5CPEA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
HLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cpeA01
2YQDA 5FH7A 5CUGA 4BW2A 3AADA 4HBXA 4CUSA 3GG3A 4QC1A 5F60A 3O36A 5EWVA 3LQIA 5E9KA 3QZVA 5D3HA 4NRBA 5F2PA 3UVWA 2G4AA 4A9EA 4QSRA 2L84A 2E7OA 5CFWA 5DFDA 4YYGA 5E9LA 5EWCA 4CFLA 3UVXA 5D3NA 5BT4A 4QBMA 3DWYA 4IOQA 3AQAA 3S91A 4CUUA 4QSXA 5DYUA 4Z1SA 3Q2FA 4N4HA 5KHMA 4WIVA 5EWHA 4CUTA 4NUDA 4ZC9A 5L97A 2I7KA 3LXJA 5EPSA 2F6NA 5JI8A 4LR6A 1N72A 4J1PA 4IR6A 4QSTA 4NXJA 5L8TA 3U5KA 1WUMA 2DVSA 5ENBA 5E9IA 4QB3A 5L98A 5LVRA 4MR3A 5DY7A 4YYMA 3UVYA 5F3AA 4YY6A 4HBWA 4IR5A 2DKWA 4UIUA 5LKZA 4UIVA 5HM0A 1EQFA 2DVQA 4IOOA 5I7XA 5D3SA 2LSPB 4QSUA 4HXPA 4OGJA 3JVLA 3QZTA 3UV4A 3P5OA 5FE4A 3UVDA 4QZSA 4A9KA 5I29A 4IR3A 4QEVA 4IORA 5C85A 4HXKA 5F36A 3MB4A 2OUOA 5DW1A 3RCWA 5FE7A 5LKTA 4N4IA 4Z6HA 5EU1A 5CUDA 5D3PA 5HFRA 3K2JA 5ENCA 4QR5A 4YYDA 4QSVA 4YBSA 3MULA 5EWDA 5F5ZA 5CRZA 4HXSA 5AMEA 5EM3A 5EV9A 2D82A 5A7CA 4QEWA 4FLPA 5HFQA 2I8NA 4NQNA 5H85A 5KU3A 5CS8A 5D3RA 3JVJA 5EWWA 5FFVA 5C8GA 2YW5A 3MXFA 5FDZA 5LKXA 4YYIA 5CQ3A 4UYDA 5HELA 5DKHA 1JM4B 5H1TA 2WP2A 4QR4A 4N3WA 4QUTA 4YBMA 4QSSA 5A82A 5BT5A 3P1EA 2RNWA 5I40A 2RI7A 1ZS5A 4NR4A 4Q0OA 5A5SA 4Z6IA 5LVQA 3HMEA 4MEOA 5A5QA 4N4GA 5EPRA 4A9OA 5DYXA 4IR4A 3I3JA 5E3DA 4NRAA 4J0SA 3P1DA 4A9JA 3ONIA 5F63A 3U5OA 4BHWA 4NR7A 3DAIA 5D24A 4A9MA 4CLBA 4TU4A 5CGPA 2YYNA 4XUAA 5C87A 5F61A 5TCMA 4YC9A 5FG4A 4NR9A 5A5PA 4A9HA 5FE3A 5A85A 5C89A 4PKLA 5C4QA 5ENHA 5EISA 2GRCA 4MENA 5CUBA 5FE9A 4LZSA 5CUAA 4YBTA 4XUBA 4LYSA 5CZGA 4A9NA 5HRXA 5D3LA 3LQHA 3UV2A 4TQNA 3IU6A 4QYLA 4A9FA 5EVAA 5F1HA 5LJ2A 4NYWA 4ALHA 5CQ4A 4E96A 4YADA 4MR4A 1WUGA 4O7BA 5E3GA 3S92A 4A9LA 5CQ8A 4HBVA 5DFBA 5FG6A 4RVRA 5DKDA 4YH4A 3Q2EA 4ZQLA 3P1FA 5A5OA 5D0CA 4LZRA 5EGUA 4O70A 3MUKA 4PS5A 3SVGA 4C66A 5HCLA 4PTBA 5IIDA 3G0JA 4CFKA 4XY9A 2DVVA 2YELA 4TZ2A 3UW9A 2L5EA 2DVRA 5LKUA 2RNYA 5J0DA 5DYCA 2DWWA 4QEUA 4NRCA 2NXBA 3QZSA 5EICA 3ZYUA 4TZ8A 3FKMX 2MJVB 5KTWA 5ETBA 5HLSA 2RFJA 4MR6A 3HMFA 5L96A 5H1UA 4QC3A 4O78A 5CY9A 2YEMA 5CU8A 5KTUA 3UV5A 4O72A 5I89A 1X0JA 4TYLA 4UIZA 4NR5A 4LYIA 4Z1QA 5I7YA 4O7FA 5CQ5A 4MR5A 4PY6A 5K29A 5A5NA 3D7CA 2E7NA 2RS9B 5EA1A 4J0RA 5IGNA 4UITA 4YYKA 5FE5A 3LQJA 4KV4A 4O7EA 4OGIA 5IGLA 4NUCA 2H60A 4TU6A 5ENGA 3O34A 5CUCA 4YYJA 4YY4A 4YH3A 5IG6A 4HBYA 5IGKA 5I1QA 4BW3A 2D9EA 4YK0A 4TS8A 4Q0NA 4LYWA 4C67A 5FB1A 4BJXA 5H1VA 5EPBA 4HXLA 2OO1A 5I83A 4TTEA 4QUUA 4HXNA 4UIWA 5IGMA 2L85A 2R0VA 4HXRA 5LUUA 4YABA 5AMFA 4O74A 4O7CA 1E6IA 4PCEA 5DYAA 5HQ5A 4ALGA 4HXMA 5I86A 4GPJA 5ENFA 4LRGA 5E9VA 5FE1A 4TT2A 5DX4A 5IBNA 4UYFB 3MB3A 5AD2A 5I88A 5BT3A 4QSQA 5LJ1A 5A83A 4BW4A 4YYHA 5E73A 4NUEA 5D7XA 5ENEA 4MEPA 5LJ0A 5D3JA 5FE2A 5EK9A 3U5NA 3MQMA 5CQAA 5FH8A 5G4SA 4A9IA 5DFCA 5FH6A 4NR6A 5E7DA 5FB0A 5D25A 2DATA 5DLZA 4YATA 4TT4A 5E9YA 5CRMA 5C7NA 3U5JA 3U5PA 2E3KA 3IU5A 3U5MA 5F1LA 4LC2A 4O75A 3O33A 4NYXA 5F62A 4WHUA 3JVMA 4TT6A 2FSAA 4UIYA 4KV1A 4N4FA 4ZW1A 4YYNA 2RNXA 2WP1A 4DONA 4NS5A 4F3IA 3JVKA 3NXBA 3TLPA 5E74A 3SVFA 4Y03A 4UIXA 4CURA 3LJWA 4LDFA 3U5LA 5FG5A 5FFYA 4Z93A 4CL9A 2YEKA 4O77A 4CUPA 5A81A 4MEQA 4KCXA 4UYGA 4HXOA 2YDWA 4UYHA 2N9GA 2OSSA 4QNSA 1F68A 4AKNA 4UYFA 5DKCA 4WHWA 5AD3A 5CTLA 2R0YA 5A5RA 4QSWA 5II2A 5DLXA 5CQ6A 3G0LA 2F6JA 5CPEA 5E9MA 4QSPA 4X2IA 5TB6A 4OUFA 4NYVA 5ENJA 5ETDA 4J3IA 4NQMA 5HJCA 5HQ6A 5KO4A 5JWMA 5KTXA 4UYEA 5ACYA 3HMHA 3P1CA 2KTBB 5FFWA 5EQ1A 5HEMA 5G4RA 5HENA 4LZ2A 4CUQA 5DW2A 5ENIA 5HQ7A 5D26A 5F25A 2RO1A 5HRWA 4O7AA 4BW1A 5DBMA 4O76A 4XY8A 5FE8A 4NR8A 5CP5A 2R0SA 5II1A 5HRVA 5COIA 4QYDA 4QY4A 1JSPB 3O35A 3SVHA 4YAXA 5I80A 5EI4A 5CQ7A 5FE6A 5D3TA 2R10A 4O71A 5CUEA 4QR3A 4XYAA 5FE0A 5EP7A 5E0RA 4PCIA 5CQTA 5L99A 5FBXA 5L8UA 3O37A
