4N4GA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
209
Chain Sequence
b'NKQEMGTYLRFIVSRMKERAIDGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 63
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4gA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4gA02
4KCXA 5KHMA 2CKKA 2O4XA 3OYGA 5EA1A 2RHXA 5ENGA 4J0SA 4LYSA 2N9GA 3OYIA 4Q0OA 3UV5A 2OUOA 5IIDA 5KTWA 5LKUA 2RHYA 3BDLA 2X4WA 4TZ2A 5D6YA 4QEWA 5H1UA 5EPRA 3L2WA 2X4YA 5E9KA 2EQKA 4QBMA 5D3HA 5TB6A 3E9FA 5L99A 5KU3A 2YELA 5FE0A 5DYCA 4N3WA 2R57A 5HEMA 3OMCA 2F6NA 2LDMA 1EQFA 2RNYA 3QZVA 5IBNA 4E96A 3DB3A 4PLIA 3Q2EA 4CRIA 2G3RA 4HXKA 4NR6A 1E6IA 5FE2A 2FHDA 3LLRA 2RJCA 3OYMA 5EWWA 5IG6A 5A5SA 4LYIA 1XNIA 5LKTA 3GG3A 4E7JA 4YH4A 4J3IA 4YABA 5I40A 5CQ3A 2EQMA 4LRGA 4UYFA 4BDYA 4NUEA 4UYDA 4YC9A 3O34A 4QEUA 3S92A 4A4GA 4NYWA 4OGIA 1WGSA 4FL6A 5C8GA 2YEMA 4LC2A 5LJ2A 1OZ2A 4YYMA 4MEOA 4UIZA 4QSTA 5F62A 3UVXA 4IUPA 4TS8A 5HM0A 5HLSA 5KE2A 5J39A 4ALGA 4BE0A 3META 2DVVA 3FKMX 5E9VA 2R5AA 3U5LA 1JM4B 3LJWA 4HBXA 3QZSA 2BKDN 3P8HA 5FG6A 3MP6A 4BACA 2KTBB 5L97A 5I80A 5CQ7A 3TLPA 5C85A 1JSPB 3MQMA 3PMTA 2YW5A 4ZQLA 3OMGA 5EV9A 3MEUA 3OYEA 1H3ZA 5ENBA 5FFVA 5A5OA 5EPSA 3C4SA 5CUEA 3OA6A 4YY4A 5IGKA 2YRVA 4IURA 3MP1A 3M9QA 3MB4A 5CRZA 4NUCA 4CUQA 2GF7A 2QQRA 4OGJA 5D3PA 4B9XA 2XK0A 4QR5A 4CFKA 2GFUA 5G4SA 5IGLA 4NR9A 5F61A 3U5PA 3CEYA 2EKOA 4YBMA 4HXMA 5ENFA 3OYBA 5D3JA 4QEVA 4UIYA 5BT5A 3QIIA 4B9WA 5FE9A 4A9KA 4X34A 5CUGA 4QSRA 4HCZA 5DYAA 5HRXA 4QR3A 5H1TA 2WP2A 3OS1A 4NR4A 4UYEA 2G4AA 4UIWA 4LZRA 5F5ZA 4C66A 3O8VA 4A9MA 3MP8A 2JTFA 4A9IA 4C5EA 4BDZA 2M16A 5FBXA 1WJQA 4J1PA 4A9OA 4A9NA 5LJ1A 2LSPB 2WP1A 5DFCA 2E6NA 4IR4A 4F3IA 4A4EA 5KO4A 5FG5A 1N72A 4E7LA 4QYLA 4Y03A 2P0KA 5M9OA 3UV2A 3LGFA 5D3LA 3SD4A 1WJRA 5KCOA 4GY5A 5BT4A 4NQMA 2FSAA 3DAIA 3MULA 3OYKA 3JVMA 5D26A 3IU6A 4TZ8A 4CUUA 2B8AA 3UVYA 4YYGA 4MR3A 2I8NA 2D9EA 3L2RA 4UIUA 5L8UA 3P8DA 4PKLA 2XDPA 5D6XA 3UT1A 5G4RA 2E7NA 4UYHA 5E0RA 5FB0A 5HQ5A 2GFAA 2MJVB 3P1DA 5DW2A 4HBWA 4AKNA 4YYNA 2NLUA 5CQAA 3I3JA 4UC4A 4LZSA 5CZGA 3OYJA 3K2JA 3JVLA 4IKFA 2IG0A 3S6WA 4QB3A 5DYXA 4XUAA 4CUTA 5I89A 5CTLA 5CQ4A 4CFLA 2QQSA 3O37A 2DIGA 4HXLA 2MWOA 2RJFA 5I7XA 3F70A 5ENIA 3E9GA 5DFDA 4ZC9A 2DIQA 5C0MA 5ENCA 4NR5A 4TQNA 1X0JA 3U5OA 5A5PA 3U5JA 5COIA 4GPJA 4C5HA 3FEOA 4NXJA 5EISA 4XYAA 5ENHA 4QVZA 3NTKA 4LD6A 5FH8A 5I83A 4YATA 3QJ6A 5FRMA 4QQGA 5LKXA 3FC3A 4FLPA 5C7NA 3NXBA 4UYFB 4PCIA 5IGNA 5HQ6A 4TU4A 4NRAA 2X35A 5IAYA 3U5NA 5LKZA 5LVRA 5ENEA 5FG4A 4IUUA 3JVKA 5AD3A 4BE2A 4HXNA 3LH0A 3LGLA 5DFBA 2K3XA 4BD3A 5HFQA 2L84A 1WUGA 2RHZA 3O33A 4XY8A 4YAXA 4YYDA 3LX7A 5C87A 5KH6A 3KUFA 4TT4A 1OI1A 1OZ3A 4A9HA 2DKWA 4O7CA 5CQ6A 5EVAA 4QSUA 5F2PA 4HXSA 5C4QA 4A9EA 4HBYA 5F63A 5JI8A 2MWPA 5F36A 4CLBA 4O70A 4YYJA 5HENA 4KV1A 4XUBA 3LQJA 5JWMA 2RHIA 4NYVA 4O74A 4C5IA 4QSQA 5CGPA 5FE7A 4TTEA 3PNWC 5E74A 4Z1SA 5J26A 3LQIA 4QC1A 5E73A 4YBSA 2LRQA 5D3SA 2LCCA 3L2QA 2RNWA 3LQHA 5A5QA 2L89A 2E3KA 5DKDA 5L8TA 5LUUA 2HQEA 5CP5A 4QNSA 4QSPA 5I88A 5HFRA 5D3TA 4HXRA 3ONIA 4TYLA 4CURA 2RI5A 4HBVA 3HMHA 5E9MA 5H1VA 5D3RA 5A7CA 3DWYA 5E7DA 4Z02A 5FFYA 1F68A 3OYCA 4O71A 4UYGA 5CUBA 3OB9A 4QY4A 5FE6A 4II1A 4IUTA 4A4HA 4N4IA 4BJXA 4O7EA 5CIUA 3UWNA 4Z6IA 5DLZA 3MEWA 4IUVA 2GRCA 4C67A 4A9JA 3OYLA 3S91A 1WUMA 2H60A 3QZTA 2BUDA 3EAEA 2OSSA 5EGUA 5H85A 2RO0A 4QW2A 4MR4A 5A5NA 2F6JA 5FE4A 1ZS5A 3OQ5A 3MUKA 4PS5A 2L8DA 4PLLA 3P5OA 3OS2A 2EQUA 3PFSA 4Z1QA 4BHWA 4QSSA 5E3GA 2DWWA 5FH7A 3ME9A 4O76A 5KCHA 1RI0A 4IOOA 4QSXA 4YYHA 3O35A 2E7OA 4J0RA 5EICA 3OYFA 4O7BA 5D3NA 5D7XA 3UW9A 5I7YA 2M1HA 5CQTA 2R0VA 3G0JA 3NTHA 4C5GA 5CQ5A 5FRNA 4HXPA 4O7FA 4WHUA 5ENJA 