4QEWA

Crystal structure of brd2(bd2) mutant with ligand et bound (methyl (2r)- 2-[(4s)-6-(4-chlorophenyl)-8-methoxy-1-methyl-4h-[1,2,4]triazolo[4,3-a][1, 4]benzodiazepin-4-yl]butanoate)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGAHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Bromodomain-containing protein 2
publication title Chemical biology. A bump-and-hole approach to engineer controlled selectivity of BET bromodomain chemical probes.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qewA00
3LXJA 3UVXA 3MXFA 3Q2FA 5F62A 3AADA 5E9LA 5FG5A 2E7NA 4ALGA 4A9IA 3D7CA 4YAXA 3I3JA 4HXSA 3U5JA 5H1TA 5DFBA 4BW2A 3ONIA 3IU5A 5I80A 5HJCA 5LJ1A 2D82A 5ACYA 5FE8A 4LZ2A 3QZVA 5BT5A 5CGPA 3G0LA 5DYUA 4YATA 2KTBB 1X0JA 5ETDA 4QSSA 4NR9A 5CQ7A 5FFVA 5KHMA 5D3PA 3U5LA 4HXRA 4QC3A 4LYWA 5CTLA 1WUGA 4OGIA 4UYFB 5EVAA 5A5NA 4CUQA 5EQ1A 4NQNA 3FKMX 5CQ5A 5CUDA 5CUAA 3DWYA 2LSPB 4J3IA 4QSPA 4YYKA 2RS9B 5FG4A 4A9MA 5EI4A 3K2JA 5K29A 3MULA 3MQMA 5I88A 4YBTA 5DYCA 5HFRA 5DKHA 5LKZA 5AMFA 3LQJA 4PCEA 4LRGA 5E73A 4YABA 5C8GA 4NYXA 4NUEA 4UIUA 5HRVA 3U5PA 4NRBA 4UIXA 2R0SA 4QR5A 5I40A 4HXOA 4IR4A 5D26A 2GRCA 4O71A 3RCWA 4UIZA 4QEVA 4YYGA 4HXPA 1F68A 5DKDA 5DYXA 4O7CA 2RFJA 5CRZA 4QNSA 5CZGA 3UV5A 4A9NA 5FE3A 2DWWA 5FE9A 4IORA 2YELA 2E3KA 4KV1A 4QR4A 3O34A 4N4GA 4QSVA 5A5OA 4WHWA 5I29A 2DVRA 4YH3A 4NR5A 3GG3A 5ENHA 5EPRA 2I8NA 4NUDA 5E74A 4KCXA 3AQAA 2YW5A 5IGNA 4QR3A 5EGUA 5J0DA 2WP2A 4ZQLA 3UVWA 3ZYUA 5HM0A 2L84A 2FSAA 2R10A 4O72A 3JVMA 2YQDA 5D3LA 2G4AA 2DKWA 4QUTA 4A9OA 2L5EA 4HBVA 5LJ0A 5DFCA 5LKUA 3UW9A 5FE5A 5IGMA 3QZSA 5I1QA 5I89A 5FBXA 3HMEA 4BJXA 4HBYA 5CQAA 5C87A 3QZTA 3UV2A 5LVRA 4TT4A 4RVRA 5CP5A 3O35A 3U5NA 4QSTA 4NXJA 5FH7A 4IOQA 4HBWA 5EK9A 4YYNA 5I83A 4XY9A 4UYHA 5F2PA 3U5MA 4A9EA 5F25A 4F3IA 4TS8A 4CL9A 4YK0A 4NR8A 4IR5A 4QYLA 3DAIA 4E96A 4MR4A 4BHWA 4LC2A 5G4SA 5FE7A 3JVKA 3LQHA 4O70A 3O33A 5CQ3A 5CQ6A 4O77A 5L8TA 4TQNA 5F63A 5D3JA 5DLXA 5E3GA 2MJVB 3UVYA 4N4HA 4Z93A 5EPBA 4ZC9A 1EQFA 3O37A 4QSRA 4UIYA 3U5OA 4Z6IA 5D24A 4CUPA 5A85A 5AD3A 5L96A 5F5ZA 5FE2A 5HLSA 5HQ6A 4QEWA 3JVJA 5E9IA 4UYFA 4TTEA 4C67A 5F61A 5EWVA 5I7YA 5DBMA 5CFWA 5ENCA 5I7XA 2RNXA 2RI7A 5HRXA 5HQ7A 4N3WA 5FH8A 4BW4A 5D3RA 2L85A 5FDZA 5E0RA 4ALHA 2F6NA 5E9YA 4NYVA 5DFDA 4QZSA 5JWMA 4TZ2A 5E7DA 4WHUA 2DVSA 5D3TA 4UIVA 5AMEA 3P1DA 3Q2EA 5HRWA 5AD2A 3P1EA 4TU4A 3SVHA 4J0SA 5H1UA 4HBXA 4A9LA 4TZ8A 4MR6A 4Q0OA 4O74A 4UYEA 4GPJA 4HXMA 4N4IA 5E9KA 5II1A 4QC1A 5A82A 5CUGA 4HXNA 4QEUA 3SVFA 4CLBA 4J0RA 2N9GA 5DYAA 5E9VA 4C66A 4AKNA 5CUCA 5IGLA 1N72A 4MEOA 3P5OA 5D3SA 5F60A 5FB0A 5TCMA 5LJ2A 5KTWA 2R0YA 4O7EA 4O7FA 4A9JA 2DVQA 5KTXA 5C7NA 1ZS5A 5ENBA 4MENA 5EISA 2H60A 1E6IA 3P1CA 5C89A 5C85A 4QYDA 5ENJA 5ETBA 3UVDA 4YY4A 4O75A 5EWCA 5L99A 4Z6HA 3G0JA 4NUCA 5FB1A 4HXKA 5EWHA 2F6JA 4Z1SA 5IIDA 5LVQA 5A5SA 5FE4A 1WUMA 4ZW1A 2R0VA 5KO4A 5EWDA 4QUUA 4QB3A 4LZRA 4DONA 5F1LA 2RNWA 4YC9A 4QSUA 5FFWA 5ENGA 5DKCA 4QSXA 3HMFA 5G4RA 4BW3A 4CFLA 5A83A 4HXLA 5E9MA 3S92A 4IR6A 5A7CA 5IBNA 4IOOA 5CRMA 3HMHA 2YYNA 4MEQA 5KTUA 4MEPA 5ENEA 5FE0A 5D3NA 4YADA 5LUUA 5EPSA 4FLPA 3MB3A 5LKXA 5EICA 4NRAA 4NQMA 5A5QA 4N4FA 4XY8A 4YYHA 3MUKA 4NR7A 5ENIA 5FE1A 4O7AA 5DW1A 5C4QA 5L97A 5FG6A 5H85A 3P1FA 5HFQA 4UYGA 3O36A 3TLPA 5D7XA 5EM3A 5HENA 5D0CA 5A5PA 5D25A 4LZSA 2YEMA 4YYJA 4Q0NA 4YYMA 4TU6A 5HQ5A 5CQ8A 3S91A 4YYDA 5CQ4A 2YEKA 5HEMA 3LJWA 4XUAA 5CS8A 5COIA 4A9KA 1JSPB 5DX4A 5CUEA 5DY7A 5EU1A 2I7KA 5CUBA 4NYWA 4IR3A 5A81A 5H1VA 5LKTA 4KV4A 5BT3A 5TB6A 4XYAA 