chains in the Genus database with same CATH superfamily
2YQDA 5FH7A 5CUGA 4BW2A 3AADA 4HBXA 4CUSA 2EJNA 3GG3A 4QC1A 5F60A 3O36A 5EWVA 3LQIA 5E9KA 3QZVA 5D3HA 4NRBA 5F2PA 3UVWA 2G4AA 4A9EA 4QSRA 3ERRA 2L84A 2E7OA 5CFWA 5DFDA 4YYGA 5E9LA 5EWCA 4CFLA 3UVXA 5D3NA 5BT4A 4QBMA 3DWYA 4IOQA 3AQAA 3S91A 4CUUA 4QSXA 5DYUA 4Z1SA 3Q2FA 4N4HA 5KHMA 4WIVA 5EWHA 4CUTA 3VKHA 4NUDA 4ZC9A 5L97A 2I7KA 3LXJA 5EPSA 2F6NA 5JI8A 4LR6A 1N72A 4J1PA 4IR6A 4QSTA 4NXJA 5L8TA 3U5KA 1WUMA 2DVSA 5ENBA 5E9IA 4QB3A 5L98A 5LVRA 4MR3A 5DY7A 4YYMA 3UVYA 5F3AA 4YY6A 4HBWA 4IR5A 2DKWA 4UIUA 5LKZA 4UIVA 5HM0A 1EQFA 2DVQA 4IOOA 5I7XA 5D3SA 2LSPB 4QSUA 4HXPA 4OGJA 3JVLA 3QZTA 3UV4A 3P5OA 5FE4A 3UVDA 4QZSA 4A9KA 5I29A 4IR3A 4QEVA 4IORA 5C85A 4HXKA 5F36A 3MB4A 2OUOA 5DW1A 3RCWA 5FE7A 5LKTA 4N4IA 4Z6HA 5EU1A 5CUDA 5D3PA 5HFRA 3K2JA 5ENCA 4QR5A 4YYDA 4QSVA 4YBSA 3MULA 5EWDA 5F5ZA 5CRZA 4HXSA 3D1BA 5AMEA 5EM3A 5EV9A 2D82A 5A7CA 4QEWA 4FLPA 5HFQA 2I8NA 4NQNA 5H85A 5KU3A 5CS8A 5D3RA 3JVJA 5EWWA 5FFVA 5C8GA 2YW5A 3MXFA 5FDZA 5LKXA 4YYIA 5CQ3A 4UYDA 5HELA 5DKHA 1JM4B 5H1TA 2WP2A 4QR4A 4N3WA 4QUTA 4YBMA 4QSSA 5A82A 5BT5A 3P1EA 2RNWA 5I40A 2RI7A 1ZS5A 4NR4A 4Q0OA 5A5SA 4Z6IA 5LVQA 3HMEA 4MEOA 5A5QA 4N4GA 5EPRA 4A9OA 5DYXA 4IR4A 3I3JA 5E3DA 4NRAA 4J0SA 3P1DA 4A9JA 3ONIA 5F63A 3U5OA 4BHWA 4NR7A 3DAIA 5D24A 4A9MA 4CLBA 4TU4A 5CGPA 2YYNA 4XUAA 5C87A 5F61A 5TCMA 4YC9A 5FG4A 4NR9A 5A5PA 4A9HA 5FE3A 5A85A 5C89A 4PKLA 5C4QA 5ENHA 5EISA 2GRCA 4MENA 5CUBA 5FE9A 4LZSA 5CUAA 4YBTA 4XUBA 4LYSA 5CZGA 4A9NA 5HRXA 5D3LA 3LQHA 3UV2A 4TQNA 3IU6A 4QYLA 4A9FA 5EVAA 5F1HA 5LJ2A 4NYWA 4ALHA 5CQ4A 4E96A 4YADA 4MR4A 1WUGA 4O7BA 5E3GA 3S92A 4A9LA 5CQ8A 4HBVA 5DFBA 5FG6A 4RVRA 5DKDA 4YH4A 3Q2EA 4ZQLA 3P1FA 5A5OA 5D0CA 4LZRA 5EGUA 4O70A 3MUKA 4PS5A 3SVGA 4C66A 5HCLA 4PTBA 5IIDA 3G0JA 4CFKA 4XY9A 2DVVA 2YELA 4TZ2A 3UW9A 2L5EA 2DVRA 5LKUA 2RNYA 5J0DA 5DYCA 2DWWA 4QEUA 4NRCA 2NXBA 3QZSA 5EICA 3ZYUA 4TZ8A 3FKMX 2MJVB 5KTWA 5ETBA 5HLSA 2RFJA 1ZKRA 4MR6A 3HMFA 5L96A 5H1UA 4QC3A 4O78A 3D1DA 5CY9A 2YEMA 5CU8A 5KTUA 3UV5A 4O72A 5I89A 1X0JA 4TYLA 4UIZA 4NR5A 4LYIA 4Z1QA 5I7YA 4O7FA 5CQ5A 4MR5A 4PY6A 5K29A 5A5NA 3D7CA 2E7NA 2RS9B 5EA1A 4J0RA 5IGNA 4UITA 4YYKA 5FE5A 3LQJA 4KV4A 4O7EA 4OGIA 5IGLA 4NUCA 2H60A 4TU6A 5ENGA 3O34A 5CUCA 4YYJA 4YY4A 4YH3A 5IG6A 4HBYA 5IGKA 5I1QA 4BW3A 2D9EA 4YK0A 4TS8A 4Q0NA 4AI6A 4LYWA 4C67A 5FB1A 4BJXA 5H1VA 5EPBA 4HXLA 2OO1A 5I83A 4TTEA 4QUUA 4HXNA 4UIWA 5IGMA 2L85A 2R0VA 4HXRA 5LUUA 4YABA 5AMFA 4O74A 4O7CA 1E6IA 4PCEA 5DYAA 5HQ5A 4ALGA 4HXMA 5I86A 4GPJA 5ENFA 4LRGA 5E9VA 5FE1A 4TT2A 5DX4A 5IBNA 4UYFB 3MB3A 5AD2A 5I88A 5BT3A 4QSQA 5LJ1A 5A83A 4BW4A 4YYHA 5E73A 4NUEA 5D7XA 5ENEA 4MEPA 4AKHA 5LJ0A 5D3JA 5FE2A 5EK9A 3U5NA 3MQMA 5CQAA 5FH8A 5G4SA 4A9IA 5DFCA 5FH6A 4NR6A 5E7DA 5FB0A 5D25A 2DATA 5DLZA 4YATA 4TT4A 5E9YA 5CRMA 5C7NA 3U5JA 3U5PA 2E3KA 3IU5A 3U5MA 5F1LA 4LC2A 4O75A 3O33A 4NYXA 5F62A 4WHUA 3JVMA 4TT6A 2FSAA 4UIYA 4KV1A 4N4FA 4ZW1A 4YYNA 2RNXA 2WP1A 4DONA 4AKGA 4NS5A 4F3IA 3JVKA 3NXBA 3TLPA 5E74A 3SVFA 4Y03A 4UIXA 4CURA 3LJWA 4LDFA 3U5LA 5FG5A 5FFYA 4Z93A 4CL9A 2YEKA 4O77A 4CUPA 5A81A 4MEQA 4KCXA 4UYGA 4HXOA 2YDWA 3VKGA 4UYHA 2N9GA 2OSSA 4QNSA 1F68A 