5EWCA 3ZEHA 5E9YA 3D7CA 3IU5A 4TU6A 5EPBA 4WIVA 5FE3A 4QUTA 5D0CA 4NS5A 5DX4A 4BW3A 5HRWA 3O36A 4O77A 4A9FA 5ETBA 4OVAA 5A85A 3DB4A 3S3OA 4E7IA 3AADA 4BE1A 5D24A 4PTBA 2HQXA 5DKHA 1WJSA 4MEPA 4NR7A 2D9TA 2RI7A 3Q2FA 4CUPA 4MR5A 4E7KA 2YYNA 2EFIA 4ALHA 4NRBA 3MEAA 3MB3A 3ZYUA 3SVFA 2R58A 2JZ2A 4YYKA 2EQJA 3QBYA 4PCEA 5TCMA 2RS9B 3OYDA 4YK0A 4A4FA 3SVGA 2WACA 5BT3A 4IOQA 4PL6A 5IGMA 5F3AA 5L96A 5D6WA 3L42A 3LXJA 3L2UA 5CPEA 5LJ0A 4UIXA 2RHUA 5EM3A 4QQ6A 2RI3A 5II1A 3FLGA 5FE5A 4UITA 4LZ2A 5EQ1A 5EWHA 3RCWA 4CL9A 3SVHA 5I29A 2RJEA 3UVWA 3NTIA 4RG2A 4QYDA 4QZSA 3HMEA 5FE1A 3S3NA 3AQAA 5FH6A 1G5VA 2RJDA 2RFJA 5EWVA 2X4XA 4IR5A 2DVSA 5DBMA 4IORA 5C89A 1MHNA 2LTOA 2R0YA 4A9LA 5CUDA 3UV4A 2R5MA 4QQDA 4Z93A 5A82A 3MXFA 5AMEA 3S3MA 2K3YA 4Q0NA 3GOXA 4BW2A 4MEQA 1N27A 5CUCA 4L59A 4CUSA 5EWDA 4QUUA 3ASKA 3OY9A 4NUDA 4FU6A 4Z6HA 5F60A 3Q1JA 5KE3A 4N4GA 5II2A 4YY6A 5F1HA 2M0OA 4IR6A 4QC3A 3MEVA 5LVQA 2E5QA 5D25A 4O7AA 5A81A 2BIVA 3U5MA 2DVRA 2R0SA 4IUQA 2NXBA 4BW1A 3OYNA 1KHCA 5C6SA 2L5EA 4UIVA 3OYAA 4N4FA 2YDWA 3DLMA 5CY9A 2YQDA 4HXOA 2PQWA 5HRVA 4O78A 4QSVA 4KV4A 5L98A 5AMFA 2R10A 4LDFA 5CQ8A 5FDZA 3OS0A 4TT2A 5DKCA 5EI4A 5CS8A 4LR6A 3PMIA 5DLXA 2OO1A 5FE8A 4EDUA 3UVDA 4OUFA 1OYXA 4ZTFA 4NQNA 4E7HA 5F1LA 4TT6A 5A83A 4MR6A 5HJCA 4PY6A 5K29A 4YBTA 5DY7A 5IN1A 3H8ZA 4RVRA 3P1EA 2D82A 4NRCA 5CRMA 5HELA 4QR4A 5ETDA 4NR8A 5CFWA 3FDRA 5CU8A 5FB1A 4YADA 2RO1A 5I86A 5FFWA 5AD2A 2YEKA 3HMFA 4O72A 2DATA 3MO8A 3OYHA 4DONA 5KTUA 5CUAA 5HQ7A 2L3RA 2RI2A 3U5KA 3P1FA 3G0LA 3H6ZA 5J0DA 2VYTA 4NYXA 5FROA 2F5KA 5E3DA 5DYUA 4XY9A 3JVJA 4YH3A 4QSWA 2DAQA 4ZTJA 5ACYA 2LVMA 4ZW1A 3P1CA 5A5RA 5DW1A 5F25A 4BW4A 5I1QA 4X2IA 4YYIA 3L2VA 2RNXA 2O4XB 3LYIA 4IR3A 4N4HA 5E9LA 2I7KA 2L85A 5EU1A 5EK9A 5KTXA 5HCLA 3QKJA 4WHWA 1SSFA 4MENA 5EP7A 4Q5WA 4O75A 4LYWA 5E9IA 2DVQA
chains in the Genus database with same CATH superfamily
4KCXA 5KHMA 3OYGA 1QW1A 3HPWA 5EA1A 5ENGA 4FYYB 4NL3A 4Q0OA 1UG1A 5IIDA 2LQWA 3BDLA 1D1AA 4M7AC 4M7AG 4TZ2A 5I2MA 4DOWA 5EPRA 2MOXA 1RUWA 5E9KA 3EG9A 4PKCC 1YJWQ 1OPLA 5LJ5j 1VQPT 3I55T 2YELA 1KSWA 5FE0A 3A8GB 5DYCA 3TQ7P 3G4ST 4M7AE 4N0AC 1RAIB 3CCRQ 1YHQA 2RNYA 3CMEQ 2EGAA 1YJ9Q 3H0FA 1TXQA 4HXKA 1E6IA 5FE2A 2FHDA 2RJCA 2HQHA 4LYIA 2V1RA 2JVVA 3C12A 4E7JA 4YH4A 4HVWA 3CCUT 5CQ3A 1X27A 2ZPBB 2JXBA 4ZN3A 2NUPB 3O34A 4NYWA 4OGIA 1WGSA 4FL6A 5C8GA 2YEMA 3QYHB 1K8AR 1E6HA 5LJ2A 5GAMd 4UIZA 1WDXA 8AT1B 4C0DC 3VKHA 2A0FB 3FKMX 2PTKA 2R5AA 3META 1QVFS 1JM4B 3CCQT 1VQ4Q 2XDBA 3LJWA 4HBXA 3QZSA 1NZ9A 1XTDA 2D0QB 5FG6A 4PJOA 5I80A 3PMTA 3TLPA 2KROA 1JJ2S 2YW5A 2HAXA 3MEUA 3VS4A 3CCSQ 4DEYA 2D8JA 5GMKe 3VRYA 1TOVA 2OAWA 2LQKA 2YRVA 3M9QA 4Z8AA 2DETA 1VQOQ 5CRZA 4NUCA 3V7RA 4B9XA 4QR5A 4CFKA 3CMAA 1M2VA 1UDLA 3EH1A 2EKOA 1Y57A 4UIYA 1LNXA 1B34A 4ELYC 4B9WA 3ERRA 4A9KA 1ZSZC 4X34A 4YTLA 3CCLQ 1MMNA 4A54A 4M7AA 4ME7A 3MJXA 1OU8A 3BDUA 2BE7D 4LZRA 2JTFA 2JNGA 5FBXA 1I5LA 1VYVA 2DTOA 3M0QA 4J1PA 2E65A 5LJ1A 5CKHA 2WP1A 5DFCA 1AWJA 1VQ7T 4Y28E 5KO4A 1N72A 5FU7B 1IHWA 5CCAA 2P0KA 3UV2A 3LGFA 3SD4A 2DVEA 1Y0MA 3I5RA 4JLIA 3DAIA 3EHRA 5D26A 1Y96B 4AKHA 2B8AA 3QSUA 3HRUA 3CC7A 3CPWS 2RA2A 4HCKA 2YUNA 2D9EA 4UIUA 5L8UA 1W6XA 2XDPA 3CC2T 4OB0B 5G4RA 2GFAA 4M7DD 1S72Q 1S1NA 4UC4A 3I3JA 3EG9B 1K1ZA 3PVQA 1NPRA 3V7SA 4CFLA 3M5AA 2DIGA 4M77E 1KQSA 1KQ2A 2GBQA 3U5JA 2K7AA 1WHHA 4XYAA 5ENHA 4LD6A 1M30A 4YATA 1Q81U 5FRMA 2P4TA 4QQGA 5LKXA 3FC3A 4NOYA 5FU6C 1X6GA 5KYNA 1UGSB 1VQ9A 4PCIA 5HK0A 2X35A 5IAYA 5LVRA 2RNAA 5AD3A 1G2BA 2Y4YA 1VQ6Q 4RTVA 2VXEA 5GAN5 1WUGA 4XY8A 2MPXC 5C87A 3TU4K 3G7ZA 2DKWA 5EVAA 4A63B 4PJOB 4HXSA 2CP2A 2MWPA 4A9EA 1WYXA 4CLBA 1KQSP 2VGMA 4YYJA 2QG9B 