5CPEA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
HLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 4
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cpeA01
5D0CA 4UIUA 4Z6IA 4YC9A 2FSAA 3LQHA 3QZTA 5CS8A 5IBNA 5C89A 5KO4A 4TU6A 4J0SA 2F6JA 2L85A 4QBMA 5CQTA 5I7YA 3SVHA 5CUAA 2F6NA 4CFKA 5DKCA 4NYWA 5HEMA 4YYHA 4WHWA 4OUFA 4UIXA 4QR4A 5CP5A 4QZSA 5CFWA 2YQDA 3MXFA 5KU3A 4HXPA 5DFDA 5EPBA 5H85A 4N3WA 4TQNA 2R0YA 4O7CA 4O7BA 5EI4A 1N72A 4OGIA 4CUQA 5DKHA 4E96A 5F62A 4UYFA 5I40A 5HM0A 4TT2A 5EPRA 5EVAA 4ZQLA 4YAXA 4MR3A 5FH8A 5E9YA 4YH3A 5DFBA 5IG6A 5DYUA 4J3IA 5K29A 4TU4A 5F60A 4TT4A 4A9FA 5F63A 5JWMA 5CGPA 5C85A 5LJ2A 3U5LA 5G4SA 3MB3A 5LVQA 4C67A 5I7XA 4NUEA 5CQ7A 3D7CA 1EQFA 4N4GA 5CPEA 5II2A 4IR5A 4Q0NA 4YBMA 4AKNA 5FE2A 5E7DA 4HXOA 4LZ2A 4NR5A 4F3IA 4NQMA 5L97A 5DFCA 5EQ1A 4BW4A 4QSQA 4Z1QA 5CUEA 4HXMA 2YW5A 4MENA 5CQ5A 4QC1A 1JM4B 1WUGA 4ZW1A 3K2JA 5LVRA 5C8GA 5E74A 5E9LA 5HENA 3HMHA 3P1CA 5ACYA 4QYLA 4UYHA 3O35A 5EWVA 5C7NA 5HFRA 5I88A 4BHWA 3P1DA 5FDZA 2YEMA 2GRCA 4QSTA 5JI8A 3O34A 2MJVB 5I83A 5HCLA 5HRWA 4HXLA 5CQ4A 5E0RA 2D82A 4YY6A 5DX4A 4UIVA 1WUMA 5TB6A 4QR3A 5FE7A 4TYLA 4HXKA 4MR4A 4QSWA 5A5NA 4QC3A 4MEPA 3LQJA 4XYAA 4YATA 5DY7A 5L99A 2RNWA 4XUAA 4QSRA 5AMFA 3FKMX 4UYGA 3HMEA 5COIA 4LDFA 2R10A 4TZ8A 5IGKA 4QNSA 5H1VA 5I89A 2D9EA 2DKWA 4YADA 5FB0A 5FE1A 5F5ZA 4PTBA 5IGNA 3G0LA 4BW3A 4QSSA 4NRCA 2DVVA 4QY4A 5ENEA 3LQIA 5FH7A 4MEQA 4C66A 5FFYA 4YYNA 4NUCA 3LJWA 5EP7A 5EV9A 4QUTA 5AMEA 4YBTA 4J1PA 3JVJA 4HBYA 4LRGA 3TLPA 4O78A 3G0JA 4TTEA 2RI7A 5FE8A 5IIDA 5ENHA 5DW1A 3QZSA 5DLZA 4DONA 3Q2FA 4PKLA 1ZS5A 4QSUA 3DWYA 4CUPA 4X2IA 4O7AA 4Z1SA 5E9VA 5BT4A 5I1QA 5CTLA 5J0DA 2RNXA 5ETDA 5LUUA 5DYAA 2YDWA 3AQAA 4BW2A 5F61A 4QSPA 4NR7A 5FE0A 5FG6A 3UV5A 4QEWA 5FG4A 5BT3A 3IU5A 4KV4A 5CUBA 5DBMA 5EWWA 5DW2A 5D25A 4RVRA 4IR6A 1F68A 4A9JA 4IOQA 3S91A 4O7FA 1E6IA 2YELA 5HLSA 3P5OA 4QR5A 4NS5A 4HBVA 5KTUA 2RO1A 5CQ6A 4UIYA 4CLBA 4UIZA 4A9OA 3I3JA 2LSPB 5C87A 2NXBA 3DAIA 5FE3A 5LJ0A 2E7NA 2R0VA 5D26A 2WP2A 3MULA 4A9NA 2R0SA 3UVDA 5D3JA 3O33A 4XUBA 2I8NA 5LJ1A 5IGLA 5E73A 2DWWA 5CU8A 3AADA 5F25A 3U5JA 3QZVA 5HQ5A 5A5PA 4FLPA 2RS9B 5HJCA 5A7CA 2N9GA 3ZYUA 4UYEA 4CL9A 4CURA 5HQ6A 2WP1A 5F3AA 3LXJA 4ZC9A 4QSVA 5D3TA 3NXBA 5CRZA 3MUKA 5F36A 4PCIA 4YYJA 5TCMA 4N4HA 4TZ2A 2OO1A 4KCXA 5KTWA 4IR4A 5EU1A 4HXNA 3JVMA 4KV1A 5HRXA 5LKTA 4ALHA 2YEKA 4NRBA 5G4RA 3S92A 4TT6A 4O76A 5A81A 4CUTA 5HFQA 5HELA 3HMFA 3O36A 4HXRA 5I80A 4YK0A 3P1EA 4MR6A 5EWDA 4IOOA 4NR8A 5E9KA 5FFVA 5D3HA 4NR6A 4O74A 4XY8A 5ENGA 4NYXA 4NQNA 2RNYA 5EGUA 5HQ7A 3MQMA 5CQ8A 4YYKA 4NUDA 4A9MA 5CRMA 4O7EA 5FE6A 3SVGA 2RFJA 2G4AA 4UYFB 3UVXA 4YY4A 1X0JA 5FG5A 5A5RA 4Q0OA 5FBXA 2OUOA 5ETBA 3U5MA 4LYWA 3U5OA 3O37A 4NR4A 4TS8A 5FH6A 5L98A 4Z6HA 5CUGA 5ENJA 4Y03A 4UIWA 4HBWA 5A85A 5F2PA 5ENCA 5I29A 5DKDA 5I86A 5A5QA 4OGJA 5ENIA 3JVKA 2L84A 4IR3A 5FB1A 3GG3A 3ONIA 3UV4A 4YYDA 4QSXA 5A5OA 2I7KA 5DYXA 5ENBA 4CFLA 5LKZA 5A82A 5AD3A 1JSPB 2E7OA 5IGMA 5E9IA 5LKXA 4QEVA 5F1LA 2E3KA 3IU6A 4YABA 4LC2A 2DATA 2DVSA 5CUCA 5CUDA 4WHUA 4J0RA 2OSSA 5FE9A 4YYMA 5LKUA 4BW1A 4QUUA 5D3SA 3UVWA 3UV2A 3JVLA 5KHMA 4NYVA 5L96A 4QYDA 4A9HA 4LZSA 2KTBB 5AD2A 5KTXA 4GPJA 4NRAA 4NXJA 3U5PA 3UVYA 3U5NA 4XY9A 5EWCA 4LYIA 4YYIA 4HBXA 4NR9A 5EK9A 5D3LA 5D3PA 5CQ3A 4UITA 5EWHA 5FE5A 4A9LA 4QB3A 5II1A 5DYCA 4LZRA 5FE4A 5D3RA 4MR5A 5E3GA 4PCEA 4CUSA 4O71A 2DVQA 4LYSA 5A5SA 4MEOA 5HRVA 4O70A 5EPSA 4O75A 4O77A 4N4FA 4YBSA 2YYNA 4PY6A 5EICA 4O72A 5FFWA 3UW9A 5D3NA 5EISA 5E9MA 5H1TA 4UYDA 5BT5A 4N4IA 4ALGA 4HXSA 2DVRA 5EA1A 5CY9A 5L8UA 4PS5A 5D7XA 4A9EA 4A9IA 5E3DA 5F1HA 3MB4A 4LR6A 4BJXA 4IORA 5ENFA 5CQAA 4YH4A 5CZGA 3SVFA 2L5EA 5EM3A 5C4QA 4YYGA 5A83A 4A9KA 5D24A 4WIVA 4CUUA 3Q2EA 2H60A 4QEUA 3U5KA 5H1UA 3RCWA 3P1FA 5DLXA 5L8TA 4Z93A