4AKNA 4UYFA 5DKCA 4WHWA 5AD3A 5CTLA 2R0YA 5A5RA 4QSWA 5II2A 5DLXA 5CQ6A 3G0LA 2F6JA 5CPEA 5E9MA 1PUOA 4QSPA 4X2IA 5TB6A 4OUFA 4NYVA 5ENJA 5ETDA 4J3IA 4NQMA 5HJCA 5HQ6A 5KO4A 5JWMA 5KTXA 4UYEA 5ACYA 3HMHA 3P1CA 2KTBB 5FFWA 5EQ1A 5HEMA 5G4RA 5HENA 4LZ2A 4CUQA 5DW2A 5ENIA 5HQ7A 5D26A 5F25A 2RO1A 5HRWA 4O7AA 4BW1A 5DBMA 4O76A 4XY8A 5FE8A 4NR8A 5CP5A 2R0SA 5II1A 5HRVA 5COIA 4QYDA 4QY4A 1JSPB 3O35A 3SVHA 4YAXA 5I80A 5EI4A 5CQ7A 5FE6A 4AKIA 5D3TA 2R10A 4O71A 5CUEA 4QR3A 4XYAA 5FE0A 5EP7A 5E0RA 4PCIA 5CQTA 5L99A 5FBXA 5L8UA 3O37A
chains in the Genus database with same CATH topology
2YQDA 5FH7A 5CUGA 4BW2A 3AADA 4HBXA 4CUSA 3GG3A 4QC1A 5F60A 3O36A 5EWVA 3LQIA 5E9KA 3QZVA 5D3HA 4NRBA 5F2PA 3UVWA 2G4AA 4A9EA 4QSRA 2L84A 2E7OA 5CFWA 5DFDA 4YYGA 5E9LA 5EWCA 4CFLA 3UVXA 5D3NA 5BT4A 4QBMA 3DWYA 4IOQA 3AQAA 3S91A 4CUUA 4QSXA 5DYUA 4Z1SA 3Q2FA 4N4HA 5KHMA 4WIVA 5EWHA 4CUTA 4NUDA 4ZC9A 5L97A 2I7KA 3LXJA 5EPSA 2F6NA 5JI8A 4LR6A 1N72A 4J1PA 4IR6A 4QSTA 4NXJA 5L8TA 3U5KA 1WUMA 2DVSA 5ENBA 5E9IA 4QB3A 5L98A 5LVRA 4MR3A 5DY7A 4YYMA 3UVYA 5F3AA 4YY6A 4HBWA 4IR5A 2DKWA 4UIUA 5LKZA 4UIVA 5HM0A 1EQFA 2DVQA 4IOOA 5I7XA 5D3SA 2LSPB 4QSUA 4HXPA 4OGJA 3JVLA 3QZTA 3UV4A 3P5OA 5FE4A 3UVDA 4QZSA 4A9KA 5I29A 4IR3A 4QEVA 4IORA 5C85A 4HXKA 5F36A 3MB4A 2OUOA 5DW1A 3RCWA 5FE7A 5LKTA 4N4IA 4Z6HA 5EU1A 5CUDA 5D3PA 5HFRA 3K2JA 5ENCA 4QR5A 4YYDA 4QSVA 4YBSA 3MULA 5EWDA 5F5ZA 5CRZA 4HXSA 5AMEA 5EM3A 5EV9A 2D82A 5A7CA 4QEWA 4FLPA 5HFQA 2I8NA 4NQNA 5H85A 5KU3A 5CS8A 5D3RA 3JVJA 5EWWA 5FFVA 5C8GA 2YW5A 3MXFA 5FDZA 5LKXA 4YYIA 5CQ3A 4UYDA 5HELA 5DKHA 1JM4B 5H1TA 2WP2A 4QR4A 4N3WA 4QUTA 4YBMA 4QSSA 5A82A 5BT5A 3P1EA 2RNWA 5I40A 2RI7A 1ZS5A 4NR4A 4Q0OA 5A5SA 4Z6IA 5LVQA 3HMEA 4MEOA 5A5QA 4N4GA 5EPRA 4A9OA 5DYXA 4IR4A 3I3JA 5E3DA 4NRAA 4J0SA 3P1DA 4A9JA 3ONIA 5F63A 3U5OA 4BHWA 4NR7A 3DAIA 5D24A 4A9MA 4CLBA 4TU4A 5CGPA 2YYNA 4XUAA 5C87A 5F61A 5TCMA 4YC9A 5FG4A 4NR9A 5A5PA 4A9HA 5FE3A 5A85A 5C89A 4PKLA 5C4QA 5ENHA 5EISA 2GRCA 4MENA 5CUBA 5FE9A 4LZSA 5CUAA 4YBTA 4XUBA 4LYSA 5CZGA 4A9NA 5HRXA 5D3LA 3LQHA 3UV2A 4TQNA 3IU6A 4QYLA 4A9FA 5EVAA 5F1HA 5LJ2A 4NYWA 4ALHA 5CQ4A 4E96A 4YADA 4MR4A 1WUGA 4O7BA 5E3GA 3S92A 4A9LA 5CQ8A 4HBVA 5DFBA 5FG6A 4RVRA 5DKDA 4YH4A 3Q2EA 4ZQLA 3P1FA 5A5OA 5D0CA 4LZRA 5EGUA 4O70A 3MUKA 4PS5A 3SVGA 4C66A 5HCLA 4PTBA 5IIDA 3G0JA 4CFKA 4XY9A 2DVVA 2YELA 4TZ2A 3UW9A 2L5EA 2DVRA 5LKUA 2RNYA 5J0DA 5DYCA 2DWWA 4QEUA 4NRCA 2NXBA 3QZSA 5EICA 3ZYUA 4TZ8A 3FKMX 2MJVB 5KTWA 5ETBA 5HLSA 2RFJA 4MR6A 3HMFA 5L96A 5H1UA 4QC3A 4O78A 5CY9A 2YEMA 5CU8A 5KTUA 3UV5A 4O72A 5I89A 1X0JA 4TYLA 4UIZA 4NR5A 4LYIA 4Z1QA 5I7YA 4O7FA 5CQ5A 4MR5A 4PY6A 5K29A 5A5NA 3D7CA 2E7NA 2RS9B 5EA1A 4J0RA 5IGNA 4UITA 4YYKA 5FE5A 3LQJA 4KV4A 4O7EA 4OGIA 5IGLA 4NUCA 2H60A 4TU6A 5ENGA 3O34A 5CUCA 4YYJA 4YY4A 4YH3A 5IG6A 4HBYA 5IGKA 5I1QA 4BW3A 2D9EA 4YK0A 4TS8A 4Q0NA 4LYWA 4C67A 5FB1A 4BJXA 5H1VA 5EPBA 4HXLA 2OO1A 5I83A 4TTEA 4QUUA 4HXNA 4UIWA 5IGMA 2L85A 2R0VA 4HXRA 5LUUA 4YABA 5AMFA 4O74A 4O7CA 1E6IA 4PCEA 5DYAA 5HQ5A 4ALGA 4HXMA 5I86A 4GPJA 5ENFA 4LRGA 5E9VA 5FE1A 4TT2A 5DX4A 5IBNA 4UYFB 3MB3A 5AD2A 5I88A 5BT3A 4QSQA 5LJ1A 5A83A 4BW4A 4YYHA 5E73A 4NUEA 5D7XA 5ENEA 4MEPA 5LJ0A 5D3JA 5FE2A 5EK9A 3U5NA 3MQMA 5CQAA 5FH8A 5G4SA 4A9IA 5DFCA 5FH6A 4NR6A 5E7DA 5FB0A 5D25A 2DATA 5DLZA 4YATA 4TT4A 5E9YA 5CRMA 5C7NA 3U5JA 3U5PA 2E3KA 3IU5A 3U5MA 5F1LA 4LC2A 4O75A 3O33A 4NYXA 5F62A 4WHUA 3JVMA 4TT6A 2FSAA 4UIYA 4KV1A 4N4FA 4ZW1A 4YYNA 2RNXA 