3VUZA 3VYGA 1HJDA 1IREB 2RHIA 1NEBA 3CCVA 4C5IA 4QSQA 5FE7A 4Z89A 1MV3A 5J26A 3LQIA 4QC1A 2LRQA 5D3SA 1M2VB 2JOYA 1TWBA 4FW2A 3L2QA 3P8BB 1MGQA 2KQWA 2E3KA 5DKDA 5KYXA 1YCSB 2E41A 2BTTA 4QSPA 3QZ9B 5D3TA 4HXRA 4TYLA 3QG1A 1Q81C 3HMHA 3H0IA 1VQMA 1B34B 5A7CA 3DWYA 1UGRB 2WSFE 3A8OB 3CMAT 2COZA 4UYGA 3OB9A 4M7AB 2YLBA 1SPKA 1KFZA 2E3IA 2EBPA 4M77A 2A28A 1V1CA 4L5GA 4A4HA 3UWNA 1QKXA 1H641 5A0DA 1PKTA 3CC4Q 4Z6IA 4KH0B 5DLZA 3MEWA 1YJ9A 2XG8D 2IPOB 4C67A 2J06A 4A9JA 3OYLA 3S91A 1Z9QA 2KI7A 2C0TA 1RADB 1ZS5A 1JO8A 2DJQA 3OQ5A 2XI9A 4PLLA 1B3QA 2GTOA 2RN8A 3OS2A 2EVRA 3JCMQ 4Z1QA 3ME9A 3OSVA 1OU9A 2H3EB 1IGQA 2W10A 4E2FB 1WI7A 2F69A 2E7OA 2PVOB 5HKCA 4O7BA 1VQ4A 1SHGA 4C0DB 3CC7T 4XU3A 1BCOA 5GANj 2HCKA 2VB6A 4C5GA 4MZPA 3A8LB 5AT1B 3D7CA 3IU5A 1WX6A 3PVLA 3CCJA 2C06A 3JV3A 4QUTA 5D0CA 5LJ5e 1VQOA 4BW3A 3L2ZA 3DB4A 1M3AA 4E7IA 2EJNA 5D24A 5DKHA 4MEPA 2J05A 1Q95G 2HSEB 3Q2FA 4CUPA 1RACB 4E7KA 1RAHB 4CC4B 1VUBA 4C92C 4ALHA 4C92G 1NYGA 2CUDA 4Z88A 2R58A 2EQJA 4OB3B 3JCMJ 1KIKA 2RS9B 1ZSZB 3OYDA 1VQ9T 4JPBW 4C92E 2WACA 2KAFA 2RQVA 1M90U 4V2SA 5IGMA 5F3AA 2L5QA 3LXJA 3QWYA 5CPEA 5LJ0A 2PVGB 3OSSC 1EIFA 2LCSA 4C0ZA 2VASA 2D1XA 2DD5A 4UITA 1U06A 4MDWA 1VYTA 4OMQA 4QYDA 2PZ1A 4HXJA 3M0PA 5FH6A 1JRIA 5EWVA 2X4XA 1K0XA 1ZSGA 1PC0A 5HCKA 5C89A 2KY9A 4A9LA 4GLMA 3VJPA 2DL4A 4WF2A 5A82A 3X20B 3CBOA 2AKLA 4MEQA 3D7SB 2KNBB 4RTTA 4LDYA 3ASKA 3WVEB 5LJ3j 5F60A 4RTYA 5KE3A 2AT1B 1WIEA 4BI8B 1WZOA 3G6EQ 5II2A 3GP8A 2M0OA 2OTJQ 3E2UA 3MEVA 2M9UA 4O7AA 2BIVA 4F17A 3U5MA 2DVRA 2R0SA 4J6WA 4JRIA 2RM4A 5KYUA 4JJBA 1CKAA 4KT0E 1VQMT 4RG8A 4FSXA 3ZL7C 4M78F 2EJFA 3VS7A 1H8KA 2CP5A 3OYAA 2EYWA 5HK3A 5A0GA 2BZXA 1M90C 2YDWA 1D3BA 3I5SA 2MI6A 4O6JA 5GMKj 4KV4A 4A53A 5AMFA 2F2WA 1BIAA 4J9FA 3GBQA 1QVFA 5CS8A 2CH4A 5FU6B 3PIPA 5DLXA 2P4RA 1K0SA 2DLPA 1JJ2A 2VVKA 4NQNA 4DBHA 4RKUE 4TT6A 1E6GA 1RI9A 4C92A 4MR6A 1G8XA 5GAMg 3GF5A 4PY6A 4YBTA 2MIOA 4KUIA 3P1EA 2OX7A 2CP3A 3CBPA 4AG2C 3FIFA 5CFWA 4HCCA 3OBYA 3QHSA 4YADA 1QQJA 5FLXE 2ABLA 3I56T 5I86A 3EG0A 2YEKA 2QA4A 3OYHA 3MO8A 1P92A 2L2PA 1VQ4T 3G0LA 3EFOB 1VQ8Q 3PIOA 3KBGA 1HD3A 5J0DA 4J6XA 4KUDK 1C0MA 1GRIA 4HVVA 4BW4A 3CCJT 3L2VA 1VQOT 2MF2A 4N4HA 1JJ2P 1FWZA 5EU1A 4F7UA 1HYOA 1X2KA 3QKJA 1K73R 4WHWA 2LNVA 5EP7A 4Q5WA 4LYWA 5LKZA 5E9IA 2DVQA 2CKKA 1DJ7B 1NYFA 1YWPA 4LYSA 2N9GA 3UV5A 5KTWA 2O2OA 3D1BA 4PJNA 3EFSA 4QEWA 3L2WA 2EQKA 3TSWA 2FPFA 5IHNA 4QBMA 5TB6A 3CPWA 5KU3A 3RERA 3OMCA 1YI2A 2F6NA 1Q86U 2LDMA 1M4ZA 4F14A 1EQFA 3QZVA 2CT4A 5IBNA 2ZZDA 1UECA 3O5ZA 2F2XA 1PM3A 3LLRA 5IG6A 2OTLA 5A5SA 2HBWA 2KE9A 1XNIA 1Q7YR 4E7SA 5CR2A 4J3IA 1RL2A 5I40A 2CUBA 4JS5A 2A37A 1GBRA 4BDYA 4NUEA 3JCMe 4QEUA 2AK5A 3CCMT 1GCQC 5KYUB 4YYMA 2LQ8A 2KK4A 4IUPA 3HHTB 1X69A 4AFUC 4BE0A 3UA6A 3U5LA 3LWHA 1GFDA 1M1KR 2BKDN 5L97A 1D3BB 3ULRB 4ZQLA 3OMGA 3SHWA 1W70A 1X01A 4AFQC 5FFVA 3C4SA 2RPNA 4YY4A 5IGKA 1WNLA 3MB4A 3RKXA 1Q86C 4CUQA 2GF7A 2AZSA 2GTJA 2MAMA 2XK0A 2SRCA 2RMOA 4RCCA 4C92B 2EPDA 5IGLA 4NR9A 1WPYA 4ELZC 4M78C 2EKHA 1UEBA 4M78G 4DOVA 2D6FA 4M7DC 1FXXA 2M0YA 3LH5A 5FE9A 4M7DG 4J7IA 5CUGA 4QSRA 3I9QA 2CP7A 4HCZA 1M8VA 1G3SA 2W0ZA 1AWXA 3R6OA 4M78E 2A08A 1K9MR 4NR4A 4M7DE 1BB9A 1WXUA 3EHQA 4C66A 3O8VA 4A9MA 3MP8A 5GANe 2PNIA 4BDZA 2RB6A 2M16A 1VQNQ 4AMCA 2OJ2A 3QUIA 2IIMA 2QA4T 2CZ0B 2JTEA 2K57A 4E7LA 3QYGB 3RR6A 4Y03A 5M9OA 3M4GA 5BT4A 4NQMA 3FJPA 2ATCB 2EJGA 3G6EA 4WCIA 3IU6A 2DFUA 1YIJA 1ZUYA 3C0CA 2AIRB 3ZFJA 5D6XA 3ZBDA 1QVGS 2K5FA 1Y96A 3P1DA 2NLUA 3G71Q 4LZSA 5CZGA 2DILA 5D7UA 3K2JA 3S6WA 2NWMA 4QB3A 1XOVA 4KH1B 1WQWA 5I89A 5CQXA 1RLQC 2V26A 2C0OA 3O37A 3X24B 3F70A 4WTOB 5DFDA 5L8RE 1ACMB 2DIQA 2Y4XA 3U23A 5C0MA 2CZ6B 