4QUTA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) complexed with histone h4-k(ac)12
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ATPase family AAA domain-containing protein 2
publication title Atad2 is a generalist facilitator of chromatin dynamics in embryonic stem cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qutA00
4CURA 2I8NA 5DLZA 5FG4A 3DAIA 4A9MA 5F1HA 3NXBA 3UV5A 4NRCA 4UYGA 5LVQA 5DYCA 5HFRA 1N72A 3AADA 4N4FA 4QEVA 4Q0OA 2MJVB 3LQIA 4NR5A 4C67A 5EISA 4WHUA 5H1UA 4J1PA 5ENFA 4TT6A 5EU1A 3MULA 1JSPB 2DKWA 4MR6A 5CFWA 5DKDA 3U5OA 4YH3A 5IIDA 5DLXA 4MEQA 4LR6A 4CUQA 4YYIA 4NR4A 4NYXA 4HBXA 4O78A 4QSPA 5F1LA 4TU4A 4O7AA 2OO1A 5CTLA 5II2A 5II1A 4UYHA 5C89A 5C8GA 4QR5A 3MXFA 2GRCA 4HBVA 5COIA 5JI8A 2OUOA 5A5RA 4ALHA 5D3PA 4YYMA 4O71A 5I86A 4PKLA 5DFCA 2YEKA 5IG6A 2L5EA 4YBSA 4NUEA 5L8TA 4IR6A 3D7CA 5CQ6A 5H85A 3RCWA 5ENHA 4Y03A 3I3JA 2R10A 4CUTA 5CUCA 5G4SA 5CQ3A 5EPSA 5F5ZA 5A5NA 4YK0A 5CRMA 4YC9A 5HQ5A 4NRBA 3UV4A 5EWHA 5A5PA 3S92A 3U5NA 5D3HA 5E73A 2LSPB 4HXNA 2I7KA 4OGJA 5CUBA 4NS5A 2D9EA 4QYDA 5ENBA 5EWDA 4LZ2A 3SVHA 5I7YA 5HFQA 4FLPA 3SVFA 5LJ0A 3QZTA 5CRZA 2RS9B 4PCEA 5HELA 5FE5A 4LYIA 4UYEA 5CP5A 5D24A 4QEUA 5FH6A 5EA1A 5F62A 5C7NA 4QY4A 4HXOA 5CY9A 4CUSA 3UV2A 5E9MA 5TCMA 5A5QA 5E0RA 4A9NA 4C66A 1EQFA 4J0SA 3O34A 3QZSA 2WP1A 5HQ6A 5FE6A 4QC3A 2F6NA 5ENIA 5FE2A 5FB1A 5I1QA 4TYLA 4F3IA 5KTWA 4IOOA 5BT5A 4O7EA 5E7DA 3O35A 5IGKA 3ZYUA 5LKXA 4QNSA 4XUBA 4PS5A 4ZQLA 5CQ5A 5L96A 4UITA 5F61A 4YYNA 5AD2A 4YYDA 3JVMA 2H60A 4J3IA 4TS8A 2YELA 5D25A 2FSAA 3P1DA 5HENA 3JVKA 4Q0NA 4A9KA 5I83A 5HLSA 3U5JA 4IORA 2R0YA 5D3SA 5CUDA 4YBMA 5I89A 5L97A 5ENJA 4NRAA 5F36A 5LUUA 5EPBA 5EWWA 5BT4A 5TB6A 3GG3A 5EICA 4PY6A 4NR6A 2F6JA 5EI4A 2YQDA 4AKNA 4QB3A 5A7CA 4J0RA 5ETBA 3P5OA 3TLPA 4NR7A 5FDZA 4QSRA 5FG5A 5CZGA 4MR3A 5KU3A 5FE4A 3MB4A 4HXPA 5FFVA 4ZC9A 4QZSA 4KCXA 4Z6HA 5D3LA 5H1TA 3UW9A 5DYUA 2YEMA 5ACYA 1F68A 5FBXA 5I88A 2DVSA 4KV4A 2KTBB 1WUGA 4QUTA 5CUGA 4YATA 5LKTA 4HBYA 3S91A 2RO1A 5E3DA 4IR4A 4N4GA 4IR3A 3K2JA 5F25A 5BT3A 5DBMA 5I80A 5D3JA 3LQHA 4LYWA 4RVRA 4UIZA 4UIWA 3JVLA 4HXSA 4YADA 4O76A 2DWWA 5ENCA 4Z1QA 4MEOA 5FE7A 4X2IA 4OUFA 3LXJA 5DFBA 5CU8A 5D7XA 4A9JA 5CQTA 5HEMA 1JM4B 5D0CA 3SVGA 3U5LA 4MEPA 4CFLA 4BW3A 5CUEA 1X0JA 4A9OA 4TQNA 5FH7A 4QYLA 5FE9A 2NXBA 3U5PA 4YYKA 5L8UA 3G0LA 3DWYA 2L85A 4O72A 4QSTA 2DVQA 4UYFB 3U5KA 1WUMA 4YYGA 4N3WA 5DX4A 2RI7A 5A83A 5C4QA 4UYDA 4QSSA 5CQ8A 4BW4A 5D26A 4HBWA 5KO4A 5K29A 1ZS5A 4YYHA 5E9IA 4WHWA 4NQMA 5CPEA 3FKMX 3HMEA 2E3KA 4LRGA 3UVYA 5LVRA 5A82A 4CUUA 3UVDA 4A9IA 5D3TA 3P1CA 3ONIA 5EP7A 4HXKA 4CUPA 2E7OA 4HXMA 5HRVA 5CS8A 4A9FA 5FH8A 5HJCA 4XUAA 5DW2A 5F3AA 4QSQA 2D82A 5DYAA 5EWCA 4UIYA 4Z93A 4O7CA 4UIXA 4NUDA 5D3NA 3MUKA 4O75A 4CFKA 5G4RA 5H1VA 5AMEA 3LQJA 3JVJA 4YABA 3O37A 2DATA 4N4HA 5HQ7A 3HMFA 4PCIA 5CQ4A 4TU6A 5FE1A 5EK9A 5CGPA 5EPRA 2N9GA 4TT4A 4YAXA 5LJ1A 4TZ8A 5FE8A 5CQ7A 5EVAA 5FFYA 4E96A 5D3RA 5DKHA 5E9VA 2YW5A 5LKUA 4O7FA 4XY9A 5J0DA 4A9HA 4CL9A 5F60A 5KHMA 3UVWA 5IGLA 4QSVA 3IU5A 4ZW1A 5IBNA 4LC2A 4KV1A 4YY4A 5FB0A 5L98A 4YY6A 5KTUA 5ENGA 4XY8A 4NYVA 4NR8A 4O70A 2OSSA 4NR9A 4Z6IA 3IU6A 5A81A 4NQNA 4QR3A 2WP2A 5EQ1A 4IR5A 4LDFA 4NXJA 3U5MA 5LKZA 5IGNA 2DVVA 5DW1A 5JWMA 4XYAA 4QC1A 5E74A 3O36A 5I40A 5E9YA 5F63A 5EV9A 2G4AA 2RNXA 5FE0A 5IGMA 4QR4A 4PTBA 5HM0A 5AD3A 4QBMA 3MB3A 4UIVA 4OGIA 3O33A 5L99A 4MR4A 4DONA 3P1EA 4MR5A 5DKCA 5KTXA 5AMFA 2R0VA 3AQAA 4QUUA 4LZSA 4NYWA 5CUAA 4O77A 4WIVA 3Q2EA 5C85A 5F2PA 4HXRA 3HMHA 3MQMA 3Q2FA 4NUCA 4MENA 2RNWA 4Z1SA 5DYXA 5E3GA 4BW2A 4QSUA 5E9LA 4A9LA 2RFJA 2DVRA 5A5SA 4TT2A 5CQAA 5A5OA 2YYNA 4CLBA 5EGUA 4QEWA 5EM3A 4UYFA 5HCLA 3LJWA 4O74A 4GPJA 4QSXA 3P1FA 5FE3A 3UVXA 5C87A 5EWVA 4BHWA 5I29A 4BJXA 1E6IA 2YDWA 4YBTA 5I7XA 4UIUA 4A9EA 4TTEA 5ETDA 4N4IA 5LJ2A 4HXLA 4O7BA 4IOQA 4QSWA 5A85A 5E9KA 4YYJA 4TZ2A 2L84A 5DFDA 5HRWA 2R0SA 4LYSA 2E7NA 4ALGA 4BW1A 5HRXA 2RNYA 3QZVA 5FG6A 4LZRA 3G0JA 5ENEA 5DY7A 4YH4A 5FFWA