chains in the Genus database with same CATH superfamily
5D0CA 4UIUA 4Z6IA 4YC9A 2FSAA 3LQHA 3QZTA 5CS8A 5IBNA 5C89A 5KO4A 4TU6A 4J0SA 2F6JA 2L85A 4QBMA 5CQTA 5I7YA 3SVHA 5CUAA 2F6NA 4CFKA 5DKCA 4NYWA 5HEMA 4YYHA 4WHWA 4OUFA 4UIXA 4QR4A 5CP5A 4QZSA 5CFWA 2YQDA 3MXFA 5KU3A 4HXPA 5DFDA 5EPBA 5H85A 4N3WA 4TQNA 2R0YA 4O7CA 4O7BA 5EI4A 1N72A 4OGIA 4CUQA 5DKHA 4E96A 5F62A 4UYFA 5I40A 5HM0A 4TT2A 5EPRA 5EVAA 4ZQLA 4YAXA 4MR3A 5FH8A 5E9YA 4YH3A 5DFBA 5IG6A 5DYUA 4J3IA 5K29A 4TU4A 5F60A 4TT4A 4A9FA 5F63A 5JWMA 5CGPA 5C85A 5LJ2A 3U5LA 5G4SA 3MB3A 5LVQA 4C67A 5I7XA 4AKGA 4NUEA 5CQ7A 3D7CA 3VKGA 1EQFA 3D1DA 4N4GA 5CPEA 5II2A 4AI6A 4IR5A 4Q0NA 4YBMA 4AKNA 3D1BA 5FE2A 5E7DA 4HXOA 4LZ2A 4NR5A 4F3IA 4NQMA 5L97A 5DFCA 5EQ1A 4BW4A 4QSQA 4Z1QA 5CUEA 4HXMA 2YW5A 2EJNA 4MENA 5CQ5A 4QC1A 1JM4B 1WUGA 4ZW1A 3K2JA 5LVRA 5C8GA 5E74A 5E9LA 5HENA 3HMHA 3P1CA 5ACYA 4QYLA 4UYHA 3O35A 5EWVA 5C7NA 4Z93A 5HFRA 5I88A 4BHWA 3P1DA 5FDZA 2YEMA 2GRCA 4QSTA 5JI8A 1PUOA 3O34A 2MJVB 5I83A 5HCLA 5HRWA 4HXLA 5CQ4A 5E0RA 2D82A 4YY6A 5DX4A 4UIVA 1WUMA 5TB6A 4QR3A 5FE7A 4TYLA 4HXKA 4MR4A 4QSWA 5A5NA 4QC3A 4MEPA 3LQJA 4XYAA 4YATA 5DY7A 5L99A 2RNWA 4XUAA 4QSRA 5AMFA 3FKMX 4UYGA 3HMEA 5COIA 4LDFA 2R10A 4TZ8A 5IGKA 4QNSA 5H1VA 5I89A 2D9EA 2DKWA 4YADA 5FB0A 5FE1A 5F5ZA 4PTBA 5IGNA 3G0LA 4BW3A 4QSSA 4NRCA 2DVVA 4QY4A 5ENEA 3LQIA 5FH7A 4MEQA 4C66A 5FFYA 4YYNA 4NUCA 3LJWA 5EP7A 5EV9A 4QUTA 5AMEA 4YBTA 4J1PA 3JVJA 4HBYA 4LRGA 3TLPA 4O78A 3G0JA 4TTEA 2RI7A 5FE8A 5IIDA 5ENHA 5DW1A 3QZSA 5DLZA 4DONA 3Q2FA 4PKLA 1ZS5A 4QSUA 3DWYA 4CUPA 4X2IA 4O7AA 4Z1SA 5E9VA 5BT4A 5I1QA 5CTLA 5J0DA 2RNXA 5ETDA 5LUUA 5DYAA 2YDWA 3AQAA 4BW2A 5F61A 4QSPA 4NR7A 5FE0A 5FG6A 3UV5A 4QEWA 5FG4A 5BT3A 3IU5A 4KV4A 5CUBA 5DBMA 5EWWA 5DW2A 5D25A 4RVRA 4IR6A 1F68A 4A9JA 4IOQA 3S91A 4O7FA 1E6IA 2YELA 5HLSA 3P5OA 4QR5A 4NS5A 4HBVA 5KTUA 2RO1A 5CQ6A 4UIYA 4CLBA 4UIZA 4A9OA 3I3JA 2LSPB 5C87A 2NXBA 3DAIA 5FE3A 5LJ0A 2E7NA 2R0VA 5D26A 2WP2A 3MULA 4A9NA 2R0SA 3UVDA 5D3JA 3O33A 4XUBA 2I8NA 5LJ1A 5IGLA 5E73A 2DWWA 5CU8A 3AADA 5F25A 3U5JA 3QZVA 5HQ5A 5A5PA 4FLPA 2RS9B 5HJCA 5A7CA 2N9GA 3ZYUA 4UYEA 4CL9A 4CURA 5HQ6A 2WP1A 5F3AA 3LXJA 4ZC9A 4QSVA 5D3TA 3NXBA 5CRZA 3MUKA 5F36A 4PCIA 4YYJA 5TCMA 4N4HA 4TZ2A 2OO1A 4KCXA 5KTWA 4IR4A 5EU1A 4HXNA 3JVMA 4KV1A 5HRXA 5LKTA 4ALHA 2YEKA 4NRBA 5G4RA 3S92A 4TT6A 3VKHA 4O76A 5A81A 4CUTA 5HFQA 5HELA 3HMFA 3O36A 4HXRA 5I80A 4YK0A 3P1EA 4MR6A 5EWDA 4IOOA 4NR8A 5E9KA 5FFVA 5D3HA 4NR6A 4O74A 4AKHA 4XY8A 5ENGA 4NYXA 4NQNA 2RNYA 5EGUA 5HQ7A 3MQMA 5CQ8A 4YYKA 4NUDA 4A9MA 5CRMA 4O7EA 5FE6A 3SVGA 2RFJA 2G4AA 4UYFB 3UVXA 4YY4A 1X0JA 5FG5A 5A5RA 4Q0OA 5FBXA 2OUOA 4AKIA 5ETBA 3U5MA 3U5OA 3O37A 4NR4A 4TS8A 5FH6A 5L98A 4Z6HA 5CUGA 5ENJA 4Y03A 4UIWA 4HBWA 5A85A 5F2PA 5ENCA 5I29A 5DKDA 5I86A 5A5QA 4OGJA 5ENIA 3JVKA 2L84A 4IR3A 5FB1A 3GG3A 3ONIA 3UV4A 4YYDA 4QSXA 5A5OA 2I7KA 5DYXA 5ENBA 4CFLA 5LKZA 5A82A 5AD3A 1JSPB 2E7OA 5IGMA 5E9IA 5LKXA 4QEVA 5F1LA 2E3KA 3IU6A 4YABA 4LC2A 2DATA 2DVSA 5CUCA 5CUDA 4WHUA 4J0RA 2OSSA 5FE9A 4YYMA 5LKUA 4BW1A 4QUUA 5D3SA 3ERRA 3UVWA 3UV2A 3JVLA 5KHMA 4NYVA 5L96A 4QYDA 4A9HA 4LZSA 2KTBB 5AD2A 5KTXA 4GPJA 