4XUBA 4Z1QA 4PKLA 4MR5A 5DW2A 5A5RA 5D3HA 4CUTA 5L98A 4WIVA 2RNYA 2RO1A 3LQIA 1JM4B 4YY6A 5E3DA 4LR6A 5IG6A 5EWWA 4BW1A 5CY9A 5FH6A 5CPEA 5FE6A 5F3AA 4YBSA 4CUSA 4O76A 4MR3A 4A9HA 5JI8A 3UV4A 4NRCA 4LDFA 5EP7A 5F36A 2NXBA 5HELA 3NXBA 3U5KA 2DATA 4UITA 4UYDA 4YH4A 4YBMA 3SVGA 2OO1A 4LYSA 5BT4A 5FFYA 4CUUA 5ENFA 2D9EA 4QBMA 4Y03A 4O78A 4TT6A 5CU8A 4QSWA 2OSSA 4PTBA 4O7BA 2OUOA 2YDWA 4NS5A 5KU3A 2E7OA 4CFKA 5I86A 4OGJA 4TT2A 4CURA 4PY6A 5L8UA 4QSQA 3IU6A 5F1HA 5EA1A 5EV9A 5DLZA 4NR4A 4YYIA 4OUFA 2WP1A 4A9FA 4QY4A 4J1PA 4TYLA 4X2IA 5II2A 4LYIA 3JVLA 5HCLA 5IGKA 4PCIA 4PS5A 2DVVA 5CQTA 4UIWA 4NR6A 3MB4A
chains in the Genus database with same CATH superfamily
3LXJA 3UVXA 3MXFA 3Q2FA 5F62A 3AADA 5E9LA 5FG5A 2E7NA 4ALGA 4A9IA 3D7CA 4YAXA 3I3JA 4HXSA 3U5JA 5H1TA 5DFBA 4BW2A 3ONIA 3IU5A 5I80A 5HJCA 5LJ1A 2D82A 5ACYA 5FE8A 4LZ2A 3QZVA 5BT5A 5CGPA 3G0LA 5DYUA 4YATA 2KTBB 4AKGA 1X0JA 5ETDA 4QSSA 4NR9A 5CQ7A 5FFVA 5KHMA 5D3PA 3U5LA 4HXRA 4QC3A 4AI6A 4LYWA 5CTLA 1WUGA 4OGIA 4UYFB 5EVAA 5A5NA 4CUQA 5EQ1A 4NQNA 3FKMX 5CQ5A 5CUDA 5CUAA 3DWYA 2LSPB 4J3IA 4QSPA 4YYKA 2RS9B 5FG4A 4A9MA 5EI4A 3K2JA 5K29A 3MULA 3MQMA 5I88A 4YBTA 5DYCA 5HFRA 5DKHA 5LKZA 5AMFA 3LQJA 4PCEA 4LRGA 5E73A 4YABA 5C8GA 4NYXA 4NUEA 4UIUA 5HRVA 3U5PA 4NRBA 4UIXA 2R0SA 4QR5A 5I40A 4HXOA 4IR4A 5D26A 2GRCA 4O71A 3RCWA 4UIZA 4QEVA 4YYGA 4HXPA 1F68A 5DKDA 5DYXA 4O7CA 2RFJA 5CRZA 4QNSA 5CZGA 3UV5A 4A9NA 5FE3A 2DWWA 5FE9A 4IORA 2YELA 2E3KA 4KV1A 4QR4A 3O34A 4N4GA 4QSVA 5A5OA 4WHWA 5I29A 2DVRA 4YH3A 4NR5A 3GG3A 5ENHA 5EPRA 2I8NA 4NUDA 5E74A 4KCXA 3AQAA 2YW5A 5IGNA 4QR3A 5EGUA 5J0DA 2WP2A 4ZQLA 3UVWA 3ZYUA 5HM0A 2L84A 2FSAA 2R10A 4O72A 3JVMA 2YQDA 5D3LA 2G4AA 2DKWA 4QUTA 4A9OA 2L5EA 2EJNA 4HBVA 5LJ0A 5DFCA 5LKUA 3UW9A 5FE5A 5IGMA 3QZSA 3VKGA 5I1QA 5I89A 5FBXA 3HMEA 4BJXA 4HBYA 5CQAA 5C87A 3QZTA 3UV2A 5LVRA 3D1BA 4TT4A 4RVRA 5CP5A 3O35A 3U5NA 4QSTA 4NXJA 5FH7A 4IOQA 4HBWA 5EK9A 4YYNA 5I83A 4XY9A 4UYHA 5F2PA 3U5MA 4A9EA 5F25A 4F3IA 4TS8A 3VKHA 4CL9A 4YK0A 4NR8A 4IR5A 4QYLA 3DAIA 4E96A 4MR4A 4BHWA 4LC2A 5G4SA 5FE7A 3JVKA 3LQHA 4O70A 3O33A 5CQ3A 5CQ6A 4O77A 5L8TA 4TQNA 5F63A 5D3JA 5DLXA 5E3GA 2MJVB 3UVYA 4N4HA 4Z93A 5EPBA 4ZC9A 1EQFA 3O37A 4QSRA 4UIYA 3U5OA 4Z6IA 5D24A 4CUPA 5A85A 5AD3A 5L96A 5F5ZA 5FE2A 5HLSA 5HQ6A 4QEWA 3JVJA 5E9IA 4UYFA 4TTEA 4C67A 5F61A 5EWVA 5I7YA 5DBMA 5CFWA 5ENCA 5I7XA 2RNXA 2RI7A 5HRXA 5HQ7A 4N3WA 5FH8A 4BW4A 5D3RA 2L85A 5FDZA 5E0RA 4ALHA 2F6NA 5E9YA 4NYVA 5DFDA 4QZSA 5JWMA 4TZ2A 5E7DA 4WHUA 2DVSA 5D3TA 4UIVA 5AMEA 3P1DA 3Q2EA 5HRWA 5AD2A 3P1EA 4TU4A 3SVHA 4J0SA 5H1UA 4HBXA 4A9LA 4TZ8A 4MR6A 4Q0OA 4O74A 4UYEA 3ERRA 4GPJA 4HXMA 4N4IA 5E9KA 5II1A 4QC1A 5A82A 5CUGA 4HXNA 4QEUA 3SVFA 4CLBA 4J0RA 2N9GA 5DYAA 5E9VA 4C66A 4AKNA 5CUCA 5IGLA 1N72A 4MEOA 3P5OA 5D3SA 5F60A 5FB0A 5TCMA 5LJ2A 5KTWA 2R0YA 4O7EA 4O7FA 4A9JA 2DVQA 5KTXA 5C7NA 1ZS5A 5ENBA 4MENA 5EISA 2H60A 1E6IA 3P1CA 5C89A 5C85A 4QYDA 5ENJA 5ETBA 3UVDA 4YY4A 4O75A 5EWCA 5L99A 4Z6HA 3G0JA 4NUCA 5FB1A 4HXKA 5EWHA 2F6JA 4Z1SA 5IIDA 5LVQA 5A5SA 5FE4A 1WUMA 4ZW1A 2R0VA 5KO4A 5EWDA 4QUUA 4QB3A 4LZRA 4DONA 5F1LA 2RNWA 4YC9A 4QSUA 5FFWA 5ENGA 5DKCA 4QSXA 3HMFA 5G4RA 4BW3A 4CFLA 5A83A 4HXLA 5E9MA 3S92A 4IR6A 5A7CA 5IBNA 4IOOA 5CRMA 3HMHA 2YYNA 4MEQA 5KTUA 4MEPA 5ENEA 5FE0A 5D3NA 4YADA 5LUUA 5EPSA 4FLPA 3MB3A 5LKXA 5EICA 4NRAA 4NQMA 5A5QA 4N4FA 4XY8A 4YYHA 3MUKA 4NR7A 5ENIA 5FE1A 4O7AA 5DW1A 5C4QA 5L97A 5FG6A 5H85A 3P1FA 5HFQA 4UYGA 3O36A 3TLPA 5D7XA 5EM3A 5HENA 5D0CA 5A5PA 5D25A 4LZSA 2YEMA 4YYJA 