chains in the Genus database with same CATH superfamily
4CURA 2I8NA 5DLZA 5FG4A 3DAIA 4A9MA 5F1HA 3NXBA 3UV5A 4NRCA 4UYGA 5LVQA 5DYCA 5HFRA 1N72A 3AADA 4N4FA 4QEVA 4Q0OA 2MJVB 3LQIA 4NR5A 4C67A 5EISA 4AKGA 4WHUA 5H1UA 4J1PA 5ENFA 4TT6A 5EU1A 3MULA 1JSPB 2DKWA 4MR6A 5CFWA 5DKDA 3U5OA 4YH3A 5IIDA 5DLXA 4MEQA 4LR6A 4CUQA 4YYIA 4NR4A 4NYXA 4HBXA 4O78A 4QSPA 5F1LA 4TU4A 4O7AA 2OO1A 5CTLA 5II2A 5II1A 4UYHA 5C89A 5C8GA 4QR5A 3MXFA 2GRCA 4HBVA 5COIA 5JI8A 2OUOA 5A5RA 4ALHA 5D3PA 4YYMA 4O71A 5I86A 4PKLA 5DFCA 2YEKA 5IG6A 2L5EA 4YBSA 4NUEA 5L8TA 4IR6A 3D7CA 5CQ6A 5H85A 3RCWA 5ENHA 4Y03A 3I3JA 2R10A 4CUTA 5CUCA 5G4SA 5CQ3A 5EPSA 5F5ZA 5A5NA 4YK0A 5CRMA 4YC9A 5HQ5A 4NRBA 3UV4A 5EWHA 5A5PA 3S92A 3U5NA 5D3HA 5E73A 2LSPB 4HXNA 2I7KA 4OGJA 5CUBA 4NS5A 2D9EA 4QYDA 5ENBA 5EWDA 4LZ2A 3SVHA 5I7YA 5HFQA 3D1BA 4FLPA 3SVFA 5LJ0A 3QZTA 5CRZA 2RS9B 4PCEA 5HELA 5FE5A 4LYIA 4UYEA 5CP5A 5D24A 4QEUA 5FH6A 5EA1A 5F62A 5C7NA 4QY4A 4HXOA 5CY9A 4CUSA 3UV2A 5E9MA 5TCMA 5A5QA 5E0RA 4A9NA 4C66A 1EQFA 4J0SA 3O34A 3QZSA 2WP1A 5HQ6A 5FE6A 4QC3A 2F6NA 5ENIA 5FE2A 5FB1A 5I1QA 4TYLA 4F3IA 5KTWA 4IOOA 5BT5A 4O7EA 5E7DA 3O35A 5IGKA 3ZYUA 5LKXA 4QNSA 4XUBA 4PS5A 4ZQLA 5CQ5A 5L96A 4UITA 5F61A 4YYNA 5AD2A 4YYDA 3JVMA 2H60A 4J3IA 4TS8A 2YELA 5D25A 2FSAA 3P1DA 5HENA 3JVKA 4Q0NA 4A9KA 5I83A 5HLSA 3U5JA 4IORA 2R0YA 5D3SA 5CUDA 4YBMA 5I89A 5L97A 5ENJA 4NRAA 5F36A 5LUUA 5EPBA 1ZKRA 5EWWA 5BT4A 5TB6A 3GG3A 5EICA 4PY6A 4NR6A 2F6JA 5EI4A 2YQDA 4AKNA 4QB3A 5A7CA 4J0RA 5ETBA 3P5OA 3TLPA 4NR7A 4AKHA 5FDZA 4QSRA 5FG5A 5CZGA 4MR3A 5KU3A 5FE4A 3MB4A 4HXPA 5FFVA 4ZC9A 4QZSA 4KCXA 4Z6HA 5D3LA 5H1TA 3UW9A 5DYUA 2YEMA 5ACYA 1F68A 5FBXA 5I88A 2DVSA 4KV4A 2KTBB 1WUGA 4QUTA 5CUGA 4YATA 5LKTA 4HBYA 3S91A 2RO1A 5E3DA 4IR4A 4N4GA 4IR3A 3K2JA 5F25A 5BT3A 5DBMA 5I80A 5D3JA 3LQHA 4LYWA 4RVRA 4UIZA 4UIWA 3JVLA 4HXSA 4YADA 4O76A 2DWWA 5ENCA 4Z1QA 4MEOA 5FE7A 4X2IA 4OUFA 3LXJA 5DFBA 5CU8A 5D7XA 4A9JA 5CQTA 5HEMA 1JM4B 5D0CA 3SVGA 3U5LA 4MEPA 4CFLA 4BW3A 5CUEA 1X0JA 4A9OA 4TQNA 5FH7A 4QYLA 5FE9A 2NXBA 3U5PA 4YYKA 5L8UA 3G0LA 3DWYA 2L85A 4O72A 4QSTA 2DVQA 4UYFB 3U5KA 1WUMA 4YYGA 4N3WA 5DX4A 2RI7A 5A83A 5C4QA 4UYDA 4QSSA 5CQ8A 4BW4A 2EJNA 5D26A 4HBWA 5KO4A 5K29A 1ZS5A 4YYHA 5E9IA 4WHWA 4NQMA 5CPEA 3FKMX 3HMEA 2E3KA 4LRGA 3UVYA 5LVRA 5A82A 4CUUA 3UVDA 4A9IA 5D3TA 3P1CA 3ONIA 5EP7A 4HXKA 4CUPA 2E7OA 4HXMA 5HRVA 5CS8A 4A9FA 5FH8A 5HJCA 4XUAA 5DW2A 5F3AA 4QSQA 2D82A 5DYAA 5EWCA 4UIYA 4Z93A 4O7CA 4UIXA 4NUDA 5D3NA 3MUKA 4O75A 4CFKA 5G4RA 5H1VA 5AMEA 3LQJA 3JVJA 4YABA 4AKIA 3O37A 2DATA 4N4HA 5HQ7A 3HMFA 4PCIA 5CQ4A 4TU6A 5FE1A 5EK9A 5CGPA 5EPRA 2N9GA 4TT4A 4YAXA 5LJ1A 4TZ8A 5FE8A 5CQ7A 5EVAA 5FFYA 4E96A 5D3RA 5DKHA 5E9VA 2YW5A 5LKUA 4O7FA 4XY9A 1PUOA 5J0DA 4A9HA 4CL9A 5F60A 5KHMA 3UVWA 5IGLA 4QSVA 3IU5A 4ZW1A 5IBNA 4LC2A 4KV1A 4YY4A 5FB0A 5L98A 4YY6A 5KTUA 5ENGA 4XY8A 4NYVA 4NR8A 4O70A 4AI6A 2OSSA 4NR9A 4Z6IA 3IU6A 5A81A 4NQNA 3ERRA 4QR3A 2WP2A 5EQ1A 4IR5A 4LDFA 4NXJA 3U5MA 5LKZA 5IGNA 2DVVA 5DW1A 5JWMA 4XYAA 4QC1A 