4NRAA 4NXJA 3U5PA 3UVYA 3U5NA 4XY9A 5EWCA 4LYIA 4YYIA 4HBXA 4NR9A 5EK9A 5D3LA 5D3PA 5CQ3A 4UITA 5EWHA 5FE5A 4A9LA 4QB3A 5II1A 5DYCA 4LZRA 5FE4A 5D3RA 4MR5A 5E3GA 4PCEA 4CUSA 4O71A 2DVQA 4LYSA 5A5SA 4MEOA 5HRVA 4O70A 5EPSA 4O75A 4O77A 4N4FA 4YBSA 2YYNA 4PY6A 5EICA 4O72A 5FFWA 3UW9A 5D3NA 5EISA 5E9MA 5H1TA 4UYDA 5BT5A 4N4IA 4ALGA 4HXSA 2DVRA 5EA1A 5CY9A 5L8UA 4PS5A 5D7XA 4A9EA 4A9IA 5E3DA 5F1HA 3MB4A 4LR6A 4BJXA 4IORA 5ENFA 5CQAA 4YH4A 5CZGA 3SVFA 2L5EA 5EM3A 5C4QA 4YYGA 5A83A 4A9KA 5D24A 4WIVA 4CUUA 3Q2EA 2H60A 4QEUA 3U5KA 5H1UA 3RCWA 1ZKRA 3P1FA 5DLXA 5L8TA 4LYWA
chains in the Genus database with same CATH topology
5D0CA 4UIUA 4Z6IA 4YC9A 2FSAA 3LQHA 3QZTA 5CS8A 5IBNA 5C89A 5KO4A 4TU6A 4J0SA 2F6JA 2L85A 4QBMA 5CQTA 5I7YA 3SVHA 5CUAA 2F6NA 4CFKA 5DKCA 4NYWA 5HEMA 4YYHA 4WHWA 4OUFA 4UIXA 4QR4A 5CP5A 4QZSA 5CFWA 2YQDA 3MXFA 5KU3A 4HXPA 5DFDA 5EPBA 5H85A 4N3WA 4TQNA 2R0YA 4O7CA 4O7BA 5EI4A 1N72A 4OGIA 4CUQA 5DKHA 4E96A 5F62A 4UYFA 5I40A 5HM0A 4TT2A 5EPRA 5EVAA 4ZQLA 4YAXA 4MR3A 5FH8A 5E9YA 4YH3A 5DFBA 5IG6A 5DYUA 4J3IA 5K29A 4TU4A 5F60A 4TT4A 4A9FA 5F63A 5JWMA 5CGPA 5C85A 5LJ2A 3U5LA 5G4SA 3MB3A 5LVQA 4C67A 5I7XA 4NUEA 5CQ7A 3D7CA 1EQFA 4N4GA 5CPEA 5II2A 4IR5A 4Q0NA 4YBMA 4AKNA 5FE2A 5E7DA 4HXOA 4LZ2A 4NR5A 4F3IA 4NQMA 5L97A 5DFCA 5EQ1A 4BW4A 4QSQA 4Z1QA 5CUEA 4HXMA 2YW5A 4MENA 5CQ5A 4QC1A 1JM4B 1WUGA 4ZW1A 3K2JA 5LVRA 5C8GA 5E74A 5E9LA 5HENA 3HMHA 3P1CA 5ACYA 4QYLA 4UYHA 3O35A 5EWVA 5C7NA 5HFRA 5I88A 4BHWA 3P1DA 5FDZA 2YEMA 2GRCA 4QSTA 5JI8A 3O34A 2MJVB 5I83A 5HCLA 5HRWA 4HXLA 5CQ4A 5E0RA 2D82A 4YY6A 5DX4A 4UIVA 1WUMA 5TB6A 4QR3A 5FE7A 4TYLA 4HXKA 4MR4A 4QSWA 5A5NA 4QC3A 4MEPA 3LQJA 4XYAA 4YATA 5DY7A 5L99A 2RNWA 4XUAA 4QSRA 5AMFA 3FKMX 4UYGA 3HMEA 5COIA 4LDFA 2R10A 4TZ8A 5IGKA 4QNSA 5H1VA 5I89A 2D9EA 2DKWA 4YADA 5FB0A 5FE1A 5F5ZA 4PTBA 5IGNA 3G0LA 4BW3A 4QSSA 4NRCA 2DVVA 4QY4A 5ENEA 3LQIA 5FH7A 4MEQA 4C66A 5FFYA 4YYNA 4NUCA 3LJWA 5EP7A 5EV9A 4QUTA 5AMEA 4YBTA 4J1PA 3JVJA 4HBYA 4LRGA 3TLPA 4O78A 3G0JA 4TTEA 2RI7A 5FE8A 5IIDA 5ENHA 5DW1A 3QZSA 5DLZA 4DONA 3Q2FA 4PKLA 1ZS5A 4QSUA 3DWYA 4CUPA 4X2IA 4O7AA 4Z1SA 5E9VA 5BT4A 5I1QA 5CTLA 5J0DA 2RNXA 5ETDA 5LUUA 5DYAA 2YDWA 3AQAA 4BW2A 5F61A 4QSPA 4NR7A 5FE0A 5FG6A 3UV5A 4QEWA 5FG4A 5BT3A 3IU5A 4KV4A 5CUBA 5DBMA 5EWWA 5DW2A 5D25A 4RVRA 4IR6A 1F68A 4A9JA 4IOQA 3S91A 4O7FA 1E6IA 2YELA 5HLSA 3P5OA 4QR5A 4NS5A 4HBVA 5KTUA 2RO1A 5CQ6A 4UIYA 4CLBA 4UIZA 4A9OA 3I3JA 2LSPB 5C87A 2NXBA 3DAIA 5FE3A 5LJ0A 2E7NA 2R0VA 5D26A 2WP2A 3MULA 4A9NA 2R0SA 3UVDA 5D3JA 3O33A 4XUBA 2I8NA 5LJ1A 5IGLA 5E73A 2DWWA 5CU8A 3AADA 5F25A 3U5JA 3QZVA 5HQ5A 5A5PA 4FLPA 2RS9B 5HJCA 5A7CA 2N9GA 3ZYUA 4UYEA 4CL9A 4CURA 5HQ6A 2WP1A 5F3AA 3LXJA 4ZC9A 4QSVA 5D3TA 3NXBA 5CRZA 3MUKA 5F36A 4PCIA 4YYJA 5TCMA 4N4HA 4TZ2A 2OO1A 4KCXA 5KTWA 4IR4A 5EU1A 4HXNA 3JVMA 4KV1A 5HRXA 5LKTA 4ALHA 2YEKA 4NRBA 5G4RA 3S92A 4TT6A 4O76A 5A81A 4CUTA 5HFQA 5HELA 3HMFA 3O36A 4HXRA 5I80A 4YK0A 3P1EA 4MR6A 5EWDA 4IOOA 4NR8A 5E9KA 5FFVA 5D3HA 4NR6A 4O74A 4XY8A 5ENGA 4NYXA 4NQNA 2RNYA 5EGUA 5HQ7A 3MQMA 5CQ8A 4YYKA 4NUDA 4A9MA 5CRMA 4O7EA 5FE6A 3SVGA 2RFJA 2G4AA 4UYFB 3UVXA 4YY4A 1X0JA 5FG5A 5A5RA 4Q0OA 5FBXA 2OUOA 5ETBA 3U5MA 4LYWA 3U5OA 3O37A 4NR4A 4TS8A 5FH6A 5L98A 4Z6HA 5CUGA 5ENJA 4Y03A 4UIWA 4HBWA 5A85A 5F2PA 5ENCA 5I29A 5DKDA 5I86A 5A5QA 4OGJA 5ENIA 3JVKA 2L84A 4IR3A 5FB1A 3GG3A 3ONIA 3UV4A 4YYDA 4QSXA 5A5OA 2I7KA 5DYXA 5ENBA 4CFLA 5LKZA 5A82A 5AD3A 1JSPB 2E7OA 5IGMA 5E9IA 5LKXA 4QEVA 