4LC2 A;  4QUT A;  5CFW A;  5D7X A;  5BT3 A;  3LQJ A;  4NRB A;  5C8G A;  4A9F A;  4QSQ A;  5CY9 A;  5F5Z A;  5CQT A;  4O7F A;  2KTB B;  3HME A;  5A82 A;  4ALH A;  4CFK A;  4WIV A;  4C67 A;  4QEV A;  4MEP A;  4YC9 A;  4NUE A;  5HM0 A;  5FE9 A;  5FE7 A;  2I8N A;  3O35 A;  4J1P A;  5I29 A;  3JVJ A;  4PY6 A;  3O33 A;  4UIT A;  5FG6 A;  4QEW A;  2YEK A;  2D9E A;  5CQA A;  3P1C A;  5II1 A;  4QSR A;  5TB6 A;  2RFJ A;  4YBT A;  5FFV A;  4QSV A;  5HJC A;  5FFY A;  4YK0 A;  5IGL A;  2F6N A;  2DVQ A;  3G0L A;  2NXB A;  4XYA A;  4TTE A;  3K2J A;  3ZYU A;  5CUD A;  3ONI A;  5D3R A;  5LKU A;  5DYX A;  4A9N A;  5EQ1 A;  3LQI A;  5BT4 A;  5F60 A;  3U5O A;  5CP5 A;  3SVH A;  2H60 A;  5FE0 A;  4IR6 A;  2OUO A;  4NYW A;  5FE6 A;  4CUR A;  4DON A;  5FFW A;  4CUT A;  5D3L A;  5D0C A;  5IGK A;  3VKG A;  5H1V A;  2DKW A;  4ZQL A;  2L84 A;  5EU1 A;  3O34 A;  3Q2E A;  5DFD A;  5EM3 A;  5A5O A;  2OSS A;  5HQ6 A;  4A9H A;  4LYW A;  4AKG A;  5L98 A;  4BJX A;  4FLP A;  4CFL A;  4QSU A;  4Z6H A;  3U5M A;  4PKL A;  5CUA A;  5C4Q A;  4YH4 A;  3QZT A;  4YYM A;  5I83 A;  3UV5 A;  5DKH A;  3D1D A;  4X2I A;  3UVY A;  4MEQ A;  4J0S A;  4Q0O A;  4NRA A;  4YY6 A;  5FG4 A;  5E9L A;  5F62 A;  5JI8 A;  4NR7 A;  4A9O A;  5EPB A;  4IOR A;  4HBX A;  4QY4 A;  4QST A;  4TQN A;  4QSS A;  4LZR A;  5FB0 A;  4ALG A;  5EWC A;  3U5J A;  5D3J A;  3UVD A;  4BW2 A;  5HFR A;  4GPJ A;  4NUC A;  4XY8 A;  4J0R A;  5E73 A;  5I7Y A;  4XUB A;  4ZW1 A;  5EI4 A;  2RNY A;  5EIS A;  5E3D A;  4UIX A;  5CQ7 A;  4NUD A;  3O37 A;  4HXM A;  5HQ5 A;  5I1Q A;  2RNW A;  3ERR A;  5A85 A;  5KTW A;  4YAD A;  2R10 A;  4O78 A;  4MR3 A;  4A9E A;  3Q2F A;  4PTB A;  5LVR A;  5H1U A;  4A9J A;  5L99 A;  5FG5 A;  5DBM A;  5D3T A;  4CL9 A;  4YAX A;  4WHU A;  5EP7 A;  5CRM A;  4Z1S A;  5L8U A;  4YAT A;  2OO1 A;  5E9M A;  5ETB A;  3UW9 A;  4TU4 A;  4XY9 A;  5IGM A;  1X0J A;  5ENE A;  5EPS A;  5HQ7 A;  1E6I A;  4LZS A;  5E3G A;  4E96 A;  2D82 A;  5AME A;  5AD2 A;  1PUO A;  4YBS A;  5A5S A;  4MEO A;  4QYL A;  3O36 A;  4Z93 A;  4CUQ A;  3RCW A;  5A7C A;  4C66 A;  2RI7 A;  4UYH A;  4MR6 A;  4NYV A;  4N4I A;  4QNS A;  4QYD A;  3U5N A;  4YYN A;  4QSX A;  5DFC A;  4NQM A;  5DX4 A;  5DYA A;  5E9Y A;  5L96 A;  4MR5 A;  4Z1Q A;  2R0S A;  5II2 A;  5IGN A;  4IR5 A;  4N4F A;  5H85 A;  4LR6 A;  4N4H A;  5D3S A;  5C89 A;  4QUU A;  4TT6 A;  5E0R A;  2R0Y A;  3MUL A;  5D3N A;  5FE5 A;  5DW2 A;  5TCM A;  5IBN A;  4O70 A;  5F1H A;  5HRV A;  4UYF A;  3IU6 A;  2E7N A;  5FE4 A;  5LKT A;  2E3K A;  4HXO A;  4J3I A;  2DVR A;  4IOQ A;  5EK9 A;  3D7C A;  1ZKR A;  5KHM A;  5COI A;  4CUP A;  4HBY A;  4TU6 A;  4CLB A;  4O74 A;  3LQH A;  5LKX A;  4A9M A;  4NR5 A;  4YH3 A;  2EJN A;  3S91 A;  4HBW A;  5ENB A;  5IG6 A;  4LYI A;  5G4S A;  5BT5 A;  5A5P A;  4TZ8 A;  2WP1 A;  2DVS A;  4UIY A;  3MUK A;  2GRC A;  5CUG A;  3S92 A;  3SVF A;  4A9I A;  4QB3 A;  4IR4 A;  4A9L A;  5DYU A;  2WP2 A;  4TS8 A;  3AAD A;  1EQF A;  1F68 A;  1ZS5 A;  4BW3 A;  3U5L A;  3MXF A;  5DY7 A;  4YYH A;  2N9G A;  5F1L A;  5ACY A;  3IU5 A;  4LZ2 A;  2L85 A;  5A83 A;  5I89 A;  4OGJ A;  5E74 A;  4ZC9 A;  4XUA A;  4PCE A;  3SVG A;  5FB1 A;  5I80 A;  4RVR A;  4O75 A;  5LJ0 A;  4IR3 A;  4O7E A;  5ENC A;  2DVV A;  5E9K A;  4OGI A;  2YQD A;  5HEM A;  2E7O A;  5HRW A;  5DFB A;  5HRX A;  5FH6 A;  3UVW A;  5F3A A;  2RS9 B;  5D26 A;  5EWV A;  4O7C A;  4QR4 A;  5FBX A;  4Q0N A;  5CQ5 A;  4TYL A;  4NXJ A;  5JWM A;  5E9V A;  1JSP B;  4NR6 A; 
#chains in the Genus database with same CATH homology
 2EJN A;  3ERR A;  1PUO A;  1ZKR A;  4AKI A;  3D1D A;  4AI6 A;  3VKG A;  4AKH A;  3D1B A;  4AKG A;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...