2WP1A 4DONA 4NS5A 4F3IA 3JVKA 3NXBA 3TLPA 5E74A 3SVFA 4Y03A 4UIXA 4CURA 3LJWA 4LDFA 3U5LA 5FG5A 5FFYA 4Z93A 4CL9A 2YEKA 4O77A 4CUPA 5A81A 4MEQA 4KCXA 4UYGA 4HXOA 2YDWA 4UYHA 2N9GA 2OSSA 4QNSA 1F68A 4AKNA 4UYFA 5DKCA 4WHWA 5AD3A 5CTLA 2R0YA 5A5RA 4QSWA 5II2A 5DLXA 5CQ6A 3G0LA 2F6JA 5CPEA 5E9MA 4QSPA 4X2IA 5TB6A 4OUFA 4NYVA 5ENJA 5ETDA 4J3IA 4NQMA 5HJCA 5HQ6A 5KO4A 5JWMA 5KTXA 4UYEA 5ACYA 3HMHA 3P1CA 2KTBB 5FFWA 5EQ1A 5HEMA 5G4RA 5HENA 4LZ2A 4CUQA 5DW2A 5ENIA 5HQ7A 5D26A 5F25A 2RO1A 5HRWA 4O7AA 4BW1A 5DBMA 4O76A 4XY8A 5FE8A 4NR8A 5CP5A 2R0SA 5II1A 5HRVA 5COIA 4QYDA 4QY4A 1JSPB 3O35A 3SVHA 4YAXA 5I80A 5EI4A 5CQ7A 5FE6A 5D3TA 2R10A 4O71A 5CUEA 4QR3A 4XYAA 5FE0A 5EP7A 5E0RA 4PCIA 5CQTA 5L99A 5FBXA 5L8UA 3O37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQD A;  5FH7 A;  5CUG A;  4BW2 A;  3AAD A;  4HBX A;  4CUS A;  3GG3 A;  4QC1 A;  5F60 A;  3O36 A;  5EWV A;  3LQI A;  5E9K A;  3QZV A;  5D3H A;  4NRB A;  5F2P A;  3UVW A;  2G4A A;  4A9E A;  4QSR A;  2L84 A;  2E7O A;  5CFW A;  5DFD A;  4YYG A;  5E9L A;  5EWC A;  4CFL A;  3UVX A;  5D3N A;  5BT4 A;  4QBM A;  3DWY A;  4IOQ A;  3AQA A;  3S91 A;  4CUU A;  4QSX A;  5DYU A;  4Z1S A;  3Q2F A;  4N4H A;  5KHM A;  4WIV A;  5EWH A;  4CUT A;  4NUD A;  4ZC9 A;  5L97 A;  2I7K A;  3LXJ A;  5EPS A;  2F6N A;  5JI8 A;  4LR6 A;  1N72 A;  4J1P A;  4IR6 A;  4QST A;  4NXJ A;  5L8T A;  3U5K A;  1WUM A;  2DVS A;  5ENB A;  5E9I A;  4QB3 A;  5L98 A;  5LVR A;  4MR3 A;  5DY7 A;  4YYM A;  3UVY A;  5F3A A;  4YY6 A;  4HBW A;  4IR5 A;  2DKW A;  4UIU A;  5LKZ A;  4UIV A;  5HM0 A;  1EQF A;  2DVQ A;  4IOO A;  5I7X A;  5D3S A;  2LSP B;  4QSU A;  4HXP A;  4OGJ A;  3JVL A;  3QZT A;  3UV4 A;  3P5O A;  5FE4 A;  3UVD A;  4QZS A;  4A9K A;  5I29 A;  4IR3 A;  4QEV A;  4IOR A;  5C85 A;  4HXK A;  5F36 A;  3MB4 A;  2OUO A;  5DW1 A;  3RCW A;  5FE7 A;  5LKT A;  4N4I A;  4Z6H A;  5EU1 A;  5CUD A;  5D3P A;  5HFR A;  3K2J A;  5ENC A;  4QR5 A;  4YYD A;  4QSV A;  4YBS A;  3MUL A;  5EWD A;  5F5Z A;  5CRZ A;  4HXS A;  5AME A;  5EM3 A;  5EV9 A;  2D82 A;  5A7C A;  4QEW A;  4FLP A;  5HFQ A;  2I8N A;  4NQN A;  5H85 A;  5KU3 A;  5CS8 A;  5D3R A;  3JVJ A;  5EWW A;  5FFV A;  5C8G A;  2YW5 A;  3MXF A;  5FDZ A;  5LKX A;  4YYI A;  5CQ3 A;  4UYD A;  5HEL A;  5DKH A;  1JM4 B;  5H1T A;  2WP2 A;  4QR4 A;  4N3W A;  4QUT A;  4YBM A;  4QSS A;  5A82 A;  5BT5 A;  3P1E A;  2RNW A;  5I40 A;  2RI7 A;  1ZS5 A;  4NR4 A;  4Q0O A;  5A5S A;  4Z6I A;  5LVQ A;  3HME A;  4MEO A;  5A5Q A;  4N4G A;  5EPR A;  4A9O A;  5DYX A;  4IR4 A;  3I3J A;  5E3D A;  4NRA A;  4J0S A;  3P1D A;  4A9J A;  3ONI A;  5F63 A;  3U5O A;  4BHW A;  4NR7 A;  3DAI A;  5D24 A;  4A9M A;  4CLB A;  4TU4 A;  5CGP A;  2YYN A;  4XUA A;  5C87 A;  5F61 A;  5TCM A;  4YC9 A;  5FG4 A;  4NR9 A;  5A5P A;  4A9H A;  5FE3 A;  5A85 A;  5C89 A;  4PKL A;  5C4Q A;  5ENH A;  5EIS A;  2GRC A;  4MEN A;  5CUB A;  5FE9 A;  4LZS A;  5CUA A;  4YBT A;  4XUB A;  4LYS A;  5CZG A;  4A9N A;  5HRX A;  5D3L A;  3LQH A;  3UV2 A;  4TQN A;  3IU6 A;  4QYL A;  4A9F A;  5EVA A;  5F1H A;  5LJ2 A;  4NYW A;  4ALH A;  5CQ4 A;  4E96 A;  4YAD A;  4MR4 A;  1WUG A;  4O7B A;  5E3G A;  3S92 A;  4A9L A;  5CQ8 A;  4HBV A;  5DFB A;  5FG6 A;  4RVR A;  5DKD A;  4YH4 A;  3Q2E A;  4ZQL A;  3P1F A;  5A5O A;  5D0C A;  4LZR A;  5EGU A;  4O70 A;  3MUK A;  4PS5 A;  3SVG A;  4C66 A;  5HCL A;  4PTB A;  5IID A;  3G0J A;  4CFK A;  4XY9 A;  2DVV A;  2YEL A;  4TZ2 A;  3UW9 A;  2L5E A;  