1N8RR 3U5OA 2HL3A 4C5HA 3FEOA 5EISA 1ZBXA 1UGVA 2M02A 2DKGA 2KT1A 5IXFA 1YI2T 1T0HA 3BFMA 1I0CA 2E5KA 2DF6A 3NXBA 4X9CA 1QP2A 2DERA 4NRAA 3U5NA 2OTLT 2CZ1B 5ENEA 3JVKA 2ESWA 2ZAEA 4BE2A 4HXNA 5DFBA 1RAFB 4FW1A 4BD3A 2CREA 5KYYA 3CD6Q 2DL5A 2FRWA 5LJ3e 4M7DA 3O33A 4YYDA 3GLXA 2K5LA 3HKSA 2YSQA 3EGUA 4JUVA 1VOMA 1VQ8A 5F2PA 3EFRA 5CKEA 5JI8A 4HBYA 5F36A 1R8OB 3H9NA 4O70A 1KJWA 3I35A 4IIOA 1ABQA 3SDZA 4O74A 1G83A 1VQLT 3PNWC 4TTEA 5CQYA 4Y92A 1SRMA 2FZKB 2X51A 2DTIA 1JU5C 3LQHA 5A5QA 5LUUA 2HQEA 1TUGB 2LC4A 4KBMB 3V8JA 2RI5A 3ONIA 5E9MA 4M75F 2P0PA 4J9DA 1SEMA 4HT8A 3OYCA 1AZGB 4O71A 5GAN8 2J6FA 2MK5A 3HTRA 4QY4A 2CSQA 3HRTA 4CI0C 2DE0X 1VA7A 4II1A 4O7EA 3VYHB 2QTVA 1JBMA 2DVJA 2VXFA 5HY6A 4IUVA 3SFMA 1PD0A 4HA8A 1UFFA 2GNCA 5GAOr 2BUDA 3EAEA 1M5Q1 1KG1A 3WXMB 5EGUA 4N0AA 2E4HA 3DLLA 4J9HA 4D8DA 5GMKm 3EGDA 2LT1A 4PS5A 1RAGB 4LDXA 2KDSA 2LT4A 4QSSA 5GAOq 4OP0A 2HD0A 4XU2A 1AWWA 2QAZA 4QSXA 4FSSA 2DXCA 2DBKA 1IRXA 3G6ET 5D3NA 4M78D 1PUOA 3UW9A 5I7YA 1YIJT 2RF0A 3H0HA 1EX4A 2CGHA 5ENJA 1NBEB 5EWCA 4JJCA 5AYFA 4C8QF 1AEYA 1PCXA 5DX4A 5HRWA 4O77A 2BZYA 5ETBA 3S3OA 2FG0A 2FRYA 1JQQA 1SF9A 4XTXA 4ZNXA 2K3BA 1I5OB 1M1GA 1K8AU 2EFIA 4M78B 3MEAA 1YHQT 5KYYB 1AT1B 2EYYA 1AOJA 2YHTA 4M7DB 4LN2A 5TCMA 3KFVA 2FB7A 1WHKA 2JMAA 4YK0A 3JRZA 5FWCA 5BT3A 1EZZB 4XTYA 1BK2A 2L3SA 5L96A 2YXYA 3X26B 2KRNA 2ZPGB 1NJIR 1PSFA 4NL2A 1MMDA 1ZSZA 4QQ6A 3L1AA 3FLGA 5IHKA 1X75C 5EWHA 4LZ2A 3VKGA 1TUCA 1VIEA 3QWXX 3MCAB 1VQ8T 1EFNA 3C94A 3V8KA 5GAOl 3SEMA 2KYMA 4FT2A 4LXCA 4CC7A 4IORA 2R0YA 3ER0A 2R5MA 1C6VX 1YJNQ 2FZCB 2LJ0A 1D0XA 3HP9A 5AMEA 1M1FA 2K3YA 4Q0NA 2OAUA 3GOXA 1N27A 3S3MA 5CUCA 3M57A 5EWDA 3OY9A 1QCOA 4FU6A 5GAN2 1WHMA 4Z6HA 2GGRA 3M53A 4N4GA 4JRQA 7AT1B 4R56A 3A8HB 1K8AC 5I22A 5LVQA 2E5QA 5D25A 1BI3A 2ZPHB 3A8MB 3X25B 3OYNA 3AHUA 1YJWA 2RD1A 4N4FA 3DLMA 3CCRA 2YQDA 4QSVA 3CMEA 1J3TA 5L98A 4X1VA 3EGDB 4LDFA 3RNJA 1D1CA 1OULA 2X3WD 5DKCA 1QLYA 1MUZA 3QDRB 4LR6A 1O9SA 3PMIA 2L3PA 3UVDA 5LJ3f 4OUFA 1OYXA 3IQLA 2QYZA 2JJ9A 3INZA 4E7HA 5A83A 1PNJA 5LL6S 3RMSA 3M59A 1IB8A 5IN1A 3H8ZA 4RVRA 3PGGA 5HELA 3BE3A 3I55Q 2X4JA 4JZ3A 3G4SQ 2ECZA 5CU8A 1PRMC 2RO1A 4QVCA 5FFWA 4O72A 5KTUA 2RI2A 3P1FA 5EC7A 2YUOA 3CCSA 4LUDA 5FROA 1G3YA 2F5KA 5DYUA 2K4YA 3JVJA 4YH3A 5J3BA 3P1CA 5DW1A 3EFOA 4YYIA 2O4XB 2RQWA 2DL3A 5E9LA 1Y7XA 1QMCA 2I7KA 2AZVA 4OB2B 5HCLA 3AT1B 2COYA 3TVTA 1K76A 4PFOA 4O75A 4XQ3A 3J7AF 2F5TX 3EG1A 3CCQQ 2YLCA 4C8QC 5GAN6 1BYMA 2XIDA 4C8QG 3OYIA 1WHLA 3CCLA 2OUOA 2RHYA 5LKUA 1WFWA 3JB9F 1R77A 2KMTA 1AD5A 2X4WA 4XTVA 4J83A 5H1UA 2X4YA 3REAB 5D3HA 3E9FA 1M27C 2XMFA 4KGXB 4N3WA 2R57A 1ZHIA 1QVGA 4ZGDB 5DM7R 4XU0A 4PLIA 4CRIA 1OV3A 1YP5A 2G3RA 3VS1A 1KD1R 3RKYA 2V1QA 3OYMA 2YRCA 3GG3A 1M2OA 5CO7A 4F16A 8ATCB 3JAME 1BCMA 2Z0WA 2DXUA 3M0TA 4LRGA 2P0QA 4LDVA 4UYFA 3TEEA 2QEXQ 4UYDA 5LJ3h 2HZYA 1GBQA 2CYZB 3S92A 4A4GA 3CCVT 1ZBJA 4OB1B 2QDLA 4RTZA 1UGPB 1F1BB 1S72A 1OZ2A 1W4SA 1LPLA 4QSTA 2EYQA 5KE2A 4TS8A 5HLSA 5J39A 1VQKQ 1BI2A 2PUOB 1LJOA 2K5IA 1VQ7Q 2EJ9A 1B07A 3P8HA 4DBRA 4BACA 1UJ0A 2IVWA 4BUGA 3OYEA 5EV9A 1H3ZA 3M0RA 4R0KA 4LNPA 2EYXA 5A5OA 2YT6A 1N5ZA 5GMKh 2DPPB 1YJWT 3UA7A 4IURA 3MP1A 2QASA 1PWTA 3CCRT 2QQRA 3MKDA 5D3PA 2JS0A 3CMET 1YJ9T 3CC2Q 2GFUA 3JB9I 5G4SA 2K6DA 2RQTA 5F61A 1CKBA 4XTZA 4KGVB 2HKQB 4YBMA 5ENFA 4JRPA 1E7OA 1UGQB 2CH4W 4EMKC 5GMKl 3OYBA 1VQ6A 5BT5A 3NFCA 3QIIA 2LNHB 1TS9A 1Q82R 1B7TA 3HSBA 5DYAA 1FMKA 2E6ZA 5H1TA 3OS1A 4UYEA 5GAMj 4UIWA 5F5ZA 3A98A 1I07A 3TSZA 1O75A 3JCMc 4FCYA 3SWNC 1WJQA 4A9OA 4PJOF 2LSPB 2COWA 2E6NA 4F3IA 2GCXA 2A36A 1UTIA 3CCST 1TU0B 5D3LA 5GMKi 2QQBA 1WJRA 5KCOA 2RH2A 4GY5A 4M75D 3CBMA 3MULA 3OYKA 3JVMA 