5E74A 3O36A 5I40A 5E9YA 5F63A 5EV9A 2G4AA 2RNXA 5FE0A 5IGMA 4QR4A 4PTBA 5HM0A 5AD3A 4QBMA 3MB3A 4UIVA 4OGIA 3O33A 5L99A 4MR4A 4DONA 3P1EA 4MR5A 5DKCA 5KTXA 5AMFA 2R0VA 3AQAA 4QUUA 4LZSA 4NYWA 5CUAA 4O77A 4WIVA 3Q2EA 5C85A 5F2PA 4HXRA 3HMHA 3MQMA 3Q2FA 4NUCA 4MENA 2RNWA 4Z1SA 5DYXA 5E3GA 4BW2A 4QSUA 5E9LA 4A9LA 2RFJA 2DVRA 5A5SA 4TT2A 5CQAA 5A5OA 2YYNA 4CLBA 5EGUA 4QEWA 5EM3A 4UYFA 5HCLA 3LJWA 4O74A 4GPJA 4QSXA 3P1FA 5FE3A 3UVXA 5C87A 5EWVA 4BHWA 5I29A 4BJXA 3VKGA 1E6IA 2YDWA 4YBTA 5I7XA 4UIUA 4A9EA 4TTEA 5ETDA 4N4IA 5LJ2A 4HXLA 4O7BA 4IOQA 4QSWA 5A85A 5E9KA 4YYJA 4TZ2A 2L84A 5DFDA 5HRWA 2R0SA 4LYSA 2E7NA 4ALGA 4BW1A 5HRXA 2RNYA 3QZVA 5FG6A 3D1DA 4LZRA 3G0JA 3VKHA 5ENEA 5DY7A 4YH4A 5FFWA
chains in the Genus database with same CATH topology
4CURA 2I8NA 5DLZA 5FG4A 3DAIA 4A9MA 5F1HA 3NXBA 3UV5A 4NRCA 4UYGA 5LVQA 5DYCA 5HFRA 1N72A 3AADA 4N4FA 4QEVA 4Q0OA 2MJVB 3LQIA 4NR5A 4C67A 5EISA 4WHUA 5H1UA 4J1PA 5ENFA 4TT6A 5EU1A 3MULA 1JSPB 2DKWA 4MR6A 5CFWA 5DKDA 3U5OA 4YH3A 5IIDA 5DLXA 4MEQA 4LR6A 4CUQA 4YYIA 4NR4A 4NYXA 4HBXA 4O78A 4QSPA 5F1LA 4TU4A 4O7AA 2OO1A 5CTLA 5II2A 5II1A 4UYHA 5C89A 5C8GA 4QR5A 3MXFA 2GRCA 4HBVA 5COIA 5JI8A 2OUOA 5A5RA 4ALHA 5D3PA 4YYMA 4O71A 5I86A 4PKLA 5DFCA 2YEKA 5IG6A 2L5EA 4YBSA 4NUEA 5L8TA 4IR6A 3D7CA 5CQ6A 5H85A 3RCWA 5ENHA 4Y03A 3I3JA 2R10A 4CUTA 5CUCA 5G4SA 5CQ3A 5EPSA 5F5ZA 5A5NA 4YK0A 5CRMA 4YC9A 5HQ5A 4NRBA 3UV4A 5EWHA 5A5PA 3S92A 3U5NA 5D3HA 5E73A 2LSPB 4HXNA 2I7KA 4OGJA 5CUBA 4NS5A 2D9EA 4QYDA 5ENBA 5EWDA 4LZ2A 3SVHA 5I7YA 5HFQA 4FLPA 3SVFA 5LJ0A 3QZTA 5CRZA 2RS9B 4PCEA 5HELA 5FE5A 4LYIA 4UYEA 5CP5A 5D24A 4QEUA 5FH6A 5EA1A 5F62A 5C7NA 4QY4A 4HXOA 5CY9A 4CUSA 3UV2A 5E9MA 5TCMA 5A5QA 5E0RA 4A9NA 4C66A 1EQFA 4J0SA 3O34A 3QZSA 2WP1A 5HQ6A 5FE6A 4QC3A 2F6NA 5ENIA 5FE2A 5FB1A 5I1QA 4TYLA 4F3IA 5KTWA 4IOOA 5BT5A 4O7EA 5E7DA 3O35A 5IGKA 3ZYUA 5LKXA 4QNSA 4XUBA 4PS5A 4ZQLA 5CQ5A 5L96A 4UITA 5F61A 4YYNA 5AD2A 4YYDA 3JVMA 2H60A 4J3IA 4TS8A 2YELA 5D25A 2FSAA 3P1DA 5HENA 3JVKA 4Q0NA 4A9KA 5I83A 5HLSA 3U5JA 4IORA 2R0YA 5D3SA 5CUDA 4YBMA 5I89A 5L97A 5ENJA 4NRAA 5F36A 5LUUA 5EPBA 5EWWA 5BT4A 5TB6A 3GG3A 5EICA 4PY6A 4NR6A 2F6JA 5EI4A 2YQDA 4AKNA 4QB3A 5A7CA 4J0RA 5ETBA 3P5OA 3TLPA 4NR7A 5FDZA 4QSRA 5FG5A 5CZGA 4MR3A 5KU3A 5FE4A 3MB4A 4HXPA 5FFVA 4ZC9A 4QZSA 4KCXA 4Z6HA 5D3LA 5H1TA 3UW9A 5DYUA 2YEMA 5ACYA 1F68A 5FBXA 5I88A 2DVSA 4KV4A 2KTBB 1WUGA 4QUTA 5CUGA 4YATA 5LKTA 4HBYA 3S91A 2RO1A 5E3DA 4IR4A 4N4GA 4IR3A 3K2JA 5F25A 5BT3A 5DBMA 5I80A 5D3JA 3LQHA 4LYWA 4RVRA 4UIZA 4UIWA 3JVLA 4HXSA 4YADA 4O76A 2DWWA 5ENCA 4Z1QA 4MEOA 5FE7A 4X2IA 4OUFA 3LXJA 5DFBA 5CU8A 5D7XA 4A9JA 5CQTA 5HEMA 1JM4B 5D0CA 3SVGA 3U5LA 4MEPA 4CFLA 4BW3A 5CUEA 1X0JA 4A9OA 4TQNA 5FH7A 4QYLA 5FE9A 2NXBA 3U5PA 4YYKA 5L8UA 3G0LA 3DWYA 2L85A 4O72A 4QSTA 2DVQA 4UYFB 3U5KA 1WUMA 4YYGA 4N3WA 5DX4A 2RI7A 5A83A 5C4QA 4UYDA 4QSSA 5CQ8A 4BW4A 5D26A 4HBWA 5KO4A 5K29A 1ZS5A 4YYHA 5E9IA 4WHWA 4NQMA 5CPEA 3FKMX 3HMEA 2E3KA 4LRGA 3UVYA 5LVRA 5A82A 4CUUA 3UVDA 4A9IA 5D3TA 3P1CA 3ONIA 5EP7A 4HXKA 4CUPA 2E7OA 4HXMA 5HRVA 5CS8A 4A9FA 5FH8A 5HJCA 4XUAA 5DW2A 5F3AA 4QSQA 2D82A 5DYAA 5EWCA 4UIYA 4Z93A 4O7CA 4UIXA 4NUDA 5D3NA 3MUKA 4O75A 4CFKA 5G4RA 5H1VA 5AMEA 3LQJA 3JVJA 4YABA 3O37A 2DATA 4N4HA 5HQ7A 3HMFA 4PCIA 5CQ4A 4TU6A 5FE1A 5EK9A 5CGPA 5EPRA 2N9GA 4TT4A 4YAXA 5LJ1A 4TZ8A 5FE8A 5CQ7A 5EVAA 5FFYA 4E96A 5D3RA 5DKHA 5E9VA 2YW5A 5LKUA 4O7FA 4XY9A 5J0DA 4A9HA 4CL9A 5F60A 5KHMA 3UVWA 5IGLA 4QSVA 3IU5A 4ZW1A 5IBNA 4LC2A 4KV1A 