5F1LA 2E3KA 3IU6A 4YABA 4LC2A 2DATA 2DVSA 5CUCA 5CUDA 4WHUA 4J0RA 2OSSA 5FE9A 4YYMA 5LKUA 4BW1A 4QUUA 5D3SA 3UVWA 3UV2A 3JVLA 5KHMA 4NYVA 5L96A 4QYDA 4A9HA 4LZSA 2KTBB 5AD2A 5KTXA 4GPJA 4NRAA 4NXJA 3U5PA 3UVYA 3U5NA 4XY9A 5EWCA 4LYIA 4YYIA 4HBXA 4NR9A 5EK9A 5D3LA 5D3PA 5CQ3A 4UITA 5EWHA 5FE5A 4A9LA 4QB3A 5II1A 5DYCA 4LZRA 5FE4A 5D3RA 4MR5A 5E3GA 4PCEA 4CUSA 4O71A 2DVQA 4LYSA 5A5SA 4MEOA 5HRVA 4O70A 5EPSA 4O75A 4O77A 4N4FA 4YBSA 2YYNA 4PY6A 5EICA 4O72A 5FFWA 3UW9A 5D3NA 5EISA 5E9MA 5H1TA 4UYDA 5BT5A 4N4IA 4ALGA 4HXSA 2DVRA 5EA1A 5CY9A 5L8UA 4PS5A 5D7XA 4A9EA 4A9IA 5E3DA 5F1HA 3MB4A 4LR6A 4BJXA 4IORA 5ENFA 5CQAA 4YH4A 5CZGA 3SVFA 2L5EA 5EM3A 5C4QA 4YYGA 5A83A 4A9KA 5D24A 4WIVA 4CUUA 3Q2EA 2H60A 4QEUA 3U5KA 5H1UA 3RCWA 3P1FA 5DLXA 5L8TA 4Z93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0C A;  4UIU A;  4Z6I A;  4YC9 A;  2FSA A;  3LQH A;  3QZT A;  5CS8 A;  5IBN A;  5C89 A;  5KO4 A;  4TU6 A;  4J0S A;  2F6J A;  2L85 A;  4QBM A;  5CQT A;  5I7Y A;  3SVH A;  5CUA A;  2F6N A;  4CFK A;  5DKC A;  4NYW A;  5HEM A;  4YYH A;  4WHW A;  4OUF A;  4UIX A;  4QR4 A;  5CP5 A;  4QZS A;  5CFW A;  2YQD A;  3MXF A;  5KU3 A;  4HXP A;  5DFD A;  5EPB A;  5H85 A;  4N3W A;  4TQN A;  2R0Y A;  4O7C A;  4O7B A;  5EI4 A;  1N72 A;  4OGI A;  4CUQ A;  5DKH A;  4E96 A;  5F62 A;  4UYF A;  5I40 A;  5HM0 A;  4TT2 A;  5EPR A;  5EVA A;  4ZQL A;  4YAX A;  4MR3 A;  5FH8 A;  5E9Y A;  4YH3 A;  5DFB A;  5IG6 A;  5DYU A;  4J3I A;  5K29 A;  4TU4 A;  5F60 A;  4TT4 A;  4A9F A;  5F63 A;  5JWM A;  5CGP A;  5C85 A;  5LJ2 A;  3U5L A;  5G4S A;  3MB3 A;  5LVQ A;  4C67 A;  5I7X A;  4NUE A;  5CQ7 A;  3D7C A;  1EQF A;  4N4G A;  5CPE A;  5II2 A;  4IR5 A;  4Q0N A;  4YBM A;  4AKN A;  5FE2 A;  5E7D A;  4HXO A;  4LZ2 A;  4NR5 A;  4F3I A;  4NQM A;  5L97 A;  5DFC A;  5EQ1 A;  4BW4 A;  4QSQ A;  4Z1Q A;  5CUE A;  4HXM A;  2YW5 A;  4MEN A;  5CQ5 A;  4QC1 A;  1JM4 B;  1WUG A;  4ZW1 A;  3K2J A;  5LVR A;  5C8G A;  5E74 A;  5E9L A;  5HEN A;  3HMH A;  3P1C A;  5ACY A;  4QYL A;  4UYH A;  3O35 A;  5EWV A;  5C7N A;  5HFR A;  5I88 A;  4BHW A;  3P1D A;  5FDZ A;  2YEM A;  2GRC A;  4QST A;  5JI8 A;  3O34 A;  2MJV B;  5I83 A;  5HCL A;  5HRW A;  4HXL A;  5CQ4 A;  5E0R A;  2D82 A;  4YY6 A;  5DX4 A;  4UIV A;  1WUM A;  5TB6 A;  4QR3 A;  5FE7 A;  4TYL A;  4HXK A;  4MR4 A;  4QSW A;  5A5N A;  4QC3 A;  4MEP A;  3LQJ A;  4XYA A;  4YAT A;  5DY7 A;  5L99 A;  2RNW A;  4XUA A;  4QSR A;  5AMF A;  3FKM X;  4UYG A;  3HME A;  5COI A;  4LDF A;  2R10 A;  4TZ8 A;  5IGK A;  4QNS A;  5H1V A;  5I89 A;  2D9E A;  2DKW A;  4YAD A;  5FB0 A;  5FE1 A;  5F5Z A;  4PTB A;  5IGN A;  3G0L A;  4BW3 A;  4QSS A;  4NRC A;  2DVV A;  4QY4 A;  5ENE A;  3LQI A;  5FH7 A;  4MEQ A;  4C66 A;  5FFY A;  4YYN A;  4NUC A;  3LJW A;  5EP7 A;  5EV9 A;  4QUT A;  5AME A;  4YBT A;  4J1P A;  3JVJ A;  4HBY A;  4LRG A;  3TLP A;  4O78 A;  3G0J A;  4TTE A;  2RI7 A;  5FE8 A;  5IID A;  5ENH A;  5DW1 A;  3QZS A;  5DLZ A;  4DON A;  3Q2F A;  4PKL A;  1ZS5 A;  4QSU A;  3DWY A;  4CUP A;  4X2I A;  4O7A A;  4Z1S A;  5E9V A;  5BT4 A;  5I1Q A;  5CTL A;  5J0D A;  2RNX A;  5ETD A;  5LUU A;  5DYA A;  2YDW A;  3AQA A;  4BW2 A;  5F61 A;  4QSP A;  4NR7 A;  5FE0 A;  5FG6 A;  3UV5 A;  4QEW A;  5FG4 A;  5BT3 A;  3IU5 A;  4KV4 A;  5CUB A;  5DBM A;  5EWW A;  5DW2 A;  5D25 A;  4RVR A;  4IR6 A;  1F68 A;  4A9J A;  4IOQ A;  3S91 A;  4O7F A;  1E6I A;  2YEL A;  5HLS A;  3P5O A;  4QR5 A;  4NS5 A;  4HBV A;  5KTU A;  2RO1 A;  