2XU8A 1QVFP 1KQSS 1KC8R 1NM7A 3HFNA 3UVYA 4J6YA 4BI4A 1PKSA 2G6FX 4OMMA 2I8NA 3LWIA 4PKLA 3UT1A 2E7NA 1KHIA 5HQ5A 2MJVB 5DW2A 4HBWA 4AKNA 5CKDA 5CQAA 4PFPA 1ZUUA 2HSPA 4DBFA 2J6KA 3OYJA 3JVLA 4IKFA 5DYXA 5CTLA 2QQSA 2ZPFB 3CC4A 1D09B 4K11A 4M7AF 4HXLA 1QWEA 2MWOA 5I7XA 3CCLT 3EGXB 1T3LA 4ZC9A 3E9GA 4HCBA 5ENCA 4D8KA 1RABB 2VWFA 2RQRA 5COIA 2VV5A 2DXTA 2PUKB 4NXJA 2EAYA 2CSIA 3NTKA 9ATCB 2DEUA 1BKBA 1ZKRA 1IGUA 5I83A 1X6OA 3QJ6A 1PD1A 2E10A 2QGGA 5C7NA 4UYFB 2FZGB 3CCEQ 2XDDA 3BW1A 5IGNA 2GQVA 4D6WA 4MZTA 5FG4A 4IUUA 3LH0A 4EMKA 4RTUA 2LMJA 5KH6A 4YAXA 3LX7A 2JMCA 2K9GA 3KUFA 1OI1A 4A9HA 1WHGA 4C8QD 1IZ6A 4O7CA 5CQ6A 1S72T 1QVPA 5C4QA 2LJ3A 5GAOm 5LJ5f 2ROLA 3SWNA 4OMOA 4XUBA 3LQJA 3CPWP 4XK8E 2NYSA 2LZ6B 2K2MA 4RUGA 5E74A 4MMKA 2L89A 3JCMP 1LCKA 5CP5A 5GJVB 4QNSA 2F1LA 5I88A 3CCQA 5HFRA 4CURA 2VGNA 1YFNA 4HBVA 3SB2A 3CC7Q 4LD9K 1D0ZA 5E7DA 4Z02A 5FFYA 2AKKA 4OMNA 4OGCA 2XICA 2QI2A 4QT7A 4AKIA 3JB9H 4IUTA 2E70A 1G3TA 4N4IA 2DZ9A 5CIUA 1VQ6T 1OPKA 2GRCA 3VRZA 5GAN3 4J9EA 2H60A 2OSSA 4EMGA 3HFOA 2H8HA 4QW2A 3VS0A 4QVDA 2FVUA 4MR4A 2VKNA 1QCFA 2F6JA 3MUKA 1K73U 1UB4A 3HRSA 2QEXA 3KXTA 3P5OA 3GNFB 2QXFA 5E3GA 5FH7A 4DEXA 4O76A 1RI0A 4ATOA 1TTHB 4IOOA 4YYHA 3O35A 4E47A 1HXDA 2OTJA 2O31A 3OYFA 1VQKA 4LDWA 1I81A 1LOJA 4JS4A 5CQTA 1PHTA 4PJOC 1R0BG 1GCQA 4PJOG 1XQHA 3NTHA 5CQ5A 1MNEA 4M77F 1MV0B 5E9YA 4TU6A 5EPBA 4WIVA 3QDFA 2DMOA 5LJ5h 3X28B 3G1JA 1QKWA 1Q7YU 2DTHA 4AT1B 3CC4T 2DL7A 4PJJA 4OVAA 3CC2A 2KRSA 4FIBA 4BE1A 4PTBA 2XD0A 2D9TA 4RTXA 2RI7A 2XHCA 1X43A 2YYNA 4FM4B 3VS2A 4NRBA 4EMKB 1UHCA 1K73C 3A5ZB 3SVFA 4XTUA 2JZ2A 1VQMQ 2DBMA 4J9IA 5LJ5g 4PCEA 1YWOA 3R6NA 4PK4A 2DJZA 2KXDA 4M78A 3JCMX 1M1KU 4AI6A 3RKWA 4PL6A 1LVKA 2DRKA 3M56A 5D6WA 2ED1A 4UIXA 2VUBA 4M4ZA 2RHUA 5EM3A 1H3HA 3SWNB 5II1A 5FE5A 4Y91A 5EQ1A 3RCWA 3SVHA 3QPHA 5I11A 5I29A 1W2BS 1JB0E 3S3NA 3AQAA 1G5VA 2RJDA 1SG5A 2RFJA 1U3OA 5DBMA 4FYXB 2LTOA 1D0YA 5CUDA 1SHFA 4Z93A 2F2VA 2DYIA 1Q7YC 1FMVA 4BW2A 5DLOA 4CUSA 4QUUA 1K9AA 4NUDA 1Q81R 2AHJB 3GPLA 3Q1JA 1ZA2B 2DL8A 3I56Q 4L6V5 3JB9D 2QQ9A 3OS5A 4YY6A 2VC8A 4IR6A 1K9MU 1FYNA 4QC3A 5A81A 3QXEB 4J9GA 3CXCS 2CP6A 2YWWA 4OF1A 5GAOp 2NXBA 3M0SA 4B6MA 1M1KC 1U8RA 2QDYB 5GAMe 2FPDA 3CCJQ 5HRVA 4O78A 4TVRA 5IH2A 2JW4A 3CCEA 5EI4A 3M4YA 3OYYA 4KRTA 3NMZC 3JCMf 3MPUB 5F1LA 3A1PA 5HJCA 4OMPA 1YITQ 2YDLA 5K29A 4X9DA 2E1HA 2QEXT 2D82A 4NRCA 4QR4A 4NR8A 5FB1A 3RESA 3MHXA 1K9MC 1N8RU 4ZGEB 2OTJT 4DONA 5CUAA 5HQ7A 2KRMA 1VQKT 2M51A 1RAAB 4NYXA 2DO3A 3UATA 2DAQA 4ZTJA 5ACYA 2LVMA 4ZW1A 3M54A 4X2IA 3OBWA 2RNXA 2C0IA 4IIMA 3CCMQ 4IR3A 2QK0A 5DLQE 1W1FA 2WSEE 2L85A 5EK9A 5KTXA 4BY6C 4MENA 1BBZA 2PU9B 4XTWA 2O4XA 4M77C 3PT9A 2RHXA 4M77G 4C92F 4J0SA 1VQ5Q 1IO6A 2K2VA 3NHNA 4C0FA 5A0LA 4EPCA 3RUXA 1FMWA 2ROTA 3RMQA 5D6YA 1YBYA 5GANf 5L99A 4KGZB 3EG3A 4PJOD 2DEQA 2Y90A 1HK9A 5HEMA 1VQNA 3UF4A 1Y07A 1N8RC 4E96A 3DB3A 3Q2EA 1U1SA 4NR6A 2A7YA 4XU1A 2QQAA 5EWWA 2E64A 3FRNA 1BI0A 5LKTA 2KEAA 2V8IA 4EIKA 2O9VA 4YABA 2EQMA 3J81E 4HVUA 1OEBA 1GFCA 1A0NB 2J6OA 3JCMh 5A2QE 4YC9A 5FWBA 1WLPB 3C95A 4F7UF 1WQ7A 4PFZA 5IT9E 6AT1B 4LC2A 1G3WA 3G71A 4MEOA 3UVXA 5F62A 4M7AD 4EMHA 5HM0A 4ALGA 2JN0A 2DVVA 3OW2S 5E9VA 1N6AA 2JT4A 3N5BB 2QA4Q 2CT3A 2NUZA 5GAN7 3EG2A 1M90R 3MP6A 1M3BA 2KTBB 1JSPB 5CQ7A 5C85A 1PG5B 5DY9A 3MQMA 3JCMg 2HDAA 1TUDA 4AG1C 5ENBA 3DKMA 2QGFB 5EPSA 5CUEA 3OA6A 3VU3C 4GBQA 4RTWA 2O01E 5CKBA 3REBB 3NGPA 4E6RA 2I2LA 4OGJA 4E7ZA 4M75C 4M75G 2D8HA 4AKGA 3GIBA 4PJLA 2JTMA 3U5PA 3CEYA 1YNZA 3CCET 1YN8A 1IXDA 4HXMA 5L23A 1SKUB 4M75E 5D3JA 4LDUA 4QEVA 3CD6A 1OX9A 2QTXA 5IXBA 3CQTA 1SRLA 5HRXA 2DNUA 1Y71A 4QR3A 1AWOA 1VQPQ 2WP2A 2MCNA 2G4AA 1ZA1B 