4Q0NA 4YYMA 4TU6A 5HQ5A 5CQ8A 3S91A 4YYDA 5CQ4A 2YEKA 5HEMA 3LJWA 4XUAA 5CS8A 5COIA 4A9KA 1JSPB 5DX4A 5CUEA 5DY7A 5EU1A 2I7KA 5CUBA 4NYWA 4IR3A 4AKHA 5A81A 5H1VA 5LKTA 4KV4A 5BT3A 5TB6A 4XYAA 4XUBA 4Z1QA 4PKLA 4MR5A 5DW2A 5A5RA 5D3HA 4CUTA 5L98A 4WIVA 2RNYA 2RO1A 3LQIA 1JM4B 4YY6A 5E3DA 4LR6A 5IG6A 5EWWA 4BW1A 5CY9A 5FH6A 5CPEA 5FE6A 5F3AA 4YBSA 4CUSA 4O76A 4MR3A 4A9HA 5JI8A 3UV4A 4NRCA 4LDFA 1PUOA 5EP7A 5F36A 2NXBA 3D1DA 5HELA 3NXBA 3U5KA 2DATA 4UITA 4UYDA 4YH4A 4YBMA 3SVGA 2OO1A 4LYSA 5BT4A 5FFYA 4CUUA 5ENFA 2D9EA 4QBMA 4Y03A 4O78A 4TT6A 5CU8A 4QSWA 2OSSA 4PTBA 4O7BA 2OUOA 2YDWA 4NS5A 5KU3A 1ZKRA 2E7OA 4CFKA 4AKIA 5I86A 4OGJA 4TT2A 4CURA 4PY6A 5L8UA 4QSQA 3IU6A 5F1HA 5EA1A 5EV9A 5DLZA 4NR4A 4YYIA 4OUFA 2WP1A 4A9FA 4QY4A 4J1PA 4TYLA 4X2IA 5II2A 4LYIA 3JVLA 5HCLA 5IGKA 4PCIA 4PS5A 2DVVA 5CQTA 4UIWA 4NR6A 3MB4A
chains in the Genus database with same CATH topology
3LXJA 3UVXA 3MXFA 3Q2FA 5F62A 3AADA 5E9LA 5FG5A 2E7NA 4ALGA 4A9IA 3D7CA 4YAXA 3I3JA 4HXSA 3U5JA 5H1TA 5DFBA 4BW2A 3ONIA 3IU5A 5I80A 5HJCA 5LJ1A 2D82A 5ACYA 5FE8A 4LZ2A 3QZVA 5BT5A 5CGPA 3G0LA 5DYUA 4YATA 2KTBB 1X0JA 5ETDA 4QSSA 4NR9A 5CQ7A 5FFVA 5KHMA 5D3PA 3U5LA 4HXRA 4QC3A 4LYWA 5CTLA 1WUGA 4OGIA 4UYFB 5EVAA 5A5NA 4CUQA 5EQ1A 4NQNA 3FKMX 5CQ5A 5CUDA 5CUAA 3DWYA 2LSPB 4J3IA 4QSPA 4YYKA 2RS9B 5FG4A 4A9MA 5EI4A 3K2JA 5K29A 3MULA 3MQMA 5I88A 4YBTA 5DYCA 5HFRA 5DKHA 5LKZA 5AMFA 3LQJA 4PCEA 4LRGA 5E73A 4YABA 5C8GA 4NYXA 4NUEA 4UIUA 5HRVA 3U5PA 4NRBA 4UIXA 2R0SA 4QR5A 5I40A 4HXOA 4IR4A 5D26A 2GRCA 4O71A 3RCWA 4UIZA 4QEVA 4YYGA 4HXPA 1F68A 5DKDA 5DYXA 4O7CA 2RFJA 5CRZA 4QNSA 5CZGA 3UV5A 4A9NA 5FE3A 2DWWA 5FE9A 4IORA 2YELA 2E3KA 4KV1A 4QR4A 3O34A 4N4GA 4QSVA 5A5OA 4WHWA 5I29A 2DVRA 4YH3A 4NR5A 3GG3A 5ENHA 5EPRA 2I8NA 4NUDA 5E74A 4KCXA 3AQAA 2YW5A 5IGNA 4QR3A 5EGUA 5J0DA 2WP2A 4ZQLA 3UVWA 3ZYUA 5HM0A 2L84A 2FSAA 2R10A 4O72A 3JVMA 2YQDA 5D3LA 2G4AA 2DKWA 4QUTA 4A9OA 2L5EA 4HBVA 5LJ0A 5DFCA 5LKUA 3UW9A 5FE5A 5IGMA 3QZSA 5I1QA 5I89A 5FBXA 3HMEA 4BJXA 4HBYA 5CQAA 5C87A 3QZTA 3UV2A 5LVRA 4TT4A 4RVRA 5CP5A 3O35A 3U5NA 4QSTA 4NXJA 5FH7A 4IOQA 4HBWA 5EK9A 4YYNA 5I83A 4XY9A 4UYHA 5F2PA 3U5MA 4A9EA 5F25A 4F3IA 4TS8A 4CL9A 4YK0A 4NR8A 4IR5A 4QYLA 3DAIA 4E96A 4MR4A 4BHWA 4LC2A 5G4SA 5FE7A 3JVKA 3LQHA 4O70A 3O33A 5CQ3A 5CQ6A 4O77A 5L8TA 4TQNA 5F63A 5D3JA 5DLXA 5E3GA 2MJVB 3UVYA 4N4HA 4Z93A 5EPBA 4ZC9A 1EQFA 3O37A 4QSRA 4UIYA 3U5OA 4Z6IA 5D24A 4CUPA 5A85A 5AD3A 5L96A 5F5ZA 5FE2A 5HLSA 5HQ6A 4QEWA 3JVJA 5E9IA 4UYFA 4TTEA 4C67A 5F61A 5EWVA 5I7YA 5DBMA 5CFWA 5ENCA 5I7XA 2RNXA 2RI7A 5HRXA 5HQ7A 4N3WA 5FH8A 4BW4A 5D3RA 2L85A 5FDZA 5E0RA 4ALHA 2F6NA 5E9YA 4NYVA 5DFDA 4QZSA 5JWMA 4TZ2A 5E7DA 4WHUA 2DVSA 5D3TA 4UIVA 5AMEA 3P1DA 3Q2EA 5HRWA 5AD2A 3P1EA 4TU4A 3SVHA 4J0SA 5H1UA 4HBXA 4A9LA 4TZ8A 4MR6A 4Q0OA 4O74A 4UYEA 4GPJA 4HXMA 4N4IA 5E9KA 5II1A 4QC1A 5A82A 5CUGA 4HXNA 4QEUA 3SVFA 4CLBA 4J0RA 2N9GA 5DYAA 5E9VA 4C66A 4AKNA 5CUCA 5IGLA 1N72A 4MEOA 3P5OA 5D3SA 5F60A 5FB0A 5TCMA 5LJ2A 5KTWA 2R0YA 4O7EA 4O7FA 4A9JA 2DVQA 5KTXA 5C7NA 1ZS5A 5ENBA 4MENA 5EISA 2H60A 1E6IA 3P1CA 5C89A 5C85A 4QYDA 5ENJA 5ETBA 3UVDA 4YY4A 4O75A 5EWCA 5L99A 4Z6HA 3G0JA 4NUCA 5FB1A 4HXKA 5EWHA 2F6JA 4Z1SA 5IIDA 5LVQA 5A5SA 5FE4A 1WUMA 4ZW1A 2R0VA 5KO4A 5EWDA 4QUUA 4QB3A 4LZRA 4DONA 5F1LA 2RNWA 4YC9A 4QSUA 5FFWA 5ENGA 5DKCA 4QSXA 3HMFA 5G4RA 4BW3A 4CFLA 5A83A 4HXLA 5E9MA 3S92A 4IR6A 5A7CA 5IBNA 4IOOA 5CRMA 3HMHA 2YYNA 4MEQA 5KTUA 4MEPA 5ENEA 5FE0A 5D3NA 4YADA 5LUUA 5EPSA 4FLPA 3MB3A 5LKXA 5EICA 4NRAA 