2DVR A;  5LKU A;  2RNY A;  5J0D A;  5DYC A;  2DWW A;  4QEU A;  4NRC A;  2NXB A;  3QZS A;  5EIC A;  3ZYU A;  4TZ8 A;  3FKM X;  2MJV B;  5KTW A;  5ETB A;  5HLS A;  2RFJ A;  4MR6 A;  3HMF A;  5L96 A;  5H1U A;  4QC3 A;  4O78 A;  5CY9 A;  2YEM A;  5CU8 A;  5KTU A;  3UV5 A;  4O72 A;  5I89 A;  1X0J A;  4TYL A;  4UIZ A;  4NR5 A;  4LYI A;  4Z1Q A;  5I7Y A;  4O7F A;  5CQ5 A;  4MR5 A;  4PY6 A;  5K29 A;  5A5N A;  3D7C A;  2E7N A;  2RS9 B;  5EA1 A;  4J0R A;  5IGN A;  4UIT A;  4YYK A;  5FE5 A;  3LQJ A;  4KV4 A;  4O7E A;  4OGI A;  5IGL A;  4NUC A;  2H60 A;  4TU6 A;  5ENG A;  3O34 A;  5CUC A;  4YYJ A;  4YY4 A;  4YH3 A;  5IG6 A;  4HBY A;  5IGK A;  5I1Q A;  4BW3 A;  2D9E A;  4YK0 A;  4TS8 A;  4Q0N A;  4LYW A;  4C67 A;  5FB1 A;  4BJX A;  5H1V A;  5EPB A;  4HXL A;  2OO1 A;  5I83 A;  4TTE A;  4QUU A;  4HXN A;  4UIW A;  5IGM A;  2L85 A;  2R0V A;  4HXR A;  5LUU A;  4YAB A;  5AMF A;  4O74 A;  4O7C A;  1E6I A;  4PCE A;  5DYA A;  5HQ5 A;  4ALG A;  4HXM A;  5I86 A;  4GPJ A;  5ENF A;  4LRG A;  5E9V A;  5FE1 A;  4TT2 A;  5DX4 A;  5IBN A;  4UYF B;  3MB3 A;  5AD2 A;  5I88 A;  5BT3 A;  4QSQ A;  5LJ1 A;  5A83 A;  4BW4 A;  4YYH A;  5E73 A;  4NUE A;  5D7X A;  5ENE A;  4MEP A;  5LJ0 A;  5D3J A;  5FE2 A;  5EK9 A;  3U5N A;  3MQM A;  5CQA A;  5FH8 A;  5G4S A;  4A9I A;  5DFC A;  5FH6 A;  4NR6 A;  5E7D A;  5FB0 A;  5D25 A;  2DAT A;  5DLZ A;  4YAT A;  4TT4 A;  5E9Y A;  5CRM A;  5C7N A;  3U5J A;  3U5P A;  2E3K A;  3IU5 A;  3U5M A;  5F1L A;  4LC2 A;  4O75 A;  3O33 A;  4NYX A;  5F62 A;  4WHU A;  3JVM A;  4TT6 A;  2FSA A;  4UIY A;  4KV1 A;  4N4F A;  4ZW1 A;  4YYN A;  2RNX A;  2WP1 A;  4DON A;  4NS5 A;  4F3I A;  3JVK A;  3NXB A;  3TLP A;  5E74 A;  3SVF A;  4Y03 A;  4UIX A;  4CUR A;  3LJW A;  4LDF A;  3U5L A;  5FG5 A;  5FFY A;  4Z93 A;  4CL9 A;  2YEK A;  4O77 A;  4CUP A;  5A81 A;  4MEQ A;  4KCX A;  4UYG A;  4HXO A;  2YDW A;  4UYH A;  2N9G A;  2OSS A;  4QNS A;  1F68 A;  4AKN A;  4UYF A;  5DKC A;  4WHW A;  5AD3 A;  5CTL A;  2R0Y A;  5A5R A;  4QSW A;  5II2 A;  5DLX A;  5CQ6 A;  3G0L A;  2F6J A;  5CPE A;  5E9M A;  4QSP A;  4X2I A;  5TB6 A;  4OUF A;  4NYV A;  5ENJ A;  5ETD A;  4J3I A;  4NQM A;  5HJC A;  5HQ6 A;  5KO4 A;  5JWM A;  5KTX A;  4UYE A;  5ACY A;  3HMH A;  3P1C A;  2KTB B;  5FFW A;  5EQ1 A;  5HEM A;  5G4R A;  5HEN A;  4LZ2 A;  4CUQ A;  5DW2 A;  5ENI A;  5HQ7 A;  5D26 A;  5F25 A;  2RO1 A;  5HRW A;  4O7A A;  4BW1 A;  5DBM A;  4O76 A;  4XY8 A;  5FE8 A;  4NR8 A;  5CP5 A;  2R0S A;  5II1 A;  5HRV A;  5COI A;  4QYD A;  4QY4 A;  1JSP B;  3O35 A;  3SVH A;  4YAX A;  5I80 A;  5EI4 A;  5CQ7 A;  5FE6 A;  5D3T A;  2R10 A;  4O71 A;  5CUE A;  4QR3 A;  4XYA A;  5FE0 A;  5EP7 A;  5E0R A;  4PCI A;  5CQT A;  5L99 A;  5FBX A;  5L8U A;  3O37 A; 
#chains in the Genus database with same CATH topology
 2YQD A;  5FH7 A;  5CUG A;  4BW2 A;  3AAD A;  4HBX A;  4CUS A;  2EJN A;  3GG3 A;  4QC1 A;  5F60 A;  3O36 A;  5EWV A;  3LQI A;  5E9K A;  3QZV A;  5D3H A;  4NRB A;  5F2P A;  3UVW A;  2G4A A;  4A9E A;  4QSR A;  3ERR A;  2L84 A;  2E7O A;  5CFW A;  5DFD A;  4YYG A;  5E9L A;  5EWC A;  4CFL A;  3UVX A;  5D3N A;  5BT4 A;  4QBM A;  3DWY A;  4IOQ A;  3AQA A;  3S91 A;  4CUU A;  4QSX A;  5DYU A;  4Z1S A;  3Q2F A;  4N4H A;  5KHM A;  4WIV A;  5EWH A;  4CUT A;  3VKH A;  4NUD A;  4ZC9 A;  5L97 A;  2I7K A;  3LXJ A;  5EPS A;  2F6N A;  5JI8 A;  4LR6 A;  1N72 A;  4J1P A;  4IR6 A;  4QST A;  4NXJ A;  5L8T A;  3U5K A;  1WUM A;  2DVS A;  5ENB A;  