3D1DA

Hexagonal crystal structure of tas3 c-terminal alpha motif
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
109
structure length
109
Chain Sequence
NDLYINWLKSLSFFQTNSSCAEALVKVIPHYHNKLIDFSQVLQLVFSASEKFPIQENQPLPEQLMFLSNLEKQTPFAKAVGSSIYKLVTGKNLSLDFASQILKEASILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-induced transcriptional silencing complex protein tas3
publication title An alpha motif at Tas3 C terminus mediates RITS cis spreading and promotes heterochromatic gene silencing.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
total genus 45
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.40 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 3d1dA00
3D1BA 3D1DA
chains in the Genus database with same CATH superfamily
5LJ2A 4NXJA 3UV4A 4NQMA 4YYJA 5EISA 4LRGA 5F1LA 4J0RA 4HXNA 4QEUA 5D3LA 4ZC9A 5L97A 4MEOA 2EJNA 5FE1A 5CPEA 4YATA 5ENIA 4IORA 5CUEA 1ZS5A 4HXSA 5IGMA 4QR4A 3K2JA 4TZ8A 4UIZA 3U5LA 4YYIA 4IR6A 5EWDA 3MULA 5CQ4A 4UIVA 4NR6A 4YC9A 5HLSA 4O74A 5EQ1A 3SVGA 5E9IA 5A81A 4C67A 2RO1A 4WIVA 4PKLA 4O75A 3JVMA 3AADA 2DVQA 5TB6A 4A9JA 4YBMA 5DFCA 3UW9A 5H1VA 5FBXA 5H1UA 5JI8A 2DVSA 4AKHA 3AQAA 4YYHA 3U5NA 2RFJA 4QEWA 4LYSA 4NUCA 5D3JA 4QSTA 4UYDA 5DFBA 5EGUA 2OSSA 4CFLA 4O72A 5L8UA 5FG5A 5CZGA 5DYAA 5CUCA 4KCXA 5EPRA 4XUBA 5FFWA 5TCMA 5FDZA 5DX4A 4A9KA 5DYUA 4QNSA 4YAXA 5CQ7A 4O71A 4PCIA 4UYGA 4CUTA 5ENEA 5CFWA 5J0DA 4LZ2A 5C89A 5I86A 4BW4A 4O7BA 4YYGA 3I3JA 4Z93A 5E7DA 5A5QA 1WUGA 5CRZA 4ALGA 5AD2A 4QSPA 5A85A 4TS8A 5BT3A 5II1A 5EPSA 5KHMA 3P1EA 4QBMA 2DKWA 3P5OA 4XUAA 5F3AA 4BW1A 4O7EA 3D7CA 5FG6A 3MUKA 5FH6A 4NR7A 3JVKA 5COIA 4CUPA 4N4HA 4NR9A 4N4IA 3MB3A 5EVAA 4CUUA 5HFRA 3U5MA 5G4SA 2YW5A 4FLPA 4O70A 4Q0NA 5D3HA 3G0JA 5AMEA 3LQHA 4MR3A 4GPJA 5EI4A 5C4QA 5CRMA 4TU6A 5D3NA 5I40A 5D3TA 5CS8A 4HXLA 3Q2EA 5EWHA 3S92A 2R0YA 3U5OA 4QY4A 5F62A 5HQ7A 4QZSA 5I7YA 5LUUA 4DONA 4CLBA 5I29A 5F60A 4TYLA 1F68A 4WHWA 4QSVA 4X2IA 5ENFA 5EPBA 4UIXA 5D26A 4RVRA 5E9YA 3P1CA 2D82A 3ERRA 2YYNA 5A5NA 5LJ1A 5LJ0A 5D7XA 2NXBA 3GG3A 5CQ6A 5EM3A 4YYMA 3VKGA 2RNXA 