4NQMA 5A5QA 4N4FA 4XY8A 4YYHA 3MUKA 4NR7A 5ENIA 5FE1A 4O7AA 5DW1A 5C4QA 5L97A 5FG6A 5H85A 3P1FA 5HFQA 4UYGA 3O36A 3TLPA 5D7XA 5EM3A 5HENA 5D0CA 5A5PA 5D25A 4LZSA 2YEMA 4YYJA 4Q0NA 4YYMA 4TU6A 5HQ5A 5CQ8A 3S91A 4YYDA 5CQ4A 2YEKA 5HEMA 3LJWA 4XUAA 5CS8A 5COIA 4A9KA 1JSPB 5DX4A 5CUEA 5DY7A 5EU1A 2I7KA 5CUBA 4NYWA 4IR3A 5A81A 5H1VA 5LKTA 4KV4A 5BT3A 5TB6A 4XYAA 4XUBA 4Z1QA 4PKLA 4MR5A 5DW2A 5A5RA 5D3HA 4CUTA 5L98A 4WIVA 2RNYA 2RO1A 3LQIA 1JM4B 4YY6A 5E3DA 4LR6A 5IG6A 5EWWA 4BW1A 5CY9A 5FH6A 5CPEA 5FE6A 5F3AA 4YBSA 4CUSA 4O76A 4MR3A 4A9HA 5JI8A 3UV4A 4NRCA 4LDFA 5EP7A 5F36A 2NXBA 5HELA 3NXBA 3U5KA 2DATA 4UITA 4UYDA 4YH4A 4YBMA 3SVGA 2OO1A 4LYSA 5BT4A 5FFYA 4CUUA 5ENFA 2D9EA 4QBMA 4Y03A 4O78A 4TT6A 5CU8A 4QSWA 2OSSA 4PTBA 4O7BA 2OUOA 2YDWA 4NS5A 5KU3A 2E7OA 4CFKA 5I86A 4OGJA 4TT2A 4CURA 4PY6A 5L8UA 4QSQA 3IU6A 5F1HA 5EA1A 5EV9A 5DLZA 4NR4A 4YYIA 4OUFA 2WP1A 4A9FA 4QY4A 4J1PA 4TYLA 4X2IA 5II2A 4LYIA 3JVLA 5HCLA 5IGKA 4PCIA 4PS5A 2DVVA 5CQTA 4UIWA 4NR6A 3MB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXJ A;  3UVX A;  3MXF A;  3Q2F A;  5F62 A;  3AAD A;  5E9L A;  5FG5 A;  2E7N A;  4ALG A;  4A9I A;  3D7C A;  4YAX A;  3I3J A;  4HXS A;  3U5J A;  5H1T A;  5DFB A;  4BW2 A;  3ONI A;  3IU5 A;  5I80 A;  5HJC A;  5LJ1 A;  2D82 A;  5ACY A;  5FE8 A;  4LZ2 A;  3QZV A;  5BT5 A;  5CGP A;  3G0L A;  5DYU A;  4YAT A;  2KTB B;  1X0J A;  5ETD A;  4QSS A;  4NR9 A;  5CQ7 A;  5FFV A;  5KHM A;  5D3P A;  3U5L A;  4HXR A;  4QC3 A;  4LYW A;  5CTL A;  1WUG A;  4OGI A;  4UYF B;  5EVA A;  5A5N A;  4CUQ A;  5EQ1 A;  4NQN A;  3FKM X;  5CQ5 A;  5CUD A;  5CUA A;  3DWY A;  2LSP B;  4J3I A;  4QSP A;  4YYK A;  2RS9 B;  5FG4 A;  4A9M A;  5EI4 A;  3K2J A;  5K29 A;  3MUL A;  3MQM A;  5I88 A;  4YBT A;  5DYC A;  5HFR A;  5DKH A;  5LKZ A;  5AMF A;  3LQJ A;  4PCE A;  4LRG A;  5E73 A;  4YAB A;  5C8G A;  4NYX A;  4NUE A;  4UIU A;  5HRV A;  3U5P A;  4NRB A;  4UIX A;  2R0S A;  4QR5 A;  5I40 A;  4HXO A;  4IR4 A;  5D26 A;  2GRC A;  4O71 A;  3RCW A;  4UIZ A;  4QEV A;  4YYG A;  4HXP A;  1F68 A;  5DKD A;  5DYX A;  4O7C A;  2RFJ A;  5CRZ A;  4QNS A;  5CZG A;  3UV5 A;  4A9N A;  5FE3 A;  2DWW A;  5FE9 A;  4IOR A;  2YEL A;  2E3K A;  4KV1 A;  4QR4 A;  3O34 A;  4N4G A;  4QSV A;  5A5O A;  4WHW A;  5I29 A;  2DVR A;  4YH3 A;  4NR5 A;  3GG3 A;  5ENH A;  5EPR A;  2I8N A;  4NUD A;  5E74 A;  4KCX A;  3AQA A;  2YW5 A;  5IGN A;  4QR3 A;  5EGU A;  5J0D A;  2WP2 A;  4ZQL A;  3UVW A;  3ZYU A;  5HM0 A;  2L84 A;  2FSA A;  2R10 A;  4O72 A;  3JVM A;  2YQD A;  5D3L A;  2G4A A;  2DKW A;  4QUT A;  4A9O A;  2L5E A;  4HBV A;  5LJ0 A;  5DFC A;  5LKU A;  3UW9 A;  5FE5 A;  5IGM A;  3QZS A;  5I1Q A;  5I89 A;  5FBX A;  3HME A;  4BJX A;  4HBY A;  5CQA A;  5C87 A;  3QZT A;  3UV2 A;  5LVR A;  4TT4 A;  4RVR A;  5CP5 A;  3O35 A;  3U5N A;  4QST A;  4NXJ A;  5FH7 A;  4IOQ A;  4HBW A;  5EK9 A;  4YYN A;  5I83 A;  4XY9 A;  4UYH A;  5F2P A;  3U5M A;  4A9E A;  5F25 A;  4F3I A;  4TS8 A;  4CL9 A;  4YK0 A;  4NR8 A;  4IR5 A;  4QYL A;  3DAI A;  4E96 A;  4MR4 A;  4BHW A;  4LC2 A;  5G4S A;  5FE7 A;  3JVK A;  3LQH A;  4O70 A;  3O33 A;  5CQ3 A;  5CQ6 A;  4O77 A;  5L8T A;  4TQN A;  5F63 A;  5D3J A;  5DLX A;  5E3G A;  2MJV B;  3UVY A;  4N4H A;  4Z93 A;  5EPB A;  4ZC9 A;  1EQF A;  3O37 A;  4QSR A;  4UIY A;  3U5O A;  4Z6I A;  5D24 A;  4CUP A;  5A85 A;  5AD3 A;  5L96 A;  5F5Z A;  5FE2 A;  5HLS A;  5HQ6 A;  4QEW A;  3JVJ A;  5E9I A;  4UYF A;  4TTE A;  4C67 A;  5F61 A;  5EWV A;  5I7Y A;  5DBM A;  5CFW A;  5ENC A;  