4YY4A 5FB0A 5L98A 4YY6A 5KTUA 5ENGA 4XY8A 4NYVA 4NR8A 4O70A 2OSSA 4NR9A 4Z6IA 3IU6A 5A81A 4NQNA 4QR3A 2WP2A 5EQ1A 4IR5A 4LDFA 4NXJA 3U5MA 5LKZA 5IGNA 2DVVA 5DW1A 5JWMA 4XYAA 4QC1A 5E74A 3O36A 5I40A 5E9YA 5F63A 5EV9A 2G4AA 2RNXA 5FE0A 5IGMA 4QR4A 4PTBA 5HM0A 5AD3A 4QBMA 3MB3A 4UIVA 4OGIA 3O33A 5L99A 4MR4A 4DONA 3P1EA 4MR5A 5DKCA 5KTXA 5AMFA 2R0VA 3AQAA 4QUUA 4LZSA 4NYWA 5CUAA 4O77A 4WIVA 3Q2EA 5C85A 5F2PA 4HXRA 3HMHA 3MQMA 3Q2FA 4NUCA 4MENA 2RNWA 4Z1SA 5DYXA 5E3GA 4BW2A 4QSUA 5E9LA 4A9LA 2RFJA 2DVRA 5A5SA 4TT2A 5CQAA 5A5OA 2YYNA 4CLBA 5EGUA 4QEWA 5EM3A 4UYFA 5HCLA 3LJWA 4O74A 4GPJA 4QSXA 3P1FA 5FE3A 3UVXA 5C87A 5EWVA 4BHWA 5I29A 4BJXA 1E6IA 2YDWA 4YBTA 5I7XA 4UIUA 4A9EA 4TTEA 5ETDA 4N4IA 5LJ2A 4HXLA 4O7BA 4IOQA 4QSWA 5A85A 5E9KA 4YYJA 4TZ2A 2L84A 5DFDA 5HRWA 2R0SA 4LYSA 2E7NA 4ALGA 4BW1A 5HRXA 2RNYA 3QZVA 5FG6A 4LZRA 3G0JA 5ENEA 5DY7A 4YH4A 5FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUR A;  2I8N A;  5DLZ A;  5FG4 A;  3DAI A;  4A9M A;  5F1H A;  3NXB A;  3UV5 A;  4NRC A;  4UYG A;  5LVQ A;  5DYC A;  5HFR A;  1N72 A;  3AAD A;  4N4F A;  4QEV A;  4Q0O A;  2MJV B;  3LQI A;  4NR5 A;  4C67 A;  5EIS A;  4WHU A;  5H1U A;  4J1P A;  5ENF A;  4TT6 A;  5EU1 A;  3MUL A;  1JSP B;  2DKW A;  4MR6 A;  5CFW A;  5DKD A;  3U5O A;  4YH3 A;  5IID A;  5DLX A;  4MEQ A;  4LR6 A;  4CUQ A;  4YYI A;  4NR4 A;  4NYX A;  4HBX A;  4O78 A;  4QSP A;  5F1L A;  4TU4 A;  4O7A A;  2OO1 A;  5CTL A;  5II2 A;  5II1 A;  4UYH A;  5C89 A;  5C8G A;  4QR5 A;  3MXF A;  2GRC A;  4HBV A;  5COI A;  5JI8 A;  2OUO A;  5A5R A;  4ALH A;  5D3P A;  4YYM A;  4O71 A;  5I86 A;  4PKL A;  5DFC A;  2YEK A;  5IG6 A;  2L5E A;  4YBS A;  4NUE A;  5L8T A;  4IR6 A;  3D7C A;  5CQ6 A;  5H85 A;  3RCW A;  5ENH A;  4Y03 A;  3I3J A;  2R10 A;  4CUT A;  5CUC A;  5G4S A;  5CQ3 A;  5EPS A;  5F5Z A;  5A5N A;  4YK0 A;  5CRM A;  4YC9 A;  5HQ5 A;  4NRB A;  3UV4 A;  5EWH A;  5A5P A;  3S92 A;  3U5N A;  5D3H A;  5E73 A;  2LSP B;  4HXN A;  2I7K A;  4OGJ A;  5CUB A;  4NS5 A;  2D9E A;  4QYD A;  5ENB A;  5EWD A;  4LZ2 A;  3SVH A;  5I7Y A;  5HFQ A;  4FLP A;  3SVF A;  5LJ0 A;  3QZT A;  5CRZ A;  2RS9 B;  4PCE A;  5HEL A;  5FE5 A;  4LYI A;  4UYE A;  5CP5 A;  5D24 A;  4QEU A;  5FH6 A;  5EA1 A;  5F62 A;  5C7N A;  4QY4 A;  4HXO A;  5CY9 A;  4CUS A;  3UV2 A;  5E9M A;  5TCM A;  5A5Q A;  5E0R A;  4A9N A;  4C66 A;  1EQF A;  4J0S A;  3O34 A;  3QZS A;  2WP1 A;  5HQ6 A;  5FE6 A;  4QC3 A;  2F6N A;  5ENI A;  5FE2 A;  5FB1 A;  5I1Q A;  4TYL A;  4F3I A;  5KTW A;  4IOO A;  5BT5 A;  4O7E A;  5E7D A;  3O35 A;  5IGK A;  3ZYU A;  5LKX A;  4QNS A;  4XUB A;  4PS5 A;  4ZQL A;  5CQ5 A;  5L96 A;  4UIT A;  5F61 A;  4YYN A;  5AD2 A;  4YYD A;  3JVM A;  2H60 A;  4J3I A;  4TS8 A;  2YEL A;  5D25 A;  2FSA A;  3P1D A;  5HEN A;  3JVK A;  4Q0N A;  4A9K A;  5I83 A;  5HLS A;  3U5J A;  4IOR A;  2R0Y A;  5D3S A;  5CUD A;  4YBM A;  5I89 A;  5L97 A;  5ENJ A;  4NRA A;  5F36 A;  5LUU A;  5EPB A;  5EWW A;  5BT4 A;  5TB6 A;  3GG3 A;  5EIC A;  4PY6 A;  4NR6 A;  2F6J A;  5EI4 A;  2YQD A;  4AKN A;  4QB3 A;  5A7C A;  4J0R A;  5ETB A;  3P5O A;  3TLP A;  4NR7 A;  5FDZ A;  4QSR A;  5FG5 A;  5CZG A;  4MR3 A;  5KU3 A;  5FE4 A;  3MB4 A;  4HXP A;  5FFV A;  4ZC9 A;  4QZS A;  4KCX A;  4Z6H A;  5D3L A;  5H1T A;  3UW9 A;  5DYU A;  2YEM A;  5ACY A;  1F68 A;  5FBX A;  5I88 A;  2DVS A;  4KV4 A;  2KTB B;  1WUG A;  4QUT A;  5CUG A;  4YAT A;  5LKT A;  4HBY A;  3S91 A;  2RO1 A;  5E3D A;  4IR4 A;  4N4G A;  4IR3 A;  3K2J A;  5F25 