4O7CA 3LQIA 4QSXA 5L96A 2I7KA 4NUDA 3P1FA 5FE0A 4QUUA 4UIWA 5A7CA 4Z1QA 5CQ5A 5A5SA 5F63A 4LC2A 3LXJA 4NYVA 4UYEA 5I80A 4TT2A 5CGPA 5EK9A 5C85A 5FH8A 3MQMA 4YH3A 5DY7A 1JM4B 4IOQA 4KV4A 4NRCA 2DATA 3UVXA 5D25A 2H60A 5FG4A 5DBMA 2YEKA 5FE6A 3HMHA 4QSQA 5CU8A 5HFQA 5E3DA 4OGJA 5FH7A 4QB3A 4NQNA 5HQ6A 5DW2A 3QZTA 4NYWA 4XY8A 4YADA 2L84A 4QC1A 2F6NA 3QZSA 4MR4A 4IR5A 3O34A 1WUMA 4KV1A 5DKHA 5FFVA 4TZ2A 2N9GA 5EWWA 3Q2FA 5E9VA 5HM0A 4HBXA 5CUDA 4F3IA 3HMEA 3IU6A 3ZYUA 4LR6A 4WHUA 5BT4A 5EICA 3HMFA 4CFKA 4NR4A 5HEMA 4C66A 1ZKRA 4NS5A 3O36A 5FE3A 5HCLA 5ETDA 5DFDA 4ALHA 4Z1SA 5F36A 2F6JA 3D1BA 4N3WA 2RS9B 4A9OA 3U5JA 5E9LA 5E74A 4O78A 3MXFA 4QEVA 5A5OA 4CUQA 4MR5A 5FE7A 2E7OA 5DLXA 2WP1A 4PY6A 4O76A 4QYLA 5JWMA 5L98A 5F1HA 5I89A 5L8TA 3D1DA 5I83A 5H85A 4A9HA 3S91A 5A82A 4A9MA 5HQ5A 5A5PA 5HRWA 5ENGA 4PCEA 5F5ZA 5IGNA 3VKHA 4O7AA 1X0JA 4HBYA 2MJVB 5C8GA 5FE9A 3NXBA 4BHWA 5L99A 4UYFA 4BW2A 5A5RA 3U5PA 4A9LA 2G4AA 5I1QA 5I88A 5D3SA 4AKIA 3FKMX 4QYDA 4MEPA 2R0VA 4UIYA 4E96A 4CUSA 3G0LA 3UV2A 4HXMA 4MR6A 4QSWA 4A9NA 5G4RA 3TLPA 4NRAA 5E3GA 5EV9A 5FB0A 5AMFA 4CURA 5HRXA 4YBSA 4QSRA 3UVWA 5KTUA 4XY9A 5EWCA 4XYAA 2E7NA 5CQ8A 5DLZA 5EU1A 2D9EA 4HBVA 3SVHA 4NRBA 4AKGA 4HXKA 2R0SA 4Y03A 5F2PA 5IBNA 3JVJA 2YQDA 5CTLA 3DWYA 2YELA 5CP5A 4TU4A 5CUGA 3LQJA 3O37A 4LZSA 4UIUA 4YBTA 2KTBB 4LYIA 5ETBA 3SVFA 4IOOA 5LKZA 4YY4A 5FE8A 4TTEA 2OO1A 4UYFB 5D3RA 2WP2A 2OUOA 3UVDA 4A9EA 5ACYA 5C7NA 5ENBA 3O33A 5DKCA 5CQ3A 4MEQA 3QZVA 5A83A 3LJWA 5DYXA 5CY9A 5D0CA 4YY6A 4YYDA 5IGLA 2LSPB 4Z6HA 2DWWA 4TQNA 4Z6IA 4LZRA 5HELA 5LKXA 5LKUA 5FE4A 4UYHA 4N4FA 4OUFA 4YH4A 2YDWA 5DYCA 4AKNA 5CQTA 4TT6A 4YYKA 2R10A 1EQFA 3IU5A 5CQAA 4BW3A 4HXPA 5LVRA 4QSSA 5E9KA 5K29A 5LKTA 2L85A 2FSAA 4YK0A 5F25A 2RNYA 4NUEA 3UVYA 5HRVA 5IG6A 5EP7A 1E6IA 4QR5A 4QR3A 4ZQLA 4ZW1A 5BT5A 4PTBA 4PS5A 5H1TA 4IR3A 4YABA 5HENA 4J0SA 3UV5A 2RNWA 3RCWA 2RI7A 5DKDA 5ENCA 4HXOA 4NR5A 5HJCA 5ENJA 5D24A 5IGKA 4O77A 2DVRA 4OGIA 5II2A 4MENA 4NR8A 5E0RA 5CUBA 5FE5A 4HBWA 5E9MA 4NYXA 4LYWA 3P1DA 4AI6A 5EA1A 5C87A 5DW1A 5AD3A 1N72A 5EWVA 4QC3A 5CUAA 5FFYA 1JSPB 5KU3A 4LDFA 4QUTA 5D3PA 5LVQA 4CL9A 2I8NA 3O35A 3ONIA 3DAIA 2GRCA 2YEMA 5ENHA 5I7XA 4O7FA 2DVVA 1PUOA 4Q0OA 4QSUA 4A9FA 5FE2A 4HXRA 2E3KA 5F61A 3MB4A 5KO4A 4TT4A 4BJXA 4YYNA 4IR4A 4A9IA 4UITA 2L5EA 4N4GA 4J1PA 5IIDA 5KTWA 3JVLA 5E73A 5KTXA 3U5KA 5FB1A 4J3IA