5I7X A;  2RNX A;  2RI7 A;  5HRX A;  5HQ7 A;  4N3W A;  5FH8 A;  4BW4 A;  5D3R A;  2L85 A;  5FDZ A;  5E0R A;  4ALH A;  2F6N A;  5E9Y A;  4NYV A;  5DFD A;  4QZS A;  5JWM A;  4TZ2 A;  5E7D A;  4WHU A;  2DVS A;  5D3T A;  4UIV A;  5AME A;  3P1D A;  3Q2E A;  5HRW A;  5AD2 A;  3P1E A;  4TU4 A;  3SVH A;  4J0S A;  5H1U A;  4HBX A;  4A9L A;  4TZ8 A;  4MR6 A;  4Q0O A;  4O74 A;  4UYE A;  4GPJ A;  4HXM A;  4N4I A;  5E9K A;  5II1 A;  4QC1 A;  5A82 A;  5CUG A;  4HXN A;  4QEU A;  3SVF A;  4CLB A;  4J0R A;  2N9G A;  5DYA A;  5E9V A;  4C66 A;  4AKN A;  5CUC A;  5IGL A;  1N72 A;  4MEO A;  3P5O A;  5D3S A;  5F60 A;  5FB0 A;  5TCM A;  5LJ2 A;  5KTW A;  2R0Y A;  4O7E A;  4O7F A;  4A9J A;  2DVQ A;  5KTX A;  5C7N A;  1ZS5 A;  5ENB A;  4MEN A;  5EIS A;  2H60 A;  1E6I A;  3P1C A;  5C89 A;  5C85 A;  4QYD A;  5ENJ A;  5ETB A;  3UVD A;  4YY4 A;  4O75 A;  5EWC A;  5L99 A;  4Z6H A;  3G0J A;  4NUC A;  5FB1 A;  4HXK A;  5EWH A;  2F6J A;  4Z1S A;  5IID A;  5LVQ A;  5A5S A;  5FE4 A;  1WUM A;  4ZW1 A;  2R0V A;  5KO4 A;  5EWD A;  4QUU A;  4QB3 A;  4LZR A;  4DON A;  5F1L A;  2RNW A;  4YC9 A;  4QSU A;  5FFW A;  5ENG A;  5DKC A;  4QSX A;  3HMF A;  5G4R A;  4BW3 A;  4CFL A;  5A83 A;  4HXL A;  5E9M A;  3S92 A;  4IR6 A;  5A7C A;  5IBN A;  4IOO A;  5CRM A;  3HMH A;  2YYN A;  4MEQ A;  5KTU A;  4MEP A;  5ENE A;  5FE0 A;  5D3N A;  4YAD A;  5LUU A;  5EPS A;  4FLP A;  3MB3 A;  5LKX A;  5EIC A;  4NRA A;  4NQM A;  5A5Q A;  4N4F A;  4XY8 A;  4YYH A;  3MUK A;  4NR7 A;  5ENI A;  5FE1 A;  4O7A A;  5DW1 A;  5C4Q A;  5L97 A;  5FG6 A;  5H85 A;  3P1F A;  5HFQ A;  4UYG A;  3O36 A;  3TLP A;  5D7X A;  5EM3 A;  5HEN A;  5D0C A;  5A5P A;  5D25 A;  4LZS A;  2YEM A;  4YYJ A;  4Q0N A;  4YYM A;  4TU6 A;  5HQ5 A;  5CQ8 A;  3S91 A;  4YYD A;  5CQ4 A;  2YEK A;  5HEM A;  3LJW A;  4XUA A;  5CS8 A;  5COI A;  4A9K A;  1JSP B;  5DX4 A;  5CUE A;  5DY7 A;  5EU1 A;  2I7K A;  5CUB A;  4NYW A;  4IR3 A;  5A81 A;  5H1V A;  5LKT A;  4KV4 A;  5BT3 A;  5TB6 A;  4XYA A;  4XUB A;  4Z1Q A;  4PKL A;  4MR5 A;  5DW2 A;  5A5R A;  5D3H A;  4CUT A;  5L98 A;  4WIV A;  2RNY A;  2RO1 A;  3LQI A;  1JM4 B;  4YY6 A;  5E3D A;  4LR6 A;  5IG6 A;  5EWW A;  4BW1 A;  5CY9 A;  5FH6 A;  5CPE A;  5FE6 A;  5F3A A;  4YBS A;  4CUS A;  4O76 A;  4MR3 A;  4A9H A;  5JI8 A;  3UV4 A;  4NRC A;  4LDF A;  5EP7 A;  5F36 A;  2NXB A;  5HEL A;  3NXB A;  3U5K A;  2DAT A;  4UIT A;  4UYD A;  4YH4 A;  4YBM A;  3SVG A;  2OO1 A;  4LYS A;  5BT4 A;  5FFY A;  4CUU A;  5ENF A;  2D9E A;  4QBM A;  4Y03 A;  4O78 A;  4TT6 A;  5CU8 A;  4QSW A;  2OSS A;  4PTB A;  4O7B A;  2OUO A;  2YDW A;  4NS5 A;  5KU3 A;  2E7O A;  4CFK A;  5I86 A;  4OGJ A;  4TT2 A;  4CUR A;  4PY6 A;  5L8U A;  4QSQ A;  3IU6 A;  5F1H A;  5EA1 A;  5EV9 A;  5DLZ A;  4NR4 A;  4YYI A;  4OUF A;  2WP1 A;  4A9F A;  4QY4 A;  4J1P A;  4TYL A;  4X2I A;  5II2 A;  4LYI A;  3JVL A;  5HCL A;  5IGK A;  4PCI A;  4PS5 A;  2DVV A;  5CQT A;  4UIW A;  4NR6 A;  3MB4 A; 
#chains in the Genus database with same CATH topology