5CQ6 A;  4UIY A;  4CLB A;  4UIZ A;  4A9O A;  3I3J A;  2LSP B;  5C87 A;  2NXB A;  3DAI A;  5FE3 A;  5LJ0 A;  2E7N A;  2R0V A;  5D26 A;  2WP2 A;  3MUL A;  4A9N A;  2R0S A;  3UVD A;  5D3J A;  3O33 A;  4XUB A;  2I8N A;  5LJ1 A;  5IGL A;  5E73 A;  2DWW A;  5CU8 A;  3AAD A;  5F25 A;  3U5J A;  3QZV A;  5HQ5 A;  5A5P A;  4FLP A;  2RS9 B;  5HJC A;  5A7C A;  2N9G A;  3ZYU A;  4UYE A;  4CL9 A;  4CUR A;  5HQ6 A;  2WP1 A;  5F3A A;  3LXJ A;  4ZC9 A;  4QSV A;  5D3T A;  3NXB A;  5CRZ A;  3MUK A;  5F36 A;  4PCI A;  4YYJ A;  5TCM A;  4N4H A;  4TZ2 A;  2OO1 A;  4KCX A;  5KTW A;  4IR4 A;  5EU1 A;  4HXN A;  3JVM A;  4KV1 A;  5HRX A;  5LKT A;  4ALH A;  2YEK A;  4NRB A;  5G4R A;  3S92 A;  4TT6 A;  4O76 A;  5A81 A;  4CUT A;  5HFQ A;  5HEL A;  3HMF A;  3O36 A;  4HXR A;  5I80 A;  4YK0 A;  3P1E A;  4MR6 A;  5EWD A;  4IOO A;  4NR8 A;  5E9K A;  5FFV A;  5D3H A;  4NR6 A;  4O74 A;  4XY8 A;  5ENG A;  4NYX A;  4NQN A;  2RNY A;  5EGU A;  5HQ7 A;  3MQM A;  5CQ8 A;  4YYK A;  4NUD A;  4A9M A;  5CRM A;  4O7E A;  5FE6 A;  3SVG A;  2RFJ A;  2G4A A;  4UYF B;  3UVX A;  4YY4 A;  1X0J A;  5FG5 A;  5A5R A;  4Q0O A;  5FBX A;  2OUO A;  5ETB A;  3U5M A;  4LYW A;  3U5O A;  3O37 A;  4NR4 A;  4TS8 A;  5FH6 A;  5L98 A;  4Z6H A;  5CUG A;  5ENJ A;  4Y03 A;  4UIW A;  4HBW A;  5A85 A;  5F2P A;  5ENC A;  5I29 A;  5DKD A;  5I86 A;  5A5Q A;  4OGJ A;  5ENI A;  3JVK A;  2L84 A;  4IR3 A;  5FB1 A;  3GG3 A;  3ONI A;  3UV4 A;  4YYD A;  4QSX A;  5A5O A;  2I7K A;  5DYX A;  5ENB A;  4CFL A;  5LKZ A;  5A82 A;  5AD3 A;  1JSP B;  2E7O A;  5IGM A;  5E9I A;  5LKX A;  4QEV A;  5F1L A;  2E3K A;  3IU6 A;  4YAB A;  4LC2 A;  2DAT A;  2DVS A;  5CUC A;  5CUD A;  4WHU A;  4J0R A;  2OSS A;  5FE9 A;  4YYM A;  5LKU A;  4BW1 A;  4QUU A;  5D3S A;  3UVW A;  3UV2 A;  3JVL A;  5KHM A;  4NYV A;  5L96 A;  4QYD A;  4A9H A;  4LZS A;  2KTB B;  5AD2 A;  5KTX A;  4GPJ A;  4NRA A;  4NXJ A;  3U5P A;  3UVY A;  3U5N A;  4XY9 A;  5EWC A;  4LYI A;  4YYI A;  4HBX A;  4NR9 A;  5EK9 A;  5D3L A;  5D3P A;  5CQ3 A;  4UIT A;  5EWH A;  5FE5 A;  4A9L A;  4QB3 A;  5II1 A;  5DYC A;  4LZR A;  5FE4 A;  5D3R A;  4MR5 A;  5E3G A;  4PCE A;  4CUS A;  4O71 A;  2DVQ A;  4LYS A;  5A5S A;  4MEO A;  5HRV A;  4O70 A;  5EPS A;  4O75 A;  4O77 A;  4N4F A;  4YBS A;  2YYN A;  4PY6 A;  5EIC A;  4O72 A;  5FFW A;  3UW9 A;  5D3N A;  5EIS A;  5E9M A;  5H1T A;  4UYD A;  5BT5 A;  4N4I A;  4ALG A;  4HXS A;  2DVR A;  5EA1 A;  5CY9 A;  5L8U A;  4PS5 A;  5D7X A;  4A9E A;  4A9I A;  5E3D A;  5F1H A;  3MB4 A;  4LR6 A;  4BJX A;  4IOR A;  5ENF A;  5CQA A;  4YH4 A;  5CZG A;  3SVF A;  2L5E A;  5EM3 A;  5C4Q A;  4YYG A;  5A83 A;  4A9K A;  5D24 A;  4WIV A;  4CUU A;  3Q2E A;  2H60 A;  4QEU A;  3U5K A;  5H1U A;  3RCW A;  3P1F A;  5DLX A;  5L8T A;  4Z93 A; 
#chains in the Genus database with same CATH topology
 5D0C A;  4UIU A;  4Z6I A;  4YC9 A;  2FSA A;  3LQH A;  3QZT A;  5CS8 A;  5IBN A;  5C89 A;  5KO4 A;  4TU6 A;  4J0S A;  2F6J A;  2L85 A;  4QBM A;  5CQT A;  5I7Y A;  3SVH A;  5CUA A;  2F6N A;  4CFK A;  5DKC A;  4NYW A;  5HEM A;  4YYH A;  4WHW A;  4OUF A;  4UIX A;  4QR4 A;  5CP5 A;  4QZS A;  5CFW A;  2YQD A;  3MXF A;  5KU3 A;  4HXP A;  5DFD A;  5EPB A;  5H85 A;  4N3W A;  4TQN A;  2R0Y A;  4O7C A;  4O7B A;  5EI4 A;  1N72 A;  4OGI A;  4CUQ A;  5DKH A;  4E96 A;  5F62 A;  4UYF A;  5I40 A;  5HM0 A;  4TT2 A;  5EPR A;  5EVA A;  4ZQL A;  4YAX A;  4MR3 A;  5FH8 A;  5E9Y A;  4YH3 A;  5DFB A;  5IG6 A;  5DYU A;  4J3I