5E9I A;  4QB3 A;  5L98 A;  5LVR A;  4MR3 A;  5DY7 A;  4YYM A;  3UVY A;  5F3A A;  4YY6 A;  4HBW A;  4IR5 A;  2DKW A;  4UIU A;  5LKZ A;  4UIV A;  5HM0 A;  1EQF A;  2DVQ A;  4IOO A;  5I7X A;  5D3S A;  2LSP B;  4QSU A;  4HXP A;  4OGJ A;  3JVL A;  3QZT A;  3UV4 A;  3P5O A;  5FE4 A;  3UVD A;  4QZS A;  4A9K A;  5I29 A;  4IR3 A;  4QEV A;  4IOR A;  5C85 A;  4HXK A;  5F36 A;  3MB4 A;  2OUO A;  5DW1 A;  3RCW A;  5FE7 A;  5LKT A;  4N4I A;  4Z6H A;  5EU1 A;  5CUD A;  5D3P A;  5HFR A;  3K2J A;  5ENC A;  4QR5 A;  4YYD A;  4QSV A;  4YBS A;  3MUL A;  5EWD A;  5F5Z A;  5CRZ A;  4HXS A;  3D1B A;  5AME A;  5EM3 A;  5EV9 A;  2D82 A;  5A7C A;  4QEW A;  4FLP A;  5HFQ A;  2I8N A;  4NQN A;  5H85 A;  5KU3 A;  5CS8 A;  5D3R A;  3JVJ A;  5EWW A;  5FFV A;  5C8G A;  2YW5 A;  3MXF A;  5FDZ A;  5LKX A;  4YYI A;  5CQ3 A;  4UYD A;  5HEL A;  5DKH A;  1JM4 B;  5H1T A;  2WP2 A;  4QR4 A;  4N3W A;  4QUT A;  4YBM A;  4QSS A;  5A82 A;  5BT5 A;  3P1E A;  2RNW A;  5I40 A;  2RI7 A;  1ZS5 A;  4NR4 A;  4Q0O A;  5A5S A;  4Z6I A;  5LVQ A;  3HME A;  4MEO A;  5A5Q A;  4N4G A;  5EPR A;  4A9O A;  5DYX A;  4IR4 A;  3I3J A;  5E3D A;  4NRA A;  4J0S A;  3P1D A;  4A9J A;  3ONI A;  5F63 A;  3U5O A;  4BHW A;  4NR7 A;  3DAI A;  5D24 A;  4A9M A;  4CLB A;  4TU4 A;  5CGP A;  2YYN A;  4XUA A;  5C87 A;  5F61 A;  5TCM A;  4YC9 A;  5FG4 A;  4NR9 A;  5A5P A;  4A9H A;  5FE3 A;  5A85 A;  5C89 A;  4PKL A;  5C4Q A;  5ENH A;  5EIS A;  2GRC A;  4MEN A;  5CUB A;  5FE9 A;  4LZS A;  5CUA A;  4YBT A;  4XUB A;  4LYS A;  5CZG A;  4A9N A;  5HRX A;  5D3L A;  3LQH A;  3UV2 A;  4TQN A;  3IU6 A;  4QYL A;  4A9F A;  5EVA A;  5F1H A;  5LJ2 A;  4NYW A;  4ALH A;  5CQ4 A;  4E96 A;  4YAD A;  4MR4 A;  1WUG A;  4O7B A;  5E3G A;  3S92 A;  4A9L A;  5CQ8 A;  4HBV A;  5DFB A;  5FG6 A;  4RVR A;  5DKD A;  4YH4 A;  3Q2E A;  4ZQL A;  3P1F A;  5A5O A;  5D0C A;  4LZR A;  5EGU A;  4O70 A;  3MUK A;  4PS5 A;  3SVG A;  4C66 A;  5HCL A;  4PTB A;  5IID A;  3G0J A;  4CFK A;  4XY9 A;  2DVV A;  2YEL A;  4TZ2 A;  3UW9 A;  2L5E A;  2DVR A;  5LKU A;  2RNY A;  5J0D A;  5DYC A;  2DWW A;  4QEU A;  4NRC A;  2NXB A;  3QZS A;  5EIC A;  3ZYU A;  4TZ8 A;  3FKM X;  2MJV B;  5KTW A;  5ETB A;  5HLS A;  2RFJ A;  1ZKR A;  4MR6 A;  3HMF A;  5L96 A;  5H1U A;  4QC3 A;  4O78 A;  3D1D A;  5CY9 A;  2YEM A;  5CU8 A;  5KTU A;  3UV5 A;  4O72 A;  5I89 A;  1X0J A;  4TYL A;  4UIZ A;  4NR5 A;  4LYI A;  4Z1Q A;  5I7Y A;  4O7F A;  5CQ5 A;  4MR5 A;  4PY6 A;  5K29 A;  5A5N A;  3D7C A;  2E7N A;  2RS9 B;  5EA1 A;  4J0R A;  5IGN A;  4UIT A;  4YYK A;  5FE5 A;  3LQJ A;  4KV4 A;  4O7E A;  4OGI A;  5IGL A;  4NUC A;  2H60 A;  4TU6 A;  5ENG A;  3O34 A;  5CUC A;  4YYJ A;  4YY4 A;  4YH3 A;  5IG6 A;  4HBY A;  5IGK A;  5I1Q A;  4BW3 A;  2D9E A;  4YK0 A;  4TS8 A;  4Q0N A;  4AI6 A;  4LYW A;  4C67 A;  5FB1 A;  4BJX A;  5H1V A;  5EPB A;  4HXL A;  2OO1 A;  5I83 A;  4TTE A;  4QUU A;  4HXN A;  4UIW A;  5IGM A;  2L85 A;  2R0V A;  4HXR A;  5LUU A;  4YAB A;  5AMF A;  4O74 A;  4O7C A;  1E6I A;  4PCE A;  5DYA A;  5HQ5 A;  4ALG A;  4HXM A;  5I86 A;  4GPJ A;  5ENF A;  4LRG A;  5E9V A;  5FE1 A;  4TT2 A;  5DX4 A;  5IBN A;  4UYF B;  3MB3 A;  5AD2 A;  5I88 A;  5BT3 A;  4QSQ A;  5LJ1 A;  5A83 A;  4BW4 A;  4YYH A;  5E73 A;  4NUE A;  5D7X A;  5ENE A;  4MEP A;  4AKH A;  5LJ0 A;  5D3J A;  5FE2 A;  5EK9 A;  3U5N A;  3MQM A;  5CQA A;  5FH8 A;  5G4S A;  4A9I A;  5DFC A;  5FH6 A;  4NR6 A;  5E7D A;  5FB0 A;  5D25 A;  2DAT A;  5DLZ A;  