 3LXJ A;  3UVX A;  3MXF A;  3Q2F A;  5F62 A;  3AAD A;  5E9L A;  5FG5 A;  2E7N A;  4ALG A;  4A9I A;  3D7C A;  4YAX A;  3I3J A;  4HXS A;  3U5J A;  5H1T A;  5DFB A;  4BW2 A;  3ONI A;  3IU5 A;  5I80 A;  5HJC A;  5LJ1 A;  2D82 A;  5ACY A;  5FE8 A;  4LZ2 A;  3QZV A;  5BT5 A;  5CGP A;  3G0L A;  5DYU A;  4YAT A;  2KTB B;  4AKG A;  1X0J A;  5ETD A;  4QSS A;  4NR9 A;  5CQ7 A;  5FFV A;  5KHM A;  5D3P A;  3U5L A;  4HXR A;  4QC3 A;  4AI6 A;  4LYW A;  5CTL A;  1WUG A;  4OGI A;  4UYF B;  5EVA A;  5A5N A;  4CUQ A;  5EQ1 A;  4NQN A;  3FKM X;  5CQ5 A;  5CUD A;  5CUA A;  3DWY A;  2LSP B;  4J3I A;  4QSP A;  4YYK A;  2RS9 B;  5FG4 A;  4A9M A;  5EI4 A;  3K2J A;  5K29 A;  3MUL A;  3MQM A;  5I88 A;  4YBT A;  5DYC A;  5HFR A;  5DKH A;  5LKZ A;  5AMF A;  3LQJ A;  4PCE A;  4LRG A;  5E73 A;  4YAB A;  5C8G A;  4NYX A;  4NUE A;  4UIU A;  5HRV A;  3U5P A;  4NRB A;  4UIX A;  2R0S A;  4QR5 A;  5I40 A;  4HXO A;  4IR4 A;  5D26 A;  2GRC A;  4O71 A;  3RCW A;  4UIZ A;  4QEV A;  4YYG A;  4HXP A;  1F68 A;  5DKD A;  5DYX A;  4O7C A;  2RFJ A;  5CRZ A;  4QNS A;  5CZG A;  3UV5 A;  4A9N A;  5FE3 A;  2DWW A;  5FE9 A;  4IOR A;  2YEL A;  2E3K A;  4KV1 A;  4QR4 A;  3O34 A;  4N4G A;  4QSV A;  5A5O A;  4WHW A;  5I29 A;  2DVR A;  4YH3 A;  4NR5 A;  3GG3 A;  5ENH A;  5EPR A;  2I8N A;  4NUD A;  5E74 A;  4KCX A;  3AQA A;  2YW5 A;  5IGN A;  4QR3 A;  5EGU A;  5J0D A;  2WP2 A;  4ZQL A;  3UVW A;  3ZYU A;  5HM0 A;  2L84 A;  2FSA A;  2R10 A;  4O72 A;  3JVM A;  2YQD A;  5D3L A;  2G4A A;  2DKW A;  4QUT A;  4A9O A;  2L5E A;  2EJN A;  4HBV A;  5LJ0 A;  5DFC A;  5LKU A;  3UW9 A;  5FE5 A;  5IGM A;  3QZS A;  3VKG A;  5I1Q A;  5I89 A;  5FBX A;  3HME A;  4BJX A;  4HBY A;  5CQA A;  5C87 A;  3QZT A;  3UV2 A;  5LVR A;  3D1B A;  4TT4 A;  4RVR A;  5CP5 A;  3O35 A;  3U5N A;  4QST A;  4NXJ A;  5FH7 A;  4IOQ A;  4HBW A;  5EK9 A;  4YYN A;  5I83 A;  4XY9 A;  4UYH A;  5F2P A;  3U5M A;  4A9E A;  5F25 A;  4F3I A;  4TS8 A;  3VKH A;  4CL9 A;  4YK0 A;  4NR8 A;  4IR5 A;  4QYL A;  3DAI A;  4E96 A;  4MR4 A;  4BHW A;  4LC2 A;  5G4S A;  5FE7 A;  3JVK A;  3LQH A;  4O70 A;  3O33 A;  5CQ3 A;  5CQ6 A;  4O77 A;  5L8T A;  4TQN A;  5F63 A;  5D3J A;  5DLX A;  5E3G A;  2MJV B;  3UVY A;  4N4H A;  4Z93 A;  5EPB A;  4ZC9 A;  1EQF A;  3O37 A;  4QSR A;  4UIY A;  3U5O A;  4Z6I A;  5D24 A;  4CUP A;  5A85 A;  5AD3 A;  5L96 A;  5F5Z A;  5FE2 A;  5HLS A;  5HQ6 A;  4QEW A;  3JVJ A;  5E9I A;  4UYF A;  4TTE A;  4C67 A;  5F61 A;  5EWV A;  5I7Y A;  5DBM A;  5CFW A;  5ENC A;  5I7X A;  2RNX A;  2RI7 A;  5HRX A;  5HQ7 A;  4N3W A;  5FH8 A;  4BW4 A;  5D3R A;  2L85 A;  5FDZ A;  5E0R A;  4ALH A;  2F6N A;  5E9Y A;  4NYV A;  5DFD A;  4QZS A;  5JWM A;  4TZ2 A;  5E7D A;  4WHU A;  2DVS A;  5D3T A;  4UIV A;  5AME A;  3P1D A;  3Q2E A;  5HRW A;  5AD2 A;  3P1E A;  4TU4 A;  3SVH A;  4J0S A;  5H1U A;  4HBX A;  4A9L A;  4TZ8 A;  4MR6 A;  4Q0O A;  4O74 A;  4UYE A;  3ERR A;  4GPJ A;  4HXM A;  4N4I A;  5E9K A;  5II1 A;  4QC1 A;  5A82 A;  5CUG A;  4HXN A;  4QEU A;  3SVF A;  4CLB A;  4J0R A;  2N9G A;  5DYA A;  5E9V A;  4C66 A;  4AKN A;  5CUC A;  5IGL A;  1N72 A;  4MEO A;  3P5O A;  5D3S A;  5F60 A;  5FB0 A;  5TCM A;  5LJ2 A;  5KTW A;  2R0Y A;  4O7E A;  4O7F A;  4A9J A;  2DVQ A;  5KTX A;  5C7N A;  1ZS5 A;  5ENB A;  4MEN A;  5EIS A;  2H60 A;  1E6I A;  3P1C A;  5C89 A;  5C85 A;  4QYD A;  5ENJ A;  5ETB A;  3UVD A;  4YY4 A;  4O75 A;  5EWC A;  5L99 A;  4Z6H A;  3G0J A;  4NUC A;  5FB1 A;  4HXK A;  5EWH A;  2F6J A;  4Z1S A;  5IID A;  5LVQ A;  5A5S A;  5FE4 A;  1WUM A;  4ZW1 A;  2R0V A;  5KO4 A;  5EWD A;  4QUU A;  4QB3 A;  4LZR A;  4DON A;  5F1L A;  2RNW A;  4YC9 A;  4QSU A;  5FFW A;  5ENG A;  5DKC A;  4QSX A;  3HMF A;  5G4R A;  4BW3 A;  4CFL A;  5A83 A;  4HXL A;  5E9M A;  3S92 A;  4IR6 A;  5A7C A;  5IBN A;  4IOO A;  5CRM A;  3HMH A;  2YYN A;  4MEQ A;  5KTU A;  4MEP A;  5ENE A;  5FE0 A;  5D3N A;  4YAD A;  5LUU A;  5EPS A;  4FLP A;  3MB3 A;  5LKX A;  5EIC A;  4NRA A;  4NQM A;  5A5Q A;  4N4F A;  4XY8 A;  4YYH A;  3MUK