A;  5K29 A;  4TU4 A;  5F60 A;  4TT4 A;  4A9F A;  5F63 A;  5JWM A;  5CGP A;  5C85 A;  5LJ2 A;  3U5L A;  5G4S A;  3MB3 A;  5LVQ A;  4C67 A;  5I7X A;  4AKG A;  4NUE A;  5CQ7 A;  3D7C A;  3VKG A;  1EQF A;  3D1D A;  4N4G A;  5CPE A;  5II2 A;  4AI6 A;  4IR5 A;  4Q0N A;  4YBM A;  4AKN A;  3D1B A;  5FE2 A;  5E7D A;  4HXO A;  4LZ2 A;  4NR5 A;  4F3I A;  4NQM A;  5L97 A;  5DFC A;  5EQ1 A;  4BW4 A;  4QSQ A;  4Z1Q A;  5CUE A;  4HXM A;  2YW5 A;  2EJN A;  4MEN A;  5CQ5 A;  4QC1 A;  1JM4 B;  1WUG A;  4ZW1 A;  3K2J A;  5LVR A;  5C8G A;  5E74 A;  5E9L A;  5HEN A;  3HMH A;  3P1C A;  5ACY A;  4QYL A;  4UYH A;  3O35 A;  5EWV A;  5C7N A;  4Z93 A;  5HFR A;  5I88 A;  4BHW A;  3P1D A;  5FDZ A;  2YEM A;  2GRC A;  4QST A;  5JI8 A;  1PUO A;  3O34 A;  2MJV B;  5I83 A;  5HCL A;  5HRW A;  4HXL A;  5CQ4 A;  5E0R A;  2D82 A;  4YY6 A;  5DX4 A;  4UIV A;  1WUM A;  5TB6 A;  4QR3 A;  5FE7 A;  4TYL A;  4HXK A;  4MR4 A;  4QSW A;  5A5N A;  4QC3 A;  4MEP A;  3LQJ A;  4XYA A;  4YAT A;  5DY7 A;  5L99 A;  2RNW A;  4XUA A;  4QSR A;  5AMF A;  3FKM X;  4UYG A;  3HME A;  5COI A;  4LDF A;  2R10 A;  4TZ8 A;  5IGK A;  4QNS A;  5H1V A;  5I89 A;  2D9E A;  2DKW A;  4YAD A;  5FB0 A;  5FE1 A;  5F5Z A;  4PTB A;  5IGN A;  3G0L A;  4BW3 A;  4QSS A;  4NRC A;  2DVV A;  4QY4 A;  5ENE A;  3LQI A;  5FH7 A;  4MEQ A;  4C66 A;  5FFY A;  4YYN A;  4NUC A;  3LJW A;  5EP7 A;  5EV9 A;  4QUT A;  5AME A;  4YBT A;  4J1P A;  3JVJ A;  4HBY A;  4LRG A;  3TLP A;  4O78 A;  3G0J A;  4TTE A;  2RI7 A;  5FE8 A;  5IID A;  5ENH A;  5DW1 A;  3QZS A;  5DLZ A;  4DON A;  3Q2F A;  4PKL A;  1ZS5 A;  4QSU A;  3DWY A;  4CUP A;  4X2I A;  4O7A A;  4Z1S A;  5E9V A;  5BT4 A;  5I1Q A;  5CTL A;  5J0D A;  2RNX A;  5ETD A;  5LUU A;  5DYA A;  2YDW A;  3AQA A;  4BW2 A;  5F61 A;  4QSP A;  4NR7 A;  5FE0 A;  5FG6 A;  3UV5 A;  4QEW A;  5FG4 A;  5BT3 A;  3IU5 A;  4KV4 A;  5CUB A;  5DBM A;  5EWW A;  5DW2 A;  5D25 A;  4RVR A;  4IR6 A;  1F68 A;  4A9J A;  4IOQ A;  3S91 A;  4O7F A;  1E6I A;  2YEL A;  5HLS A;  3P5O A;  4QR5 A;  4NS5 A;  4HBV A;  5KTU A;  2RO1 A;  5CQ6 A;  4UIY A;  4CLB A;  4UIZ A;  4A9O A;  3I3J A;  2LSP B;  5C87 A;  2NXB A;  3DAI A;  5FE3 A;  5LJ0 A;  2E7N A;  2R0V A;  5D26 A;  2WP2 A;  3MUL A;  4A9N A;  2R0S A;  3UVD A;  5D3J A;  3O33 A;  4XUB A;  2I8N A;  5LJ1 A;  5IGL A;  5E73 A;  2DWW A;  5CU8 A;  3AAD A;  5F25 A;  3U5J A;  3QZV A;  5HQ5 A;  5A5P A;  4FLP A;  2RS9 B;  5HJC A;  5A7C A;  2N9G A;  3ZYU A;  4UYE A;  4CL9 A;  4CUR A;  5HQ6 A;  2WP1 A;  5F3A A;  3LXJ A;  4ZC9 A;  4QSV A;  5D3T A;  3NXB A;  5CRZ A;  3MUK A;  5F36 A;  4PCI A;  4YYJ A;  5TCM A;  4N4H A;  4TZ2 A;  2OO1 A;  4KCX A;  5KTW A;  4IR4 A;  5EU1 A;  4HXN A;  3JVM A;  4KV1 A;  5HRX A;  5LKT A;  4ALH A;  2YEK A;  4NRB A;  5G4R A;  3S92 A;  4TT6 A;  3VKH A;  4O76 A;  5A81 A;  4CUT A;  5HFQ A;  5HEL A;  3HMF A;  3O36 A;  4HXR A;  5I80 A;  4YK0 A;  3P1E A;  4MR6 A;  5EWD A;  4IOO A;  4NR8 A;  5E9K A;  5FFV A;  5D3H A;  4NR6 A;  4O74 A;  4AKH A;  4XY8 A;  5ENG A;  4NYX A;  4NQN A;  2RNY A;  5EGU A;  5HQ7 A;  3MQM A;  5CQ8 A;  4YYK A;  4NUD A;  4A9M A;  5CRM A;  4O7E A;  5FE6 A;  3SVG A;  2RFJ A;  2G4A A;  4UYF B;  3UVX A;  4YY4 A;  1X0J A;  5FG5 A;  5A5R A;  4Q0O A;  5FBX A;  2OUO A;  4AKI A;  5ETB A;  3U5M A;  3U5O A;  3O37 A;  4NR4 A;  4TS8 A;  5FH6 A;  5L98 A;  4Z6H A;  5CUG A;  5ENJ A;  4Y03 A;  4UIW A;  4HBW A;  5A85 A;  5F2P A;  5ENC A;  5I29 A;  5DKD A;  5I86 A;  5A5Q A;  4OGJ A;  