4YAT A;  4TT4 A;  5E9Y A;  5CRM A;  5C7N A;  3U5J A;  3U5P A;  2E3K A;  3IU5 A;  3U5M A;  5F1L A;  4LC2 A;  4O75 A;  3O33 A;  4NYX A;  5F62 A;  4WHU A;  3JVM A;  4TT6 A;  2FSA A;  4UIY A;  4KV1 A;  4N4F A;  4ZW1 A;  4YYN A;  2RNX A;  2WP1 A;  4DON A;  4AKG A;  4NS5 A;  4F3I A;  3JVK A;  3NXB A;  3TLP A;  5E74 A;  3SVF A;  4Y03 A;  4UIX A;  4CUR A;  3LJW A;  4LDF A;  3U5L A;  5FG5 A;  5FFY A;  4Z93 A;  4CL9 A;  2YEK A;  4O77 A;  4CUP A;  5A81 A;  4MEQ A;  4KCX A;  4UYG A;  4HXO A;  2YDW A;  3VKG A;  4UYH A;  2N9G A;  2OSS A;  4QNS A;  1F68 A;  4AKN A;  4UYF A;  5DKC A;  4WHW A;  5AD3 A;  5CTL A;  2R0Y A;  5A5R A;  4QSW A;  5II2 A;  5DLX A;  5CQ6 A;  3G0L A;  2F6J A;  5CPE A;  5E9M A;  1PUO A;  4QSP A;  4X2I A;  5TB6 A;  4OUF A;  4NYV A;  5ENJ A;  5ETD A;  4J3I A;  4NQM A;  5HJC A;  5HQ6 A;  5KO4 A;  5JWM A;  5KTX A;  4UYE A;  5ACY A;  3HMH A;  3P1C A;  2KTB B;  5FFW A;  5EQ1 A;  5HEM A;  5G4R A;  5HEN A;  4LZ2 A;  4CUQ A;  5DW2 A;  5ENI A;  5HQ7 A;  5D26 A;  5F25 A;  2RO1 A;  5HRW A;  4O7A A;  4BW1 A;  5DBM A;  4O76 A;  4XY8 A;  5FE8 A;  4NR8 A;  5CP5 A;  2R0S A;  5II1 A;  5HRV A;  5COI A;  4QYD A;  4QY4 A;  1JSP B;  3O35 A;  3SVH A;  4YAX A;  5I80 A;  5EI4 A;  5CQ7 A;  5FE6 A;  4AKI A;  5D3T A;  2R10 A;  4O71 A;  5CUE A;  4QR3 A;  4XYA A;  5FE0 A;  5EP7 A;  5E0R A;  4PCI A;  5CQT A;  5L99 A;  5FBX A;  5L8U A;  3O37 A; 
#chains in the Genus database with same CATH homology
 2YQD A;  5FH7 A;  5CUG A;  4BW2 A;  3AAD A;  4HBX A;  4CUS A;  3GG3 A;  4QC1 A;  5F60 A;  3O36 A;  5EWV A;  3LQI A;  5E9K A;  3QZV A;  5D3H A;  4NRB A;  5F2P A;  3UVW A;  2G4A A;  4A9E A;  4QSR A;  2L84 A;  2E7O A;  5CFW A;  5DFD A;  4YYG A;  5E9L A;  5EWC A;  4CFL A;  3UVX A;  5D3N A;  5BT4 A;  4QBM A;  3DWY A;  4IOQ A;  3AQA A;  3S91 A;  4CUU A;  4QSX A;  5DYU A;  4Z1S A;  3Q2F A;  4N4H A;  5KHM A;  4WIV A;  5EWH A;  4CUT A;  4NUD A;  4ZC9 A;  5L97 A;  2I7K A;  3LXJ A;  5EPS A;  2F6N A;  5JI8 A;  4LR6 A;  1N72 A;  4J1P A;  4IR6 A;  4QST A;  4NXJ A;  5L8T A;  3U5K A;  1WUM A;  2DVS A;  5ENB A;  5E9I A;  4QB3 A;  5L98 A;  5LVR A;  4MR3 A;  5DY7 A;  4YYM A;  3UVY A;  5F3A A;  4YY6 A;  4HBW A;  4IR5 A;  2DKW A;  4UIU A;  5LKZ A;  4UIV A;  5HM0 A;  1EQF A;  2DVQ A;  4IOO A;  5I7X A;  5D3S A;  2LSP B;  4QSU A;  4HXP A;  4OGJ A;  3JVL A;  3QZT A;  3UV4 A;  3P5O A;  5FE4 A;  3UVD A;  4QZS A;  4A9K A;  5I29 A;  4IR3 A;  4QEV A;  4IOR A;  5C85 A;  4HXK A;  5F36 A;  3MB4 A;  2OUO A;  5DW1 A;  3RCW A;  5FE7 A;  5LKT A;  4N4I A;  4Z6H A;  5EU1 A;  5CUD A;  5D3P A;  5HFR A;  3K2J A;  5ENC A;  4QR5 A;  4YYD A;  4QSV A;  4YBS A;  3MUL A;  5EWD A;  5F5Z A;  5CRZ A;  4HXS A;  5AME A;  5EM3 A;  5EV9 A;  2D82 A;  5A7C A;  4QEW A;  4FLP A;  5HFQ A;  2I8N A;  4NQN A;  5H85 A;  5KU3 A;  5CS8 A;  5D3R A;  3JVJ A;  5EWW A;  5FFV A;  5C8G A;  2YW5 A;  3MXF A;  5FDZ A;  5LKX A;  4YYI A;  5CQ3 A;  4UYD A;  5HEL A;  5DKH A;  1JM4 B;  5H1T A;  2WP2 A;  4QR4 A;  4N3W A;  4QUT A;  4YBM A;  4QSS A;  5A82 A;  5BT5 A;  3P1E A;  2RNW A;  5I40 A;  2RI7 A;  1ZS5 A;  4NR4 A;  4Q0O A;  5A5S A;  4Z6I A;  5LVQ A;  3HME A;  4MEO A;  5A5Q A;  4N4G A;  5EPR A;  4A9O A;  5DYX A;  4IR4 A;  3I3J A;  5E3D A;  4NRA A;  4J0S A;  3P1D A;  4A9J A;  3ONI A;  5F63 A;  3U5O A;  4BHW A;  4NR7 A;  3DAI A;  5D24 A;  4A9M A;  4CLB A;  4TU4 A;  5CGP A;  2YYN A;  4XUA A;  5C87 A;  5F61 A;  5TCM A;  4YC9 A;  5FG4 A;  4NR9 A;  5A5P A;  4A9H