1I8FA 2ZCFB 2CS7A 1AVZC 2DA9A 5LJ5d 2LJ1A 2E3HA 5GANh 4A9IA 4C5EA 1YI2Q 3URGA 4J9BA 3VUBA 1MMGA 3BY7A 4A9NA 4IR4A 1U5SA 4A4EA 5FG5A 4QYLA 3UPUA 2OTLQ 3CCUQ 4AFZC 2FSAA 1NEGA 1M3CA 3I56A 4TZ8A 4CUUA 4J8OA 3VKIA 5GANg 4YYGA 5EG2A 4MR3A 3QZ5B 2DD4A 4PNOA 2LX9A 3L2RA 2EGCA 3P8DA 1NJIU 1JXOA 4UYHA 5E0RA 5FB0A 4YYNA 1M8MA 1WA7A 2FYKA 5GAMf 2DX1A 2A3LA 4DA4A 2IG0A 4CUTA 4XUAA 2K79A 5CQ4A 1VQLQ 3GNGA 5FW9A 2RJFA 1H92A 5ENIA 2JS2A 4FYVB 4ORZA 2NUTA 4C8QE 4ZN1A 4NR5A 4TQNA 1X0JA 5A5PA 1MNDA 1QP3A 4ESRA 4GPJA 1I4K1 4MZMA 2DXBA 4QVZA 2P84A 3EGXA 3VS3A 5FH8A 1VQNT 2KR3A 3RBBB 1YITA 4FLPA 4M75A 5HQ6A 4TU4A 1NG2A 3VS5A 4BI3A 4RMOA 2PVDB 3H41A 2RK1A 1GL5A 3LGLA 2K3XA 4J5YA 5HFQA 2L84A 1MMAA 3D1DA 4JDSA 2RHZA 4M77D 3V7CA 4TT4A 1OZ3A 5CVIA 5ECAA 1NJIC 4QSUA 1D1BA 2YRDA 5F63A 3G71T 1HSQA 1I1JA 2WSCE 2ENMA 2FO0A 5KYWA 5HENA 2LQNA 2HMAA 4KV1A 3FB9A 5JWMA 4NYVA 5KYXB 2I0NA 1QCNA 5CAIA 5CGPA 5LJ3g 1QVGP 3CCMA 1T0JA 4LUEA 1SSHA 1Q86R 4Z1SA 5E73A 4YBSA 4F7UG 2LCCA 2RNWA 5CK9A 5L8TA 4BY6B 4MMLA 1W2BA 4F7UE 1YIJQ 1VQ5A 4M77B 5H1VA 4LE9A 5D3RA 3JCMb 4HT9A 1F68A 2DM1A 5IHIA 4JJDA 5CUBA 1KK7A 1AZEA 5FE6A 2DRMA 4CC3A 4BJXA 4M7DF 4C8QA 5GAMh 3CD6T 2FPEA 1TSFA 4VUBA 3JB9J 3VV0A 1YCYA 2MYSA 5GAOn 2E12A 2ZGWA 1OX8A 1WUMA 3QZTA 1ZLMA 5H85A 2RO0A 3CXCA 4JZ4A 4QKUA 2HL5C 5A5NA 5FE4A 1YHQQ 1NPPA 1IHVA 1YJNA 2L8DA 2DZCA 3EH2A 4F04B 1V29B 1VIFA 2EQUA 3PFSA 4KULA 1W2BP 4BHWA 2DWWA 5KCHA 2EQIA 1ZUKA 1ZQ1A 2DYBA 4J0RA 5GJWB 3T9NA 5EICA 2EGEA 2LX7A 5D7XA 4PJMA 2FL7A 2M1HA 2R0VA 3G0JA 1UE9A 2X3XD 5FRNA 4HXPA 2YUQA 4O7FA 4WHUA 2OI3A 4FT4A 4J7FA 3ZEHA 2FEIA 2NUTB 4MDXA 4CC2A 3THKA 2KBTA 3JCMV 1AHJB 1KD1U 5FE3A 4P5NA 2CZ7B 4NS5A 1N9SA 3FJ5A 3O36A 3CXCP 4A9FA 1Z9ZA 3QJYA 4RCBA 5A85A 4JJNK 3AADA 4OMLA 5CKFA 2HQXA 4M75B 1JEGA 1WJSA 4NR7A 3JCMd 2HKNA 1FX7A 1NE8A 2ED0A 2ZPEB 4DQ2A 4OGEA 4MR5A 2LP5A 1RLPC 4HKEA 3VS6A 1TH7A 3MB3A 3ZYUA 3M0UA 1RAEB 3CMAQ 4YYKA 3QBYA 3J80E 3RDVA 3JB9G 1YITT 1UHFA 2X9HA 1VQPA 3JCMW 4A4FA 2D0NA 3I55A 3SVGA 1XJWB 4IOQA 3G4SA 1U1TA 3L42A 3L2UA 3HL8A 2BE9B 3PE0A 2RI3A 5KYWB 2HEQA 2H3JA 2RJEA 3NTIA 1BIBA 2KSSA 1WXTA 4CL9A 4RG2A 4R55A 3UVWA 1BU1A 3HMEA 4QZSA 5FE1A 2SEMA 1M9SA 2CDTA 2KXCA 5I21A 3CCUA 1CSKA 3M55A 4IR5A 2DVSA 2O88A 1R0CB 1MHNA 1KD1C 4QQDA 3UV4A 5FU7C 4OMFB 1C1AA 3MXFA 2XKOC 1QWFA 4L59A 4O5VA 4C92D 1Q82U 1X2QA 2MMPA 2NUPA 4DBQA 5F1HA 1JXMA 1VQLA 2RQUA 2EW3A 4BB7A 4C8QB 4J9CA 1VQ5T 4IUQA 1T3SA 2CP0A 3PTAA 3LW5E 5GANd 4JRKA 1PRLC 4BW1A 1KHCA 5C6SA 3JSCA 2EWNA 2L5EA 3QO3A 4UIVA 2JM9A 4A4KA 2JUFA 5CY9A 4HXOA 2J7IA 2L0AA 2PQWA 1UJYA 5GAN4 2R10A 1NLPC 1ZX6A 5CQ8A 5FDZA 1OQKA 2EIFA 4TT2A 2ZPIB 4GLKA 3TREA 4ZGJB 3OS0A 3OW2A 1KC8U 4ANJA 2OO1A 3NPFA 5FE8A 4EDUA 3CPFA 4ZTFA 3V8LA 1TG0A 1WHJA 2KGTA 4C0GA 2KYBA 1YJNT 3WVDB 5DY7A 1OOTA 2HBPA 3UDCA 4AFSC 1VQ9Q 5CRMA 5ETDA 2BZ8A 3RIRA 2DK3A 2RK2A 2O9SA 1Q82C 3FDRA 2LCLA 5I2SA 4JLGA 5AD2A 2GQIA 3HMFA 1VQ7A 2DATA 2L3RA 2L3QA 3U5KA 1UUEA 1WXBA 2HNIA 3H6ZA 1GCPA 3M58A 2KT8A 2VYTA 1N9RA 2V8JA 5E3DA 1K4US 2B86A 4XY9A 1BI1A 2KVQG 4F7UB 1PSEA 4PJOE 4QSWA 3TCJA 5A5RA 3OW2P 2V8KA 5F25A 5I1QA 1VYUA 3CCVQ 1V76A 1KQ1A 1X6BA 2YUPA 3LYIA 4FYWB 2EYZA 1ABOA 1ARKA 3E1SA 1GXIE 3E19A 4XAXB 1KC8C 1SSFA 5LJ3d 2JM8A 1NLOC
chains in the Genus database with same CATH topology