5ENI A;  3JVK A;  2L84 A;  4IR3 A;  5FB1 A;  3GG3 A;  3ONI A;  3UV4 A;  4YYD A;  4QSX A;  5A5O A;  2I7K A;  5DYX A;  5ENB A;  4CFL A;  5LKZ A;  5A82 A;  5AD3 A;  1JSP B;  2E7O A;  5IGM A;  5E9I A;  5LKX A;  4QEV A;  5F1L A;  2E3K A;  3IU6 A;  4YAB A;  4LC2 A;  2DAT A;  2DVS A;  5CUC A;  5CUD A;  4WHU A;  4J0R A;  2OSS A;  5FE9 A;  4YYM A;  5LKU A;  4BW1 A;  4QUU A;  5D3S A;  3ERR A;  3UVW A;  3UV2 A;  3JVL A;  5KHM A;  4NYV A;  5L96 A;  4QYD A;  4A9H A;  4LZS A;  2KTB B;  5AD2 A;  5KTX A;  4GPJ A;  4NRA A;  4NXJ A;  3U5P A;  3UVY A;  3U5N A;  4XY9 A;  5EWC A;  4LYI A;  4YYI A;  4HBX A;  4NR9 A;  5EK9 A;  5D3L A;  5D3P A;  5CQ3 A;  4UIT A;  5EWH A;  5FE5 A;  4A9L A;  4QB3 A;  5II1 A;  5DYC A;  4LZR A;  5FE4 A;  5D3R A;  4MR5 A;  5E3G A;  4PCE A;  4CUS A;  4O71 A;  2DVQ A;  4LYS A;  5A5S A;  4MEO A;  5HRV A;  4O70 A;  5EPS A;  4O75 A;  4O77 A;  4N4F A;  4YBS A;  2YYN A;  4PY6 A;  5EIC A;  4O72 A;  5FFW A;  3UW9 A;  5D3N A;  5EIS A;  5E9M A;  5H1T A;  4UYD A;  5BT5 A;  4N4I A;  4ALG A;  4HXS A;  2DVR A;  5EA1 A;  5CY9 A;  5L8U A;  4PS5 A;  5D7X A;  4A9E A;  4A9I A;  5E3D A;  5F1H A;  3MB4 A;  4LR6 A;  4BJX A;  4IOR A;  5ENF A;  5CQA A;  4YH4 A;  5CZG A;  3SVF A;  2L5E A;  5EM3 A;  5C4Q A;  4YYG A;  5A83 A;  4A9K A;  5D24 A;  4WIV A;  4CUU A;  3Q2E A;  2H60 A;  4QEU A;  3U5K A;  5H1U A;  3RCW A;  1ZKR A;  3P1F A;  5DLX A;  5L8T A;  4LYW A; 
#chains in the Genus database with same CATH homology
 5D0C A;  4UIU A;  4Z6I A;  4YC9 A;  2FSA A;  3LQH A;  3QZT A;  5CS8 A;  5IBN A;  5C89 A;  5KO4 A;  4TU6 A;  4J0S A;  2F6J A;  2L85 A;  4QBM A;  5CQT A;  5I7Y A;  3SVH A;  5CUA A;  2F6N A;  4CFK A;  5DKC A;  4NYW A;  5HEM A;  4YYH A;  4WHW A;  4OUF A;  4UIX A;  4QR4 A;  5CP5 A;  4QZS A;  5CFW A;  2YQD A;  3MXF A;  5KU3 A;  4HXP A;  5DFD A;  5EPB A;  5H85 A;  4N3W A;  4TQN A;  2R0Y A;  4O7C A;  4O7B A;  5EI4 A;  1N72 A;  4OGI A;  4CUQ A;  5DKH A;  4E96 A;  5F62 A;  4UYF A;  5I40 A;  5HM0 A;  4TT2 A;  5EPR A;  5EVA A;  4ZQL A;  4YAX A;  4MR3 A;  5FH8 A;  5E9Y A;  4YH3 A;  5DFB A;  5IG6 A;  5DYU A;  4J3I A;  5K29 A;  4TU4 A;  5F60 A;  4TT4 A;  4A9F A;  5F63 A;  5JWM A;  5CGP A;  5C85 A;  5LJ2 A;  3U5L A;  5G4S A;  3MB3 A;  5LVQ A;  4C67 A;  5I7X A;  4NUE A;  5CQ7 A;  3D7C A;  1EQF A;  4N4G A;  5CPE A;  5II2 A;  4IR5 A;  4Q0N A;  4YBM A;  4AKN A;  5FE2 A;  5E7D A;  4HXO A;  4LZ2 A;  4NR5 A;  4F3I A;  4NQM A;  5L97 A;  5DFC A;  5EQ1 A;  4BW4 A;  4QSQ A;  4Z1Q A;  5CUE A;  4HXM A;  2YW5 A;  4MEN A;  5CQ5 A;  4QC1 A;  1JM4 B;  1WUG A;  4ZW1 A;  3K2J A;  5LVR A;  5C8G A;  5E74 A;  5E9L A;  5HEN A;  3HMH A;  3P1C A;  5ACY A;  4QYL A;  4UYH A;  3O35 A;  5EWV A;  5C7N A;  5HFR A;  5I88 A;  4BHW A;  3P1D A;  5FDZ A;  2YEM A;  2GRC A;  4QST A;  5JI8 A;  3O34 A;  2MJV B;  5I83 A;  5HCL A;  5HRW A;  4HXL A;  5CQ4 A;  5E0R A;  2D82 A;  4YY6 A;  5DX4 A;  4UIV A;  1WUM A;  5TB6 A;  4QR3 A;  5FE7 A;  4TYL A;  4HXK A;  4MR4 A;  4QSW A;  5A5N A;  4QC3 A;  4MEP A;  3LQJ A;  4XYA A;  4YAT A;  5DY7 A;  5L99 A;  2RNW A;  4XUA A;  4QSR A;  5AMF A;  3FKM X;  4UYG A;  3HME A;  5COI A;  4LDF A;  2R10 A;  4TZ8 A;  5IGK A;  4QNS A;  5H1V A;  5I89 A;  2D9E A;  2DKW A;  4YAD A;  5FB0 A;  5FE1 A;  5F5Z A;  4PTB A;  5IGN A;  3G0L A;  4BW3 A;  4QSS A;  4NRC A;  2DVV A;  4QY4 A;  5ENE A;  3LQI A;  5FH7 A;  4MEQ A;  4C66 A;  5FFY A;  4YYN A;  4NUC A;  3LJW A;  5EP7 A;  5EV9 A;  4QUT A;  5AME A;  4YBT A;  4J1P A;  