A;  5BT3 A;  5DBM A;  5I80 A;  5D3J A;  3LQH A;  4LYW A;  4RVR A;  4UIZ A;  4UIW A;  3JVL A;  4HXS A;  4YAD A;  4O76 A;  2DWW A;  5ENC A;  4Z1Q A;  4MEO A;  5FE7 A;  4X2I A;  4OUF A;  3LXJ A;  5DFB A;  5CU8 A;  5D7X A;  4A9J A;  5CQT A;  5HEM A;  1JM4 B;  5D0C A;  3SVG A;  3U5L A;  4MEP A;  4CFL A;  4BW3 A;  5CUE A;  1X0J A;  4A9O A;  4TQN A;  5FH7 A;  4QYL A;  5FE9 A;  2NXB A;  3U5P A;  4YYK A;  5L8U A;  3G0L A;  3DWY A;  2L85 A;  4O72 A;  4QST A;  2DVQ A;  4UYF B;  3U5K A;  1WUM A;  4YYG A;  4N3W A;  5DX4 A;  2RI7 A;  5A83 A;  5C4Q A;  4UYD A;  4QSS A;  5CQ8 A;  4BW4 A;  5D26 A;  4HBW A;  5KO4 A;  5K29 A;  1ZS5 A;  4YYH A;  5E9I A;  4WHW A;  4NQM A;  5CPE A;  3FKM X;  3HME A;  2E3K A;  4LRG A;  3UVY A;  5LVR A;  5A82 A;  4CUU A;  3UVD A;  4A9I A;  5D3T A;  3P1C A;  3ONI A;  5EP7 A;  4HXK A;  4CUP A;  2E7O A;  4HXM A;  5HRV A;  5CS8 A;  4A9F A;  5FH8 A;  5HJC A;  4XUA A;  5DW2 A;  5F3A A;  4QSQ A;  2D82 A;  5DYA A;  5EWC A;  4UIY A;  4Z93 A;  4O7C A;  4UIX A;  4NUD A;  5D3N A;  3MUK A;  4O75 A;  4CFK A;  5G4R A;  5H1V A;  5AME A;  3LQJ A;  3JVJ A;  4YAB A;  3O37 A;  2DAT A;  4N4H A;  5HQ7 A;  3HMF A;  4PCI A;  5CQ4 A;  4TU6 A;  5FE1 A;  5EK9 A;  5CGP A;  5EPR A;  2N9G A;  4TT4 A;  4YAX A;  5LJ1 A;  4TZ8 A;  5FE8 A;  5CQ7 A;  5EVA A;  5FFY A;  4E96 A;  5D3R A;  5DKH A;  5E9V A;  2YW5 A;  5LKU A;  4O7F A;  4XY9 A;  5J0D A;  4A9H A;  4CL9 A;  5F60 A;  5KHM A;  3UVW A;  5IGL A;  4QSV A;  3IU5 A;  4ZW1 A;  5IBN A;  4LC2 A;  4KV1 A;  4YY4 A;  5FB0 A;  5L98 A;  4YY6 A;  5KTU A;  5ENG A;  4XY8 A;  4NYV A;  4NR8 A;  4O70 A;  2OSS A;  4NR9 A;  4Z6I A;  3IU6 A;  5A81 A;  4NQN A;  4QR3 A;  2WP2 A;  5EQ1 A;  4IR5 A;  4LDF A;  4NXJ A;  3U5M A;  5LKZ A;  5IGN A;  2DVV A;  5DW1 A;  5JWM A;  4XYA A;  4QC1 A;  5E74 A;  3O36 A;  5I40 A;  5E9Y A;  5F63 A;  5EV9 A;  2G4A A;  2RNX A;  5FE0 A;  5IGM A;  4QR4 A;  4PTB A;  5HM0 A;  5AD3 A;  4QBM A;  3MB3 A;  4UIV A;  4OGI A;  3O33 A;  5L99 A;  4MR4 A;  4DON A;  3P1E A;  4MR5 A;  5DKC A;  5KTX A;  5AMF A;  2R0V A;  3AQA A;  4QUU A;  4LZS A;  4NYW A;  5CUA A;  4O77 A;  4WIV A;  3Q2E A;  5C85 A;  5F2P A;  4HXR A;  3HMH A;  3MQM A;  3Q2F A;  4NUC A;  4MEN A;  2RNW A;  4Z1S A;  5DYX A;  5E3G A;  4BW2 A;  4QSU A;  5E9L A;  4A9L A;  2RFJ A;  2DVR A;  5A5S A;  4TT2 A;  5CQA A;  5A5O A;  2YYN A;  4CLB A;  5EGU A;  4QEW A;  5EM3 A;  4UYF A;  5HCL A;  3LJW A;  4O74 A;  4GPJ A;  4QSX A;  3P1F A;  5FE3 A;  3UVX A;  5C87 A;  5EWV A;  4BHW A;  5I29 A;  4BJX A;  1E6I A;  2YDW A;  4YBT A;  5I7X A;  4UIU A;  4A9E A;  4TTE A;  5ETD A;  4N4I A;  5LJ2 A;  4HXL A;  4O7B A;  4IOQ A;  4QSW A;  5A85 A;  5E9K A;  4YYJ A;  4TZ2 A;  2L84 A;  5DFD A;  5HRW A;  2R0S A;  4LYS A;  2E7N A;  4ALG A;  4BW1 A;  5HRX A;  2RNY A;  3QZV A;  5FG6 A;  4LZR A;  3G0J A;  5ENE A;  5DY7 A;  4YH4 A;  5FFW A; 
#chains in the Genus database with same CATH topology
 4CUR A;  2I8N A;  5DLZ A;  5FG4 A;  3DAI A;  4A9M A;  5F1H A;  3NXB A;  3UV5 A;  4NRC A;  4UYG A;  5LVQ A;  5DYC A;  5HFR A;  1N72 A;  3AAD A;  4N4F A;  4QEV A;  4Q0O A;  2MJV B;  3LQI A;  4NR5 A;  4C67 A;  5EIS A;  4AKG A;  4WHU A;  5H1U A;  4J1P A;  5ENF A;  4TT6 A;  5EU1 A;  3MUL A;  1JSP B;  2DKW A;  4MR6 A;  5CFW A;  5DKD A;  3U5O A;  4YH3 A;  5IID A;  5DLX A;  4MEQ A;  4LR6 A;  4CUQ A;  4YYI A;  4NR4 A;  4NYX A;  4HBX A;  4O78 A;  4QSP A;  5F1L A;  4TU4 A;  4O7A A;  2OO1 A;  5CTL A;  5II2 A;  5II1 A;  4UYH A;  5C89 A;  5C8G A;  4QR5 