chains in the Genus database with same CATH topology
3VKGA 2EJNA 1ZKRA 3D1DA 4AKGA 3VKHA 1PUOA 3D1BA 4AKHA 4AKIA 4AI6A 3ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1B A;  3D1D A; 
#chains in the Genus database with same CATH topology
 5LJ2 A;  4NXJ A;  3UV4 A;  4NQM A;  4YYJ A;  5EIS A;  4LRG A;  5F1L A;  4J0R A;  4HXN A;  4QEU A;  5D3L A;  4ZC9 A;  5L97 A;  4MEO A;  2EJN A;  5FE1 A;  5CPE A;  4YAT A;  5ENI A;  4IOR A;  5CUE A;  1ZS5 A;  4HXS A;  5IGM A;  4QR4 A;  3K2J A;  4TZ8 A;  4UIZ A;  3U5L A;  4YYI A;  4IR6 A;  5EWD A;  3MUL A;  5CQ4 A;  4UIV A;  4NR6 A;  4YC9 A;  5HLS A;  4O74 A;  5EQ1 A;  3SVG A;  5E9I A;  5A81 A;  4C67 A;  2RO1 A;  4WIV A;  4PKL A;  4O75 A;  3JVM A;  3AAD A;  2DVQ A;  5TB6 A;  4A9J A;  4YBM A;  5DFC A;  3UW9 A;  5H1V A;  5FBX A;  5H1U A;  5JI8 A;  2DVS A;  4AKH A;  3AQA A;  4YYH A;  3U5N A;  2RFJ A;  4QEW A;  4LYS A;  4NUC A;  5D3J A;  4QST A;  4UYD A;  5DFB A;  5EGU A;  2OSS A;  4CFL A;  4O72 A;  5L8U A;  5FG5 A;  5CZG A;  5DYA A;  5CUC A;  4KCX A;  5EPR A;  4XUB A;  5FFW A;  5TCM A;  5FDZ A;  5DX4 A;  4A9K A;  5DYU A;  4QNS A;  4YAX A;  5CQ7 A;  4O71 A;  4PCI A;  4UYG A;  4CUT A;  5ENE A;  5CFW A;  5J0D A;  4LZ2 A;  5C89 A;  5I86 A;  4BW4 A;  4O7B A;  4YYG A;  3I3J A;  4Z93 A;  5E7D A;  5A5Q A;  1WUG A;  5CRZ A;  4ALG A;  5AD2 A;  4QSP A;  5A85 A;  4TS8 A;  5BT3 A;  5II1 A;  5EPS A;  5KHM A;  3P1E A;  4QBM A;  2DKW A;  3P5O A;  4XUA A;  5F3A A;  4BW1 A;  4O7E A;  3D7C A;  5FG6 A;  3MUK A;  5FH6 A;  4NR7 A;  3JVK A;  5COI A;  4CUP A;  4N4H A;  4NR9 A;  4N4I A;  3MB3 A;  5EVA A;  4CUU A;  5HFR A;  3U5M A;  5G4S A;  2YW5 A;  4FLP A;  4O70 A;  4Q0N A;  5D3H A;  3G0J A;  5AME A;  3LQH A;  4MR3 A;  4GPJ A;  5EI4 A;  5C4Q A;  5CRM A;  4TU6 A;  5D3N A;  5I40 A;  5D3T A;  