4KCXA 5KHMA 3OYGA 1QW1A 3HPWA 5EA1A 5ENGA 4NL3A 4Q0OA 5IIDA 3BDLA 4M7AC 4M7AG 4TZ2A 5I2MA 4DOWA 5EPRA 5E9KA 4PKCC 1VQPT 5LJ5j 3I55T 2YELA 5FE0A 3A8GB 5DYCA 3G4ST 4M7AE 4N0AC 1YHQA 2RNYA 4HXKA 1E6IA 5FE2A 2FHDA 2RJCA 4LYIA 2JVVA 3C12A 4E7JA 4YH4A 3CCUT 5CQ3A 2ZPBB 4ZN3A 3O34A 4NYWA 4OGIA 1WGSA 4FL6A 5C8GA 2YEMA 3QYHB 5LJ2A 5GAMd 4UIZA 4C0DC 3META 3FKMX 2R5AA 1QVFS 1JM4B 3CCQT 2XDBA 3LJWA 4HBXA 3QZSA 1NZ9A 1XTDA 2D0QB 5FG6A 4PJOA 5I80A 3PMTA 3TLPA 1JJ2S 2HAXA 2YW5A 3MEUA 5GMKe 2LQKA 2YRVA 3M9QA 5CRZA 4NUCA 3V7RA 4B9XA 4QR5A 4CFKA 3CMAA 2EKOA 4UIYA 1LNXA 1B34A 4ELYC 4B9WA 4A9KA 4X34A 4YTLA 4A54A 4M7AA 4ME7A 3BDUA 4LZRA 2JTFA 2JNGA 5FBXA 1I5LA 2DTOA 4J1PA 2E65A 5LJ1A 5CKHA 2WP1A 5DFCA 1VQ7T 4Y28E 5KO4A 1N72A 5FU7B 5CCAA 2P0KA 3UV2A 3LGFA 3SD4A 2DVEA 4JLIA 3DAIA 5D26A 1Y96B 2B8AA 3QSUA 3HRUA 3CC7A 3CPWS 2RA2A 2D9EA 4UIUA 5L8UA 2XDPA 3CC2T 4OB0B 5G4RA 2GFAA 4M7DD 4UC4A 3I3JA 1NPRA 3V7SA 4CFLA 3M5AA 2DIGA 4M77E 1KQSA 1KQ2A 3U5JA 4XYAA 5ENHA 4LD6A 4YATA 1Q81U 5FRMA 2P4TA 4QQGA 5LKXA 3FC3A 4NOYA 5FU6C 1UGSB 1VQ9A 4PCIA 5HK0A 2X35A 5IAYA 5LVRA 5AD3A 2Y4YA 2VXEA 5GAN5 1WUGA 4XY8A 5C87A 3TU4K 3G7ZA 2DKWA 5EVAA 4PJOB 4HXSA 2MWPA 4A9EA 4CLBA 2VGMA 4YYJA 3VUZA 3VYGA 1IREB 2RHIA 3CCVA 4C5IA 4QSQA 5FE7A 5J26A 3LQIA 4QC1A 2LRQA 5D3SA 2JOYA 3L2QA 3P8BB 1MGQA 2KQWA 2E3KA 5DKDA 2E41A 4QSPA 3QZ9B 5D3TA 4HXRA 4TYLA 3QG1A 1Q81C 3HMHA 1VQMA 1B34B 5A7CA 3DWYA 1UGRB 2WSFE 3A8OB 3CMAT 4UYGA 3OB9A 4M7AB 2YLBA 4M77A 4L5GA 4A4HA 3UWNA 1H641 5A0DA 4Z6IA 5DLZA 3MEWA 1YJ9A 2XG8D 4C67A 4A9JA 3OYLA 3S91A 1ZS5A 3OQ5A 2XI9A 4PLLA 3OS2A 3JCMQ 4Z1QA 3ME9A 3OSVA 2F69A 2E7OA 2PVOB 5HKCA 4O7BA 1VQ4A 4C0DB 3CC7T 4XU3A 5GANj 4C5GA 4MZPA 3A8LB 3D7CA 3IU5A 3CCJA 2C06A 4QUTA 5D0CA 5LJ5e 1VQOA 4BW3A 3L2ZA 3DB4A 4E7IA 5D24A 5DKHA 4MEPA 3Q2FA 4CUPA 4E7KA 1VUBA 4C92C 4ALHA 4C92G 2R58A 2EQJA 4OB3B 3JCMJ 2RS9B 3OYDA 1VQ9T 4C92E 2WACA 2KAFA 1M90U 4V2SA 5IGMA 5F3AA 2L5QA 3LXJA 5CPEA 5LJ0A 2PVGB 3OSSC 1EIFA 4C0ZA 2DD5A 4UITA 4MDWA 4QYDA 5FH6A 1JRIA 5EWVA 2X4XA 5C89A 2KY9A 4A9LA 3VJPA 4WF2A 5A82A 3X20B 3CBOA 4MEQA 4LDYA 3ASKA 3WVEB 5LJ3j 5F60A 5KE3A 4BI8B 5II2A 3GP8A 2M0OA 3MEVA 2M9UA 4O7AA 2BIVA 3U5MA 2DVRA 2R0SA 4J6WA 4JRIA 2RM4A 4KT0E 1VQMT 4RG8A 4FSXA 4M78F 2EJFA 3OYAA 5HK3A 5A0GA 1M90C 2YDWA 1D3BA 2MI6A 4O6JA 5GMKj 4KV4A 4A53A 5AMFA 1BIAA 1QVFA 5CS8A 5FU6B 3PIPA 5DLXA 1JJ2A 4NQNA 4RKUE 4TT6A 4C92A 4MR6A 5GAMg 3GF5A 4PY6A 4YBTA 4KUIA 3P1EA 3CBPA 3FIFA 5CFWA 4HCCA 3OBYA 3QHSA 4YADA 5FLXE 3I56T 5I86A 2YEKA 2QA4A 3OYHA 3MO8A 1P92A 1VQ4T 3G0LA 3PIOA 3KBGA 5J0DA 4J6XA 4KUDK 4BW4A 3CCJT 3L2VA 1VQOT 2MF2A 4N4HA 1FWZA 5EU1A 4F7UA 3QKJA 4WHWA 2LNVA 5EP7A 4Q5WA 4LYWA 5LKZA 5E9IA 2DVQA 2CKKA 1DJ7B 4LYSA 2N9GA 3UV5A 5KTWA 3EFSA 4QEWA 3L2WA 2EQKA 4QBMA 5TB6A 3CPWA 5KU3A 3RERA 3OMCA 1YI2A 2F6NA 1Q86U 2LDMA 1M4ZA 1EQFA 3QZVA 5IBNA 2ZZDA 3LLRA 5IG6A 2OTLA 5A5SA 1XNIA 5CR2A 4J3IA 1RL2A 5I40A 4JS5A 4BDYA 4NUEA 3JCMe 4QEUA 3CCMT 4YYMA 2LQ8A 2KK4A 4IUPA 3HHTB 4BE0A 3U5LA 3LWHA 2BKDN 5L97A 1D3BB 4ZQLA 3OMGA 1X01A 5FFVA 3C4SA 4YY4A 5IGKA 1WNLA 3MB4A 3RKXA 1Q86C 4CUQA 2GF7A 2MAMA 2XK0A 4RCCA 4C92B 5IGLA 4NR9A 1WPYA 4ELZC 4M78C 1UEBA 4M78G 4DOVA 2D6FA 4M7DC 1FXXA 5FE9A 4M7DG 4J7IA 5CUGA 4QSRA 4HCZA 1M8VA 1G3SA 3R6OA 4M78E 4NR4A 4M7DE 4C66A 3O8VA 4A9MA 3MP8A 5GANe 4BDZA 2RB6A 2M16A 3QUIA 2QA4T 2CZ0B 2K57A 4E7LA 3QYGB 4Y03A 5M9OA 3M4GA 5BT4A 4NQMA 3FJPA 2EJGA 3G6EA 3IU6A 1YIJA 3ZFJA 5D6XA 3ZBDA 1QVGS 2K5FA 1Y96A 3P1DA 2NLUA 4LZSA 5CZGA 3K2JA 3S6WA 4QB3A 1XOVA 5CQXA 1WQWA 5I89A 3O37A 3X24B 3F70A 5DFDA 5L8RE 2DIQA 2Y4XA 5C0MA 2CZ6B 3U5OA 4C5HA 3FEOA 5EISA 1ZBXA 2DKGA 1YI2T 3BFMA 3NXBA 4X9CA 1QP2A 4NRAA 3U5NA 2OTLT 2CZ1B 5ENEA 3JVKA 4BE2A 4HXNA 5DFBA 4BD3A 5LJ3e 4M7DA 3O33A 4YYDA 3GLXA 2K5LA 3HKSA 4JUVA 1VQ8A 5F2PA 3EFRA 5CKEA 5JI8A 4HBYA 5F36A 1R8OB 4O70A 3SDZA 4O74A 1VQLT 3PNWC 4TTEA 5CQYA 2DTIA 3LQHA 5A5QA 5LUUA 2HQEA 2LC4A 4KBMB 3V8JA 2RI5A 3ONIA 5E9MA 4M75F 2P0PA 4HT8A 3OYCA 4O71A 5GAN8 4QY4A 3HRTA 4CI0C 4II1A 4O7EA 3VYHB 1JBMA 2VXFA 5HY6A 4IUVA 3SFMA 4HA8A 