A;  4NR7 A;  5ENI A;  5FE1 A;  4O7A A;  5DW1 A;  5C4Q A;  5L97 A;  5FG6 A;  5H85 A;  3P1F A;  5HFQ A;  4UYG A;  3O36 A;  3TLP A;  5D7X A;  5EM3 A;  5HEN A;  5D0C A;  5A5P A;  5D25 A;  4LZS A;  2YEM A;  4YYJ A;  4Q0N A;  4YYM A;  4TU6 A;  5HQ5 A;  5CQ8 A;  3S91 A;  4YYD A;  5CQ4 A;  2YEK A;  5HEM A;  3LJW A;  4XUA A;  5CS8 A;  5COI A;  4A9K A;  1JSP B;  5DX4 A;  5CUE A;  5DY7 A;  5EU1 A;  2I7K A;  5CUB A;  4NYW A;  4IR3 A;  4AKH A;  5A81 A;  5H1V A;  5LKT A;  4KV4 A;  5BT3 A;  5TB6 A;  4XYA A;  4XUB A;  4Z1Q A;  4PKL A;  4MR5 A;  5DW2 A;  5A5R A;  5D3H A;  4CUT A;  5L98 A;  4WIV A;  2RNY A;  2RO1 A;  3LQI A;  1JM4 B;  4YY6 A;  5E3D A;  4LR6 A;  5IG6 A;  5EWW A;  4BW1 A;  5CY9 A;  5FH6 A;  5CPE A;  5FE6 A;  5F3A A;  4YBS A;  4CUS A;  4O76 A;  4MR3 A;  4A9H A;  5JI8 A;  3UV4 A;  4NRC A;  4LDF A;  1PUO A;  5EP7 A;  5F36 A;  2NXB A;  3D1D A;  5HEL A;  3NXB A;  3U5K A;  2DAT A;  4UIT A;  4UYD A;  4YH4 A;  4YBM A;  3SVG A;  2OO1 A;  4LYS A;  5BT4 A;  5FFY A;  4CUU A;  5ENF A;  2D9E A;  4QBM A;  4Y03 A;  4O78 A;  4TT6 A;  5CU8 A;  4QSW A;  2OSS A;  4PTB A;  4O7B A;  2OUO A;  2YDW A;  4NS5 A;  5KU3 A;  1ZKR A;  2E7O A;  4CFK A;  4AKI A;  5I86 A;  4OGJ A;  4TT2 A;  4CUR A;  4PY6 A;  5L8U A;  4QSQ A;  3IU6 A;  5F1H A;  5EA1 A;  5EV9 A;  5DLZ A;  4NR4 A;  4YYI A;  4OUF A;  2WP1 A;  4A9F A;  4QY4 A;  4J1P A;  4TYL A;  4X2I A;  5II2 A;  4LYI A;  3JVL A;  5HCL A;  5IGK A;  4PCI A;  4PS5 A;  2DVV A;  5CQT A;  4UIW A;  4NR6 A;  3MB4 A; 
#chains in the Genus database with same CATH homology
 3LXJ A;  3UVX A;  3MXF A;  3Q2F A;  5F62 A;  3AAD A;  5E9L A;  5FG5 A;  2E7N A;  4ALG A;  4A9I A;  3D7C A;  4YAX A;  3I3J A;  4HXS A;  3U5J A;  5H1T A;  5DFB A;  4BW2 A;  3ONI A;  3IU5 A;  5I80 A;  5HJC A;  5LJ1 A;  2D82 A;  5ACY A;  5FE8 A;  4LZ2 A;  3QZV A;  5BT5 A;  5CGP A;  3G0L A;  5DYU A;  4YAT A;  2KTB B;  1X0J A;  5ETD A;  4QSS A;  4NR9 A;  5CQ7 A;  5FFV A;  5KHM A;  5D3P A;  3U5L A;  4HXR A;  4QC3 A;  4LYW A;  5CTL A;  1WUG A;  4OGI A;  4UYF B;  5EVA A;  5A5N A;  4CUQ A;  5EQ1 A;  4NQN A;  3FKM X;  5CQ5 A;  5CUD A;  5CUA A;  3DWY A;  2LSP B;  4J3I A;  4QSP A;  4YYK A;  2RS9 B;  5FG4 A;  4A9M A;  5EI4 A;  3K2J A;  5K29 A;  3MUL A;  3MQM A;  5I88 A;  4YBT A;  5DYC A;  5HFR A;  5DKH A;  5LKZ A;  5AMF A;  3LQJ A;  4PCE A;  4LRG A;  5E73 A;  4YAB A;  5C8G A;  4NYX A;  4NUE A;  4UIU A;  5HRV A;  3U5P A;  4NRB A;  4UIX A;  2R0S A;  4QR5 A;  5I40 A;  4HXO A;  4IR4 A;  5D26 A;  2GRC A;  4O71 A;  3RCW A;  4UIZ A;  4QEV A;  4YYG A;  4HXP A;  1F68 A;  5DKD A;  5DYX A;  4O7C A;  2RFJ A;  5CRZ A;  4QNS A;  5CZG A;  3UV5 A;  4A9N A;  5FE3 A;  2DWW A;  5FE9 A;  4IOR A;  2YEL A;  2E3K A;  4KV1 A;  4QR4 A;  3O34 A;  4N4G A;  4QSV A;  5A5O A;  4WHW A;  5I29 A;  2DVR A;  4YH3 A;  4NR5 A;  3GG3 A;  5ENH A;  5EPR A;  2I8N A;  4NUD A;  5E74 A;  4KCX A;  3AQA A;  2YW5 A;  5IGN A;  4QR3 A;  5EGU A;  5J0D A;  2WP2 A;  4ZQL A;  3UVW A;  3ZYU A;  5HM0 A;  2L84 A;  2FSA A;  2R10 A;  4O72 A;  3JVM A;  2YQD A;  5D3L A;  2G4A A;  2DKW A;  4QUT A;  4A9O A;  2L5E A;  4HBV A;  5LJ0 A;  5DFC A;  5LKU A;  3UW9 A;  5FE5 A;  5IGM A;  3QZS A;  5I1Q A;  5I89 A;  5FBX A;  3HME A;  4BJX A;  4HBY A;  5CQA A;  5C87 A;  3QZT A;  3UV2 A;  5LVR A;  4TT4 A;  4RVR A;  5CP5 A;  3O35 A;  3U5N A;  4QST A;  4NXJ A;  5FH7 A;  4IOQ A;  4HBW A;  5EK9 A;  4YYN A;  5I83 A;  4XY9 A;  4UYH A;  5F2P A;  3U5M A;  4A9E A;  5F25 A;  4F3I A;  4TS8 A;  4CL9 A;  4YK0 A;  4NR8 A;  4IR5 A;  