5CS8 A;  4HXL A;  3Q2E A;  5EWH A;  3S92 A;  2R0Y A;  3U5O A;  4QY4 A;  5F62 A;  5HQ7 A;  4QZS A;  5I7Y A;  5LUU A;  4DON A;  4CLB A;  5I29 A;  5F60 A;  4TYL A;  1F68 A;  4WHW A;  4QSV A;  4X2I A;  5ENF A;  5EPB A;  4UIX A;  5D26 A;  4RVR A;  5E9Y A;  3P1C A;  2D82 A;  3ERR A;  2YYN A;  5A5N A;  5LJ1 A;  5LJ0 A;  5D7X A;  2NXB A;  3GG3 A;  5CQ6 A;  5EM3 A;  4YYM A;  3VKG A;  2RNX A;  4O7C A;  3LQI A;  4QSX A;  5L96 A;  2I7K A;  4NUD A;  3P1F A;  5FE0 A;  4QUU A;  4UIW A;  5A7C A;  4Z1Q A;  5CQ5 A;  5A5S A;  5F63 A;  4LC2 A;  3LXJ A;  4NYV A;  4UYE A;  5I80 A;  4TT2 A;  5CGP A;  5EK9 A;  5C85 A;  5FH8 A;  3MQM A;  4YH3 A;  5DY7 A;  1JM4 B;  4IOQ A;  4KV4 A;  4NRC A;  2DAT A;  3UVX A;  5D25 A;  2H60 A;  5FG4 A;  5DBM A;  2YEK A;  5FE6 A;  3HMH A;  4QSQ A;  5CU8 A;  5HFQ A;  5E3D A;  4OGJ A;  5FH7 A;  4QB3 A;  4NQN A;  5HQ6 A;  5DW2 A;  3QZT A;  4NYW A;  4XY8 A;  4YAD A;  2L84 A;  4QC1 A;  2F6N A;  3QZS A;  4MR4 A;  4IR5 A;  3O34 A;  1WUM A;  4KV1 A;  5DKH A;  5FFV A;  4TZ2 A;  2N9G A;  5EWW A;  3Q2F A;  5E9V A;  5HM0 A;  4HBX A;  5CUD A;  4F3I A;  3HME A;  3IU6 A;  3ZYU A;  4LR6 A;  4WHU A;  5BT4 A;  5EIC A;  3HMF A;  4CFK A;  4NR4 A;  5HEM A;  4C66 A;  1ZKR A;  4NS5 A;  3O36 A;  5FE3 A;  5HCL A;  5ETD A;  5DFD A;  4ALH A;  4Z1S A;  5F36 A;  2F6J A;  3D1B A;  4N3W A;  2RS9 B;  4A9O A;  3U5J A;  5E9L A;  5E74 A;  4O78 A;  3MXF A;  4QEV A;  5A5O A;  4CUQ A;  4MR5 A;  5FE7 A;  2E7O A;  5DLX A;  2WP1 A;  4PY6 A;  4O76 A;  4QYL A;  5JWM A;  5L98 A;  5F1H A;  5I89 A;  5L8T A;  3D1D A;  5I83 A;  5H85 A;  4A9H A;  3S91 A;  5A82 A;  4A9M A;  5HQ5 A;  5A5P A;  5HRW A;  5ENG A;  4PCE A;  5F5Z A;  5IGN A;  3VKH A;  4O7A A;  1X0J A;  4HBY A;  2MJV B;  5C8G A;  5FE9 A;  3NXB A;  4BHW A;  5L99 A;  4UYF A;  4BW2 A;  5A5R A;  3U5P A;  4A9L A;  2G4A A;  5I1Q A;  5I88 A;  5D3S A;  4AKI A;  3FKM X;  4QYD A;  4MEP A;  2R0V A;  4UIY A;  4E96 A;  4CUS A;  3G0L A;  3UV2 A;  4HXM A;  4MR6 A;  4QSW A;  4A9N A;  5G4R A;  3TLP A;  4NRA A;  5E3G A;  5EV9 A;  5FB0 A;  5AMF A;  4CUR A;  5HRX A;  4YBS A;  