A;  3MXF A;  2GRC A;  4HBV A;  5COI A;  5JI8 A;  2OUO A;  5A5R A;  4ALH A;  5D3P A;  4YYM A;  4O71 A;  5I86 A;  4PKL A;  5DFC A;  2YEK A;  5IG6 A;  2L5E A;  4YBS A;  4NUE A;  5L8T A;  4IR6 A;  3D7C A;  5CQ6 A;  5H85 A;  3RCW A;  5ENH A;  4Y03 A;  3I3J A;  2R10 A;  4CUT A;  5CUC A;  5G4S A;  5CQ3 A;  5EPS A;  5F5Z A;  5A5N A;  4YK0 A;  5CRM A;  4YC9 A;  5HQ5 A;  4NRB A;  3UV4 A;  5EWH A;  5A5P A;  3S92 A;  3U5N A;  5D3H A;  5E73 A;  2LSP B;  4HXN A;  2I7K A;  4OGJ A;  5CUB A;  4NS5 A;  2D9E A;  4QYD A;  5ENB A;  5EWD A;  4LZ2 A;  3SVH A;  5I7Y A;  5HFQ A;  3D1B A;  4FLP A;  3SVF A;  5LJ0 A;  3QZT A;  5CRZ A;  2RS9 B;  4PCE A;  5HEL A;  5FE5 A;  4LYI A;  4UYE A;  5CP5 A;  5D24 A;  4QEU A;  5FH6 A;  5EA1 A;  5F62 A;  5C7N A;  4QY4 A;  4HXO A;  5CY9 A;  4CUS A;  3UV2 A;  5E9M A;  5TCM A;  5A5Q A;  5E0R A;  4A9N A;  4C66 A;  1EQF A;  4J0S A;  3O34 A;  3QZS A;  2WP1 A;  5HQ6 A;  5FE6 A;  4QC3 A;  2F6N A;  5ENI A;  5FE2 A;  5FB1 A;  5I1Q A;  4TYL A;  4F3I A;  5KTW A;  4IOO A;  5BT5 A;  4O7E A;  5E7D A;  3O35 A;  5IGK A;  3ZYU A;  5LKX A;  4QNS A;  4XUB A;  4PS5 A;  4ZQL A;  5CQ5 A;  5L96 A;  4UIT A;  5F61 A;  4YYN A;  5AD2 A;  4YYD A;  3JVM A;  2H60 A;  4J3I A;  4TS8 A;  2YEL A;  5D25 A;  2FSA A;  3P1D A;  5HEN A;  3JVK A;  4Q0N A;  4A9K A;  5I83 A;  5HLS A;  3U5J A;  4IOR A;  2R0Y A;  5D3S A;  5CUD A;  4YBM A;  5I89 A;  5L97 A;  5ENJ A;  4NRA A;  5F36 A;  5LUU A;  5EPB A;  1ZKR A;  5EWW A;  5BT4 A;  5TB6 A;  3GG3 A;  5EIC A;  4PY6 A;  4NR6 A;  2F6J A;  5EI4 A;  2YQD A;  4AKN A;  4QB3 A;  5A7C A;  4J0R A;  5ETB A;  3P5O A;  3TLP A;  4NR7 A;  4AKH A;  5FDZ A;  4QSR A;  5FG5 A;  5CZG A;  4MR3 A;  5KU3 A;  5FE4 A;  3MB4 A;  4HXP A;  5FFV A;  4ZC9 A;  4QZS A;  4KCX A;  4Z6H A;  5D3L A;  5H1T A;  3UW9 A;  5DYU A;  2YEM A;  5ACY A;  1F68 A;  5FBX A;  5I88 A;  2DVS A;  4KV4 A;  2KTB B;  1WUG A;  4QUT A;  5CUG A;  4YAT A;  5LKT A;  4HBY A;  3S91 A;  2RO1 A;  5E3D A;  4IR4 A;  4N4G A;  4IR3 A;  3K2J A;  5F25 A;  5BT3 A;  5DBM A;  5I80 A;  5D3J A;  3LQH A;  4LYW A;  4RVR A;  4UIZ A;  4UIW A;  3JVL A;  4HXS A;  4YAD A;  4O76 A;  2DWW A;  5ENC A;  4Z1Q A;  4MEO A;  5FE7 A;  4X2I A;  4OUF A;  3LXJ A;  5DFB A;  5CU8 A;  5D7X A;  4A9J A;  5CQT A;  5HEM A;  1JM4 B;  5D0C A;  3SVG A;  3U5L A;  4MEP A;  4CFL A;  4BW3 A;  5CUE A;  1X0J A;  4A9O A;  4TQN A;  5FH7 A;  4QYL A;  5FE9 A;  2NXB A;  3U5P A;  4YYK A;  5L8U A;  3G0L A;  3DWY A;  2L85 A;  4O72 A;  4QST A;  2DVQ A;  4UYF B;  3U5K A;  1WUM A;  4YYG A;  4N3W A;  5DX4 A;  2RI7 A;  5A83 A;  5C4Q A;  4UYD A;  4QSS A;  5CQ8 A;  4BW4 A;  2EJN A;  5D26 A;  4HBW A;  5KO4 A;  5K29 A;  1ZS5 A;  4YYH A;  5E9I A;  4WHW A;  4NQM A;  5CPE A;  3FKM X;  3HME A;  2E3K A;  4LRG A;  3UVY A;  5LVR A;  5A82 A;  4CUU A;  3UVD A;  4A9I A;  5D3T A;  3P1C A;  3ONI A;  5EP7 A;  4HXK A;  4CUP A;  2E7O A;  4HXM A;  5HRV A;  5CS8 A;  4A9F A;  5FH8 A;  5HJC A;  4XUA A;  5DW2 A;  5F3A A;  4QSQ A;  2D82 A;  5DYA A;  5EWC A;  4UIY A;  4Z93 A;  4O7C A;  4UIX A;  4NUD A;  5D3N A;  3MUK A;  4O75 A;  4CFK A;  5G4R A;  5H1V A;  5AME A;  3LQJ A;  3JVJ A;  4YAB A;  4AKI A;  3O37 A;  2DAT A;  4N4H A;  5HQ7 A;  3HMF A;  4PCI A;  5CQ4 A;  4TU6 A;  5FE1 A;  5EK9 A;  5CGP A;  5EPR A;  2N9G A;  4TT4 A;  4YAX A;  5LJ1 A;  4TZ8 A;  5FE8 A;  5CQ7 A;  5EVA A;  5FFY A;  4E96 A;  5D3R A;  5DKH A;  5E9V A;  2YW5 A;  5LKU A;  4O7F A;  4XY9 A;  1PUO A;  5J0D A;  4A9H A;  4CL9 A;  5F60 A;  5KHM A;  3UVW