3JVJ A;  4HBY A;  4LRG A;  3TLP A;  4O78 A;  3G0J A;  4TTE A;  2RI7 A;  5FE8 A;  5IID A;  5ENH A;  5DW1 A;  3QZS A;  5DLZ A;  4DON A;  3Q2F A;  4PKL A;  1ZS5 A;  4QSU A;  3DWY A;  4CUP A;  4X2I A;  4O7A A;  4Z1S A;  5E9V A;  5BT4 A;  5I1Q A;  5CTL A;  5J0D A;  2RNX A;  5ETD A;  5LUU A;  5DYA A;  2YDW A;  3AQA A;  4BW2 A;  5F61 A;  4QSP A;  4NR7 A;  5FE0 A;  5FG6 A;  3UV5 A;  4QEW A;  5FG4 A;  5BT3 A;  3IU5 A;  4KV4 A;  5CUB A;  5DBM A;  5EWW A;  5DW2 A;  5D25 A;  4RVR A;  4IR6 A;  1F68 A;  4A9J A;  4IOQ A;  3S91 A;  4O7F A;  1E6I A;  2YEL A;  5HLS A;  3P5O A;  4QR5 A;  4NS5 A;  4HBV A;  5KTU A;  2RO1 A;  5CQ6 A;  4UIY A;  4CLB A;  4UIZ A;  4A9O A;  3I3J A;  2LSP B;  5C87 A;  2NXB A;  3DAI A;  5FE3 A;  5LJ0 A;  2E7N A;  2R0V A;  5D26 A;  2WP2 A;  3MUL A;  4A9N A;  2R0S A;  3UVD A;  5D3J A;  3O33 A;  4XUB A;  2I8N A;  5LJ1 A;  5IGL A;  5E73 A;  2DWW A;  5CU8 A;  3AAD A;  5F25 A;  3U5J A;  3QZV A;  5HQ5 A;  5A5P A;  4FLP A;  2RS9 B;  5HJC A;  5A7C A;  2N9G A;  3ZYU A;  4UYE A;  4CL9 A;  4CUR A;  5HQ6 A;  2WP1 A;  5F3A A;  3LXJ A;  4ZC9 A;  4QSV A;  5D3T A;  3NXB A;  5CRZ A;  3MUK A;  5F36 A;  4PCI A;  4YYJ A;  5TCM A;  4N4H A;  4TZ2 A;  2OO1 A;  4KCX A;  5KTW A;  4IR4 A;  5EU1 A;  4HXN A;  3JVM A;  4KV1 A;  5HRX A;  5LKT A;  4ALH A;  2YEK A;  4NRB A;  5G4R A;  3S92 A;  4TT6 A;  4O76 A;  5A81 A;  4CUT A;  5HFQ A;  5HEL A;  3HMF A;  3O36 A;  4HXR A;  5I80 A;  4YK0 A;  3P1E A;  4MR6 A;  5EWD A;  4IOO A;  4NR8 A;  5E9K A;  5FFV A;  5D3H A;  4NR6 A;  4O74 A;  4XY8 A;  5ENG A;  4NYX A;  4NQN A;  2RNY A;  5EGU A;  5HQ7 A;  3MQM A;  5CQ8 A;  4YYK A;  4NUD A;  4A9M A;  5CRM A;  4O7E A;  5FE6 A;  3SVG A;  2RFJ A;  2G4A A;  4UYF B;  3UVX A;  4YY4 A;  1X0J A;  5FG5 A;  5A5R A;  4Q0O A;  5FBX A;  2OUO A;  5ETB A;  3U5M A;  4LYW A;  3U5O A;  3O37 A;  4NR4 A;  4TS8 A;  5FH6 A;  5L98 A;  4Z6H A;  5CUG A;  5ENJ A;  4Y03 A;  4UIW A;  4HBW A;  5A85 A;  5F2P A;  5ENC A;  5I29 A;  5DKD A;  5I86 A;  5A5Q A;  4OGJ A;  5ENI A;  3JVK A;  2L84 A;  4IR3 A;  5FB1 A;  3GG3 A;  3ONI A;  3UV4 A;  4YYD A;  4QSX A;  5A5O A;  2I7K A;  5DYX A;  5ENB A;  4CFL A;  5LKZ A;  5A82 A;  5AD3 A;  1JSP B;  2E7O A;  5IGM A;  5E9I A;  5LKX A;  4QEV A;  5F1L A;  2E3K A;  3IU6 A;  4YAB A;  4LC2 A;  2DAT A;  2DVS A;  5CUC A;  5CUD A;  4WHU A;  4J0R A;  2OSS A;  5FE9 A;  4YYM A;  5LKU A;  4BW1 A;  4QUU A;  5D3S A;  3UVW A;  3UV2 A;  3JVL A;  5KHM A;  4NYV A;  5L96 A;  4QYD A;  4A9H A;  4LZS A;  2KTB B;  5AD2 A;  5KTX A;  4GPJ A;  4NRA A;  4NXJ A;  3U5P A;  3UVY A;  3U5N A;  4XY9 A;  5EWC A;  4LYI A;  4YYI A;  4HBX A;  4NR9 A;  5EK9 A;  5D3L A;  5D3P A;  5CQ3 A;  4UIT A;  5EWH A;  5FE5 A;  4A9L A;  4QB3 A;  5II1 A;  5DYC A;  4LZR A;  5FE4 A;  5D3R A;  4MR5 A;  5E3G A;  4PCE A;  4CUS A;  4O71 A;  2DVQ A;  4LYS A;  5A5S A;  4MEO A;  5HRV A;  4O70 A;  5EPS A;  4O75 A;  4O77 A;  4N4F A;  4YBS A;  2YYN A;  4PY6 A;  5EIC A;  4O72 A;  5FFW A;  3UW9 A;  5D3N A;  5EIS A;  5E9M A;  5H1T A;  4UYD A;  5BT5 A;  4N4I A;  4ALG A;  4HXS A;  2DVR A;  5EA1 A;  5CY9 A;  5L8U A;  4PS5 A;  5D7X A;  4A9E A;  4A9I A;  5E3D A;  5F1H A;  3MB4 A;  4LR6 A;  4BJX A;  4IOR A;  5ENF A;  5CQA A;  4YH4 A;  5CZG A;  3SVF A;  2L5E A;  5EM3 A;  5C4Q A;  4YYG A;  5A83 A;  4A9K A;  5D24 A;  4WIV A;  4CUU A;  3Q2E A;  2H60 A;  4QEU A;  3U5K A;  5H1U A;  3RCW A;  3P1F A;  5DLX A;  5L8T A;  4Z93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...