4QYL A;  3DAI A;  4E96 A;  4MR4 A;  4BHW A;  4LC2 A;  5G4S A;  5FE7 A;  3JVK A;  3LQH A;  4O70 A;  3O33 A;  5CQ3 A;  5CQ6 A;  4O77 A;  5L8T A;  4TQN A;  5F63 A;  5D3J A;  5DLX A;  5E3G A;  2MJV B;  3UVY A;  4N4H A;  4Z93 A;  5EPB A;  4ZC9 A;  1EQF A;  3O37 A;  4QSR A;  4UIY A;  3U5O A;  4Z6I A;  5D24 A;  4CUP A;  5A85 A;  5AD3 A;  5L96 A;  5F5Z A;  5FE2 A;  5HLS A;  5HQ6 A;  4QEW A;  3JVJ A;  5E9I A;  4UYF A;  4TTE A;  4C67 A;  5F61 A;  5EWV A;  5I7Y A;  5DBM A;  5CFW A;  5ENC A;  5I7X A;  2RNX A;  2RI7 A;  5HRX A;  5HQ7 A;  4N3W A;  5FH8 A;  4BW4 A;  5D3R A;  2L85 A;  5FDZ A;  5E0R A;  4ALH A;  2F6N A;  5E9Y A;  4NYV A;  5DFD A;  4QZS A;  5JWM A;  4TZ2 A;  5E7D A;  4WHU A;  2DVS A;  5D3T A;  4UIV A;  5AME A;  3P1D A;  3Q2E A;  5HRW A;  5AD2 A;  3P1E A;  4TU4 A;  3SVH A;  4J0S A;  5H1U A;  4HBX A;  4A9L A;  4TZ8 A;  4MR6 A;  4Q0O A;  4O74 A;  4UYE A;  4GPJ A;  4HXM A;  4N4I A;  5E9K A;  5II1 A;  4QC1 A;  5A82 A;  5CUG A;  4HXN A;  4QEU A;  3SVF A;  4CLB A;  4J0R A;  2N9G A;  5DYA A;  5E9V A;  4C66 A;  4AKN A;  5CUC A;  5IGL A;  1N72 A;  4MEO A;  3P5O A;  5D3S A;  5F60 A;  5FB0 A;  5TCM A;  5LJ2 A;  5KTW A;  2R0Y A;  4O7E A;  4O7F A;  4A9J A;  2DVQ A;  5KTX A;  5C7N A;  1ZS5 A;  5ENB A;  4MEN A;  5EIS A;  2H60 A;  1E6I A;  3P1C A;  5C89 A;  5C85 A;  4QYD A;  5ENJ A;  5ETB A;  3UVD A;  4YY4 A;  4O75 A;  5EWC A;  5L99 A;  4Z6H A;  3G0J A;  4NUC A;  5FB1 A;  4HXK A;  5EWH A;  2F6J A;  4Z1S A;  5IID A;  5LVQ A;  5A5S A;  5FE4 A;  1WUM A;  4ZW1 A;  2R0V A;  5KO4 A;  5EWD A;  4QUU A;  4QB3 A;  4LZR A;  4DON A;  5F1L A;  2RNW A;  4YC9 A;  4QSU A;  5FFW A;  5ENG A;  5DKC A;  4QSX A;  3HMF A;  5G4R A;  4BW3 A;  4CFL A;  5A83 A;  4HXL A;  5E9M A;  3S92 A;  4IR6 A;  5A7C A;  5IBN A;  4IOO A;  5CRM A;  3HMH A;  2YYN A;  4MEQ A;  5KTU A;  4MEP A;  5ENE A;  5FE0 A;  5D3N A;  4YAD A;  5LUU A;  5EPS A;  4FLP A;  3MB3 A;  5LKX A;  5EIC A;  4NRA A;  4NQM A;  5A5Q A;  4N4F A;  4XY8 A;  4YYH A;  3MUK A;  4NR7 A;  5ENI A;  5FE1 A;  4O7A A;  5DW1 A;  5C4Q A;  5L97 A;  5FG6 A;  5H85 A;  3P1F A;  5HFQ A;  4UYG A;  3O36 A;  3TLP A;  5D7X A;  5EM3 A;  5HEN A;  5D0C A;  5A5P A;  5D25 A;  4LZS A;  2YEM A;  4YYJ A;  4Q0N A;  4YYM A;  4TU6 A;  5HQ5 A;  5CQ8 A;  3S91 A;  4YYD A;  5CQ4 A;  2YEK A;  5HEM A;  3LJW A;  4XUA A;  5CS8 A;  5COI A;  4A9K A;  1JSP B;  5DX4 A;  5CUE A;  5DY7 A;  5EU1 A;  2I7K A;  5CUB A;  4NYW A;  4IR3 A;  5A81 A;  5H1V A;  5LKT A;  4KV4 A;  5BT3 A;  5TB6 A;  4XYA A;  4XUB A;  4Z1Q A;  4PKL A;  4MR5 A;  5DW2 A;  5A5R A;  5D3H A;  4CUT A;  5L98 A;  4WIV A;  2RNY A;  2RO1 A;  3LQI A;  1JM4 B;  4YY6 A;  5E3D A;  4LR6 A;  5IG6 A;  5EWW A;  4BW1 A;  5CY9 A;  5FH6 A;  5CPE A;  5FE6 A;  5F3A A;  4YBS A;  4CUS A;  4O76 A;  4MR3 A;  4A9H A;  5JI8 A;  3UV4 A;  4NRC A;  4LDF A;  5EP7 A;  5F36 A;  2NXB A;  5HEL A;  3NXB A;  3U5K A;  2DAT A;  4UIT A;  4UYD A;  4YH4 A;  4YBM A;  3SVG A;  2OO1 A;  4LYS A;  5BT4 A;  5FFY A;  4CUU A;  5ENF A;  2D9E A;  4QBM A;  4Y03 A;  4O78 A;  4TT6 A;  5CU8 A;  4QSW A;  2OSS A;  4PTB A;  4O7B A;  2OUO A;  2YDW A;  4NS5 A;  5KU3 A;  2E7O A;  4CFK A;  5I86 A;  4OGJ A;  4TT2 A;  4CUR A;  4PY6 A;  5L8U A;  4QSQ A;  3IU6 A;  5F1H A;  5EA1 A;  5EV9 A;  5DLZ A;  4NR4 A;  4YYI A;  4OUF A;  2WP1 A;  4A9F A;  4QY4 A;  4J1P A;  4TYL A;  4X2I A;  5II2 A;  4LYI A;  3JVL A;  5HCL A;  5IGK A;  4PCI A;  4PS5 A;  2DVV A;  5CQT A;  4UIW A;  4NR6 A;  3MB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...