A;  5IGL A;  4QSV A;  3IU5 A;  4ZW1 A;  5IBN A;  4LC2 A;  4KV1 A;  4YY4 A;  5FB0 A;  5L98 A;  4YY6 A;  5KTU A;  5ENG A;  4XY8 A;  4NYV A;  4NR8 A;  4O70 A;  4AI6 A;  2OSS A;  4NR9 A;  4Z6I A;  3IU6 A;  5A81 A;  4NQN A;  3ERR A;  4QR3 A;  2WP2 A;  5EQ1 A;  4IR5 A;  4LDF A;  4NXJ A;  3U5M A;  5LKZ A;  5IGN A;  2DVV A;  5DW1 A;  5JWM A;  4XYA A;  4QC1 A;  5E74 A;  3O36 A;  5I40 A;  5E9Y A;  5F63 A;  5EV9 A;  2G4A A;  2RNX A;  5FE0 A;  5IGM A;  4QR4 A;  4PTB A;  5HM0 A;  5AD3 A;  4QBM A;  3MB3 A;  4UIV A;  4OGI A;  3O33 A;  5L99 A;  4MR4 A;  4DON A;  3P1E A;  4MR5 A;  5DKC A;  5KTX A;  5AMF A;  2R0V A;  3AQA A;  4QUU A;  4LZS A;  4NYW A;  5CUA A;  4O77 A;  4WIV A;  3Q2E A;  5C85 A;  5F2P A;  4HXR A;  3HMH A;  3MQM A;  3Q2F A;  4NUC A;  4MEN A;  2RNW A;  4Z1S A;  5DYX A;  5E3G A;  4BW2 A;  4QSU A;  5E9L A;  4A9L A;  2RFJ A;  2DVR A;  5A5S A;  4TT2 A;  5CQA A;  5A5O A;  2YYN A;  4CLB A;  5EGU A;  4QEW A;  5EM3 A;  4UYF A;  5HCL A;  3LJW A;  4O74 A;  4GPJ A;  4QSX A;  3P1F A;  5FE3 A;  3UVX A;  5C87 A;  5EWV A;  4BHW A;  5I29 A;  4BJX A;  3VKG A;  1E6I A;  2YDW A;  4YBT A;  5I7X A;  4UIU A;  4A9E A;  4TTE A;  5ETD A;  4N4I A;  5LJ2 A;  4HXL A;  4O7B A;  4IOQ A;  4QSW A;  5A85 A;  5E9K A;  4YYJ A;  4TZ2 A;  2L84 A;  5DFD A;  5HRW A;  2R0S A;  4LYS A;  2E7N A;  4ALG A;  4BW1 A;  5HRX A;  2RNY A;  3QZV A;  5FG6 A;  3D1D A;  4LZR A;  3G0J A;  3VKH A;  5ENE A;  5DY7 A;  4YH4 A;  5FFW A; 
#chains in the Genus database with same CATH homology
 4CUR A;  2I8N A;  5DLZ A;  5FG4 A;  3DAI A;  4A9M A;  5F1H A;  3NXB A;  3UV5 A;  4NRC A;  4UYG A;  5LVQ A;  5DYC A;  5HFR A;  1N72 A;  3AAD A;  4N4F A;  4QEV A;  4Q0O A;  2MJV B;  3LQI A;  4NR5 A;  4C67 A;  5EIS A;  4WHU A;  5H1U A;  4J1P A;  5ENF A;  4TT6 A;  5EU1 A;  3MUL A;  1JSP B;  2DKW A;  4MR6 A;  5CFW A;  5DKD A;  3U5O A;  4YH3 A;  5IID A;  5DLX A;  4MEQ A;  4LR6 A;  4CUQ A;  4YYI A;  4NR4 A;  4NYX A;  4HBX A;  4O78 A;  4QSP A;  5F1L A;  4TU4 A;  4O7A A;  2OO1 A;  5CTL A;  5II2 A;  5II1 A;  4UYH A;  5C89 A;  5C8G A;  4QR5 A;  3MXF A;  2GRC A;  4HBV A;  5COI A;  5JI8 A;  2OUO A;  5A5R A;  4ALH A;  5D3P A;  4YYM A;  4O71 A;  5I86 A;  4PKL A;  5DFC A;  2YEK A;  5IG6 A;  2L5E A;  4YBS A;  4NUE A;  5L8T A;  4IR6 A;  3D7C A;  5CQ6 A;  5H85 A;  3RCW A;  5ENH A;  4Y03 A;  3I3J A;  2R10 A;  4CUT A;  5CUC A;  5G4S A;  5CQ3 A;  5EPS A;  5F5Z A;  5A5N A;  4YK0 A;  5CRM A;  4YC9 A;  5HQ5 A;  4NRB A;  3UV4 A;  5EWH A;  5A5P A;  3S92 A;  3U5N A;  5D3H A;  5E73 A;  2LSP B;  4HXN A;  2I7K A;  4OGJ A;  5CUB A;  4NS5 A;  2D9E A;  4QYD A;  5ENB A;  5EWD A;  4LZ2 A;  3SVH A;  5I7Y A;  5HFQ A;  4FLP A;  3SVF A;  5LJ0 A;  3QZT A;  5CRZ A;  2RS9 B;  4PCE A;  5HEL A;  5FE5 A;  4LYI A;  4UYE A;  5CP5 A;  5D24 A;  4QEU A;  5FH6 A;  5EA1 A;  5F62 A;  5C7N A;  4QY4 A;  4HXO A;  5CY9 A;  4CUS A;  3UV2 A;  5E9M A;  5TCM A;  5A5Q A;  5E0R A;  4A9N A;  4C66 A;  1EQF A;  4J0S A;  3O34 A;  3QZS A;  2WP1 A;  5HQ6 A;  5FE6 A;  4QC3 A;  2F6N A;  5ENI A;  5FE2 A;  5FB1 A;  5I1Q A;  4TYL A;  4F3I A;  5KTW A;  4IOO A;  5BT5 A;  4O7E A;  5E7D A;  3O35 A;  5IGK A;  3ZYU A;  5LKX A;  4QNS A;  4XUB A;  4PS5 A;  4ZQL A;  5CQ5 A;  5L96 A;  4UIT A;  5F61 A;  4YYN A;  5AD2 A;  4YYD A;  3JVM A;  2H60 A;  4J3I A;  4TS8 A;  2YEL A;  5D25 A;  2FSA A;  3P1D A;  5HEN A;  3JVK A;  4Q0N A;  4A9K A;  5I83 A;  5HLS A;  3U5J A;  4IOR A;  2R0Y A;  5D3S A;  5CUD A;  4YBM A;  5I89 A;  5L97 A;  5ENJ A;  4NRA