4QSR A;  3UVW A;  5KTU A;  4XY9 A;  5EWC A;  4XYA A;  2E7N A;  5CQ8 A;  5DLZ A;  5EU1 A;  2D9E A;  4HBV A;  3SVH A;  4NRB A;  4AKG A;  4HXK A;  2R0S A;  4Y03 A;  5F2P A;  5IBN A;  3JVJ A;  2YQD A;  5CTL A;  3DWY A;  2YEL A;  5CP5 A;  4TU4 A;  5CUG A;  3LQJ A;  3O37 A;  4LZS A;  4UIU A;  4YBT A;  2KTB B;  4LYI A;  5ETB A;  3SVF A;  4IOO A;  5LKZ A;  4YY4 A;  5FE8 A;  4TTE A;  2OO1 A;  4UYF B;  5D3R A;  2WP2 A;  2OUO A;  3UVD A;  4A9E A;  5ACY A;  5C7N A;  5ENB A;  3O33 A;  5DKC A;  5CQ3 A;  4MEQ A;  3QZV A;  5A83 A;  3LJW A;  5DYX A;  5CY9 A;  5D0C A;  4YY6 A;  4YYD A;  5IGL A;  2LSP B;  4Z6H A;  2DWW A;  4TQN A;  4Z6I A;  4LZR A;  5HEL A;  5LKX A;  5LKU A;  5FE4 A;  4UYH A;  4N4F A;  4OUF A;  4YH4 A;  2YDW A;  5DYC A;  4AKN A;  5CQT A;  4TT6 A;  4YYK A;  2R10 A;  1EQF A;  3IU5 A;  5CQA A;  4BW3 A;  4HXP A;  5LVR A;  4QSS A;  5E9K A;  5K29 A;  5LKT A;  2L85 A;  2FSA A;  4YK0 A;  5F25 A;  2RNY A;  4NUE A;  3UVY A;  5HRV A;  5IG6 A;  5EP7 A;  1E6I A;  4QR5 A;  4QR3 A;  4ZQL A;  4ZW1 A;  5BT5 A;  4PTB A;  4PS5 A;  5H1T A;  4IR3 A;  4YAB A;  5HEN A;  4J0S A;  3UV5 A;  2RNW A;  3RCW A;  2RI7 A;  5DKD A;  5ENC A;  4HXO A;  4NR5 A;  5HJC A;  5ENJ A;  5D24 A;  5IGK A;  4O77 A;  2DVR A;  4OGI A;  5II2 A;  4MEN A;  4NR8 A;  5E0R A;  5CUB A;  5FE5 A;  4HBW A;  5E9M A;  4NYX A;  4LYW A;  3P1D A;  4AI6 A;  5EA1 A;  5C87 A;  5DW1 A;  5AD3 A;  1N72 A;  5EWV A;  4QC3 A;  5CUA A;  5FFY A;  1JSP B;  5KU3 A;  4LDF A;  4QUT A;  5D3P A;  5LVQ A;  4CL9 A;  2I8N A;  3O35 A;  3ONI A;  3DAI A;  2GRC A;  2YEM A;  5ENH A;  5I7X A;  4O7F A;  2DVV A;  1PUO A;  4Q0O A;  4QSU A;  4A9F A;  5FE2 A;  4HXR A;  2E3K A;  5F61 A;  3MB4 A;  5KO4 A;  4TT4 A;  4BJX A;  4YYN A;  4IR4 A;  4A9I A;  4UIT A;  2L5E A;  4N4G A;  4J1P A;  5IID A;  5KTW A;  3JVL A;  5E73 A;  5KTX A;  3U5K A;  5FB1 A;  4J3I A; 
#chains in the Genus database with same CATH homology
 3VKG A;  2EJN A;  1ZKR A;  3D1D A;  4AKG A;  3VKH A;  1PUO A;  3D1B A;  4AKH A;  4AKI A;  4AI6 A;  3ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...