A;  5FE3 A;  5A85 A;  5C89 A;  4PKL A;  5C4Q A;  5ENH A;  5EIS A;  2GRC A;  4MEN A;  5CUB A;  5FE9 A;  4LZS A;  5CUA A;  4YBT A;  4XUB A;  4LYS A;  5CZG A;  4A9N A;  5HRX A;  5D3L A;  3LQH A;  3UV2 A;  4TQN A;  3IU6 A;  4QYL A;  4A9F A;  5EVA A;  5F1H A;  5LJ2 A;  4NYW A;  4ALH A;  5CQ4 A;  4E96 A;  4YAD A;  4MR4 A;  1WUG A;  4O7B A;  5E3G A;  3S92 A;  4A9L A;  5CQ8 A;  4HBV A;  5DFB A;  5FG6 A;  4RVR A;  5DKD A;  4YH4 A;  3Q2E A;  4ZQL A;  3P1F A;  5A5O A;  5D0C A;  4LZR A;  5EGU A;  4O70 A;  3MUK A;  4PS5 A;  3SVG A;  4C66 A;  5HCL A;  4PTB A;  5IID A;  3G0J A;  4CFK A;  4XY9 A;  2DVV A;  2YEL A;  4TZ2 A;  3UW9 A;  2L5E A;  2DVR A;  5LKU A;  2RNY A;  5J0D A;  5DYC A;  2DWW A;  4QEU A;  4NRC A;  2NXB A;  3QZS A;  5EIC A;  3ZYU A;  4TZ8 A;  3FKM X;  2MJV B;  5KTW A;  5ETB A;  5HLS A;  2RFJ A;  4MR6 A;  3HMF A;  5L96 A;  5H1U A;  4QC3 A;  4O78 A;  5CY9 A;  2YEM A;  5CU8 A;  5KTU A;  3UV5 A;  4O72 A;  5I89 A;  1X0J A;  4TYL A;  4UIZ A;  4NR5 A;  4LYI A;  4Z1Q A;  5I7Y A;  4O7F A;  5CQ5 A;  4MR5 A;  4PY6 A;  5K29 A;  5A5N A;  3D7C A;  2E7N A;  2RS9 B;  5EA1 A;  4J0R A;  5IGN A;  4UIT A;  4YYK A;  5FE5 A;  3LQJ A;  4KV4 A;  4O7E A;  4OGI A;  5IGL A;  4NUC A;  2H60 A;  4TU6 A;  5ENG A;  3O34 A;  5CUC A;  4YYJ A;  4YY4 A;  4YH3 A;  5IG6 A;  4HBY A;  5IGK A;  5I1Q A;  4BW3 A;  2D9E A;  4YK0 A;  4TS8 A;  4Q0N A;  4LYW A;  4C67 A;  5FB1 A;  4BJX A;  5H1V A;  5EPB A;  4HXL A;  2OO1 A;  5I83 A;  4TTE A;  4QUU A;  4HXN A;  4UIW A;  5IGM A;  2L85 A;  2R0V A;  4HXR A;  5LUU A;  4YAB A;  5AMF A;  4O74 A;  4O7C A;  1E6I A;  4PCE A;  5DYA A;  5HQ5 A;  4ALG A;  4HXM A;  5I86 A;  4GPJ A;  5ENF A;  4LRG A;  5E9V A;  5FE1 A;  4TT2 A;  5DX4 A;  5IBN A;  4UYF B;  3MB3 A;  5AD2 A;  5I88 A;  5BT3 A;  4QSQ A;  5LJ1 A;  5A83 A;  4BW4 A;  4YYH A;  5E73 A;  4NUE A;  5D7X A;  5ENE A;  4MEP A;  5LJ0 A;  5D3J A;  5FE2 A;  5EK9 A;  3U5N A;  3MQM A;  5CQA A;  5FH8 A;  5G4S A;  4A9I A;  5DFC A;  5FH6 A;  4NR6 A;  5E7D A;  5FB0 A;  5D25 A;  2DAT A;  5DLZ A;  4YAT A;  4TT4 A;  5E9Y A;  5CRM A;  5C7N A;  3U5J A;  3U5P A;  2E3K A;  3IU5 A;  3U5M A;  5F1L A;  4LC2 A;  4O75 A;  3O33 A;  4NYX A;  5F62 A;  4WHU A;  3JVM A;  4TT6 A;  2FSA A;  4UIY A;  4KV1 A;  4N4F A;  4ZW1 A;  4YYN A;  2RNX A;  2WP1 A;  4DON A;  4NS5 A;  4F3I A;  3JVK A;  3NXB A;  3TLP A;  5E74 A;  3SVF A;  4Y03 A;  4UIX A;  4CUR A;  3LJW A;  4LDF A;  3U5L A;  5FG5 A;  5FFY A;  4Z93 A;  4CL9 A;  2YEK A;  4O77 A;  4CUP A;  5A81 A;  4MEQ A;  4KCX A;  4UYG A;  4HXO A;  2YDW A;  4UYH A;  2N9G A;  2OSS A;  4QNS A;  1F68 A;  4AKN A;  4UYF A;  5DKC A;  4WHW A;  5AD3 A;  5CTL A;  2R0Y A;  5A5R A;  4QSW A;  5II2 A;  5DLX A;  5CQ6 A;  3G0L A;  2F6J A;  5CPE A;  5E9M A;  4QSP A;  4X2I A;  5TB6 A;  4OUF A;  4NYV A;  5ENJ A;  5ETD A;  4J3I A;  4NQM A;  5HJC A;  5HQ6 A;  5KO4 A;  5JWM A;  5KTX A;  4UYE A;  5ACY A;  3HMH A;  3P1C A;  2KTB B;  5FFW A;  5EQ1 A;  5HEM A;  5G4R A;  5HEN A;  4LZ2 A;  4CUQ A;  5DW2 A;  5ENI A;  5HQ7 A;  5D26 A;  5F25 A;  2RO1 A;  5HRW A;  4O7A A;  4BW1 A;  5DBM A;  4O76 A;  4XY8 A;  5FE8 A;  4NR8 A;  5CP5 A;  2R0S A;  5II1 A;  5HRV A;  5COI A;  4QYD A;  4QY4 A;  1JSP B;  3O35 A;  3SVH A;  4YAX A;  5I80 A;  5EI4 A;  5CQ7 A;  5FE6 A;  5D3T A;  2R10 A;  4O71 A;  5CUE A;  4QR3 A;  4XYA A;  5FE0 A;  5EP7 A;  5E0R A;  4PCI A;  5CQT A;  5L99 A;  5FBX A;  5L8U A;  3O37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...