A;  5F36 A;  5LUU A;  5EPB A;  5EWW A;  5BT4 A;  5TB6 A;  3GG3 A;  5EIC A;  4PY6 A;  4NR6 A;  2F6J A;  5EI4 A;  2YQD A;  4AKN A;  4QB3 A;  5A7C A;  4J0R A;  5ETB A;  3P5O A;  3TLP A;  4NR7 A;  5FDZ A;  4QSR A;  5FG5 A;  5CZG A;  4MR3 A;  5KU3 A;  5FE4 A;  3MB4 A;  4HXP A;  5FFV A;  4ZC9 A;  4QZS A;  4KCX A;  4Z6H A;  5D3L A;  5H1T A;  3UW9 A;  5DYU A;  2YEM A;  5ACY A;  1F68 A;  5FBX A;  5I88 A;  2DVS A;  4KV4 A;  2KTB B;  1WUG A;  4QUT A;  5CUG A;  4YAT A;  5LKT A;  4HBY A;  3S91 A;  2RO1 A;  5E3D A;  4IR4 A;  4N4G A;  4IR3 A;  3K2J A;  5F25 A;  5BT3 A;  5DBM A;  5I80 A;  5D3J A;  3LQH A;  4LYW A;  4RVR A;  4UIZ A;  4UIW A;  3JVL A;  4HXS A;  4YAD A;  4O76 A;  2DWW A;  5ENC A;  4Z1Q A;  4MEO A;  5FE7 A;  4X2I A;  4OUF A;  3LXJ A;  5DFB A;  5CU8 A;  5D7X A;  4A9J A;  5CQT A;  5HEM A;  1JM4 B;  5D0C A;  3SVG A;  3U5L A;  4MEP A;  4CFL A;  4BW3 A;  5CUE A;  1X0J A;  4A9O A;  4TQN A;  5FH7 A;  4QYL A;  5FE9 A;  2NXB A;  3U5P A;  4YYK A;  5L8U A;  3G0L A;  3DWY A;  2L85 A;  4O72 A;  4QST A;  2DVQ A;  4UYF B;  3U5K A;  1WUM A;  4YYG A;  4N3W A;  5DX4 A;  2RI7 A;  5A83 A;  5C4Q A;  4UYD A;  4QSS A;  5CQ8 A;  4BW4 A;  5D26 A;  4HBW A;  5KO4 A;  5K29 A;  1ZS5 A;  4YYH A;  5E9I A;  4WHW A;  4NQM A;  5CPE A;  3FKM X;  3HME A;  2E3K A;  4LRG A;  3UVY A;  5LVR A;  5A82 A;  4CUU A;  3UVD A;  4A9I A;  5D3T A;  3P1C A;  3ONI A;  5EP7 A;  4HXK A;  4CUP A;  2E7O A;  4HXM A;  5HRV A;  5CS8 A;  4A9F A;  5FH8 A;  5HJC A;  4XUA A;  5DW2 A;  5F3A A;  4QSQ A;  2D82 A;  5DYA A;  5EWC A;  4UIY A;  4Z93 A;  4O7C A;  4UIX A;  4NUD A;  5D3N A;  3MUK A;  4O75 A;  4CFK A;  5G4R A;  5H1V A;  5AME A;  3LQJ A;  3JVJ A;  4YAB A;  3O37 A;  2DAT A;  4N4H A;  5HQ7 A;  3HMF A;  4PCI A;  5CQ4 A;  4TU6 A;  5FE1 A;  5EK9 A;  5CGP A;  5EPR A;  2N9G A;  4TT4 A;  4YAX A;  5LJ1 A;  4TZ8 A;  5FE8 A;  5CQ7 A;  5EVA A;  5FFY A;  4E96 A;  5D3R A;  5DKH A;  5E9V A;  2YW5 A;  5LKU A;  4O7F A;  4XY9 A;  5J0D A;  4A9H A;  4CL9 A;  5F60 A;  5KHM A;  3UVW A;  5IGL A;  4QSV A;  3IU5 A;  4ZW1 A;  5IBN A;  4LC2 A;  4KV1 A;  4YY4 A;  5FB0 A;  5L98 A;  4YY6 A;  5KTU A;  5ENG A;  4XY8 A;  4NYV A;  4NR8 A;  4O70 A;  2OSS A;  4NR9 A;  4Z6I A;  3IU6 A;  5A81 A;  4NQN A;  4QR3 A;  2WP2 A;  5EQ1 A;  4IR5 A;  4LDF A;  4NXJ A;  3U5M A;  5LKZ A;  5IGN A;  2DVV A;  5DW1 A;  5JWM A;  4XYA A;  4QC1 A;  5E74 A;  3O36 A;  5I40 A;  5E9Y A;  5F63 A;  5EV9 A;  2G4A A;  2RNX A;  5FE0 A;  5IGM A;  4QR4 A;  4PTB A;  5HM0 A;  5AD3 A;  4QBM A;  3MB3 A;  4UIV A;  4OGI A;  3O33 A;  5L99 A;  4MR4 A;  4DON A;  3P1E A;  4MR5 A;  5DKC A;  5KTX A;  5AMF A;  2R0V A;  3AQA A;  4QUU A;  4LZS A;  4NYW A;  5CUA A;  4O77 A;  4WIV A;  3Q2E A;  5C85 A;  5F2P A;  4HXR A;  3HMH A;  3MQM A;  3Q2F A;  4NUC A;  4MEN A;  2RNW A;  4Z1S A;  5DYX A;  5E3G A;  4BW2 A;  4QSU A;  5E9L A;  4A9L A;  2RFJ A;  2DVR A;  5A5S A;  4TT2 A;  5CQA A;  5A5O A;  2YYN A;  4CLB A;  5EGU A;  4QEW A;  5EM3 A;  4UYF A;  5HCL A;  3LJW A;  4O74 A;  4GPJ A;  4QSX A;  3P1F A;  5FE3 A;  3UVX A;  5C87 A;  5EWV A;  4BHW A;  5I29 A;  4BJX A;  1E6I A;  2YDW A;  4YBT A;  5I7X A;  4UIU A;  4A9E A;  4TTE A;  5ETD A;  4N4I A;  5LJ2 A;  4HXL A;  4O7B A;  4IOQ A;  4QSW A;  5A85 A;  5E9K A;  4YYJ A;  4TZ2 A;  2L84 A;  5DFD A;  5HRW A;  2R0S A;  4LYS A;  2E7N A;  4ALG A;  4BW1 A;  5HRX A;  2RNY A;  3QZV A;  5FG6 A;  4LZR A;  3G0J A;  5ENE A;  5DY7 A;  4YH4 A;  5FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...