5GAOr 2BUDA 3EAEA 1M5Q1 1KG1A 3WXMB 5EGUA 4N0AA 3DLLA 5GMKm 2LT1A 4PS5A 4LDXA 2KDSA 2LT4A 4QSSA 5GAOq 4OP0A 2HD0A 4XU2A 4QSXA 2DXCA 3G6ET 5D3NA 4M78D 3UW9A 5I7YA 1YIJT 2CGHA 5ENJA 5EWCA 5AYFA 4C8QF 5DX4A 5HRWA 4O77A 5ETBA 3S3OA 4XTXA 1M1GA 1K8AU 2EFIA 4M78B 3MEAA 1YHQT 2YHTA 4M7DB 5TCMA 2FB7A 4YK0A 3JRZA 5BT3A 4XTYA 5L96A 3X26B 2ZPGB 1PSFA 4NL2A 4QQ6A 3L1AA 3FLGA 1X75C 5EWHA 4LZ2A 1VIEA 1VQ8T 3MCAB 3C94A 3V8KA 5GAOl 4FT2A 4IORA 2R0YA 3ER0A 2R5MA 3HP9A 5AMEA 1M1FA 2K3YA 4Q0NA 2OAUA 3GOXA 1N27A 3S3MA 5CUCA 3M57A 5EWDA 3OY9A 4FU6A 5GAN2 4Z6HA 3M53A 4N4GA 4JRQA 4R56A 3A8HB 1K8AC 5LVQA 2E5QA 5D25A 1BI3A 2ZPHB 3A8MB 3X25B 3OYNA 3AHUA 1YJWA 2RD1A 4N4FA 3DLMA 3CCRA 2YQDA 4QSVA 3CMEA 5L98A 4LDFA 5DKCA 3QDRB 4LR6A 1O9SA 3PMIA 3UVDA 5LJ3f 4OUFA 1OYXA 4E7HA 3INZA 5A83A 5LL6S 3RMSA 3M59A 5IN1A 3H8ZA 4RVRA 3PGGA 5HELA 2X4JA 5CU8A 2RO1A 4QVCA 5FFWA 4O72A 5KTUA 2RI2A 3P1FA 3CCSA 5FROA 1G3YA 2F5KA 5DYUA 2K4YA 3JVJA 4YH3A 5J3BA 3P1CA 5DW1A 4YYIA 2O4XB 5E9LA 1Y7XA 2I7KA 4OB2B 5HCLA 4XQ3A 4O75A 3J7AF 2F5TX 2YLCA 4C8QC 5GAN6 1BYMA 2XIDA 4C8QG 3OYIA 3CCLA 2OUOA 2RHYA 5LKUA 3JB9F 2KMTA 2X4WA 4XTVA 4J83A 5H1UA 2X4YA 5D3HA 3E9FA 4N3WA 2R57A 1ZHIA 1QVGA 4ZGDB 5DM7R 4XU0A 4PLIA 4CRIA 2G3RA 3RKYA 3OYMA 3GG3A 5CO7A 3JAME 2DXUA 4LRGA 2P0QA 4LDVA 4UYFA 3TEEA 4UYDA 5LJ3h 2CYZB 3S92A 4A4GA 3CCVT 4OB1B 1UGPB 1S72A 1OZ2A 1W4SA 4QSTA 2EYQA 5KE2A 4TS8A 5HLSA 5J39A 1BI2A 2PUOB 1LJOA 2K5IA 2EJ9A 3P8HA 4BACA 2IVWA 4BUGA 3OYEA 5EV9A 1H3ZA 5A5OA 5GMKh 2DPPB 1YJWT 4IURA 3MP1A 3CCRT 2QQRA 5D3PA 3CMET 1YJ9T 2GFUA 3JB9I 5G4SA 5F61A 4XTZA 4YBMA 5ENFA 4JRPA 1UGQB 4EMKC 5GMKl 3OYBA 1VQ6A 5BT5A 3NFCA 3QIIA 3HSBA 5DYAA 2E6ZA 5H1TA 3OS1A 4UYEA 5GAMj 4UIWA 5F5ZA 1O75A 3JCMc 3SWNC 1WJQA 4A9OA 4PJOF 2LSPB 2E6NA 4F3IA 2GCXA 3CCST 5D3LA 5GMKi 2QQBA 1WJRA 5KCOA 2RH2A 4GY5A 4M75D 3CBMA 3MULA 3OYKA 3JVMA 2XU8A 1KQSS 3HFNA 3UVYA 4J6YA 4BI4A 2I8NA 3LWIA 4PKLA 3UT1A 2E7NA 1KHIA 5HQ5A 2MJVB 5DW2A 4HBWA 4AKNA 5CKDA 5CQAA 3OYJA 3JVLA 4IKFA 5DYXA 5CTLA 2QQSA 2ZPFB 3CC4A 4M7AF 4HXLA 2MWOA 5I7XA 3CCLT 3E9GA 4ZC9A 4HCBA 5ENCA 5COIA 2VV5A 2DXTA 2PUKB 4NXJA 2EAYA 3NTKA 1BKBA 5I83A 1X6OA 3QJ6A 2E10A 5C7NA 4UYFB 2XDDA 3BW1A 5IGNA 2GQVA 4D6WA 4MZTA 5FG4A 4IUUA 3LH0A 4EMKA 5KH6A 4YAXA 3LX7A 3KUFA 1OI1A 4A9HA 4C8QD 1IZ6A 4O7CA 5CQ6A 1S72T 1QVPA 5C4QA 5GAOm 5LJ5f 3SWNA 4XUBA 3LQJA 4XK8E 5E74A 4MMKA 2L89A 3JCMP 5CP5A 4QNSA 3CCQA 5I88A 5HFRA 4CURA 2VGNA 3SB2A 4HBVA 4LD9K 5E7DA 4Z02A 5FFYA 4OGCA 2XICA 2QI2A 3JB9H 4IUTA 2E70A 1G3TA 4N4IA 2DZ9A 5CIUA 1VQ6T 2GRCA 5GAN3 2H60A 2OSSA 4EMGA 3HFOA 4QW2A 4QVDA 2FVUA 4MR4A 2F6JA 3MUKA 1K73U 1UB4A 3HRSA 2QEXA 3KXTA 3P5OA 3GNFB 2QXFA 5E3GA 5FH7A 4O76A 1RI0A 4ATOA 4IOOA 4YYHA 3O35A 4E47A 1HXDA 2OTJA 3OYFA 1VQKA 4LDWA 1I81A 1LOJA 4JS4A 5CQTA 4PJOC 4PJOG 1XQHA 3NTHA 5CQ5A 4M77F 5E9YA 4TU6A 5EPBA 4WIVA 5LJ5h 3X28B 1Q7YU 2DTHA 3CC4T 4OVAA 3CC2A 4FIBA 4BE1A 4PTBA 2XD0A 2D9TA 2RI7A 2XHCA 2YYNA 4FM4B 4NRBA 4EMKB 1K73C 3A5ZB 3SVFA 4XTUA 2JZ2A 5LJ5g 4PCEA 2DJZA 4M78A 3JCMX 1M1KU 3RKWA 4PL6A 3M56A 5D6WA 4UIXA 2VUBA 2RHUA 5EM3A 3SWNB 5II1A 5FE5A 4Y91A 3QPHA 5EQ1A 3RCWA 3SVHA 5I29A 1W2BS 1JB0E 3S3NA 3AQAA 1G5VA 2RJDA 2RFJA 5DBMA 2LTOA 5CUDA 4Z93A 1Q7YC 4BW2A 5DLOA 4CUSA 4QUUA 4NUDA 2AHJB 3GPLA 3Q1JA 3JB9D 4L6V5 2QQ9A 3OS5A 4YY6A 2VC8A 4IR6A 1K9MU 4QC3A 5A81A 3QXEB 3CXCS 4OF1A 5GAOp 2NXBA 1M1KC 1U8RA 2QDYB 5GAMe 5HRVA 4O78A 4TVRA 3CCEA 5EI4A 3M4YA 3OYYA 3JCMf 5F1LA 5HJCA 5K29A 4X9DA 2E1HA 2QEXT 2D82A 4NRCA 4QR4A 4NR8A 5FB1A 3RESA 3MHXA 1K9MC 1N8RU 4ZGEB 2OTJT 4DONA 5CUAA 5HQ7A 1VQKT 4NYXA 2DO3A 2DAQA 4ZTJA 5ACYA 2LVMA 4ZW1A 3M54A 4X2IA 3OBWA 2RNXA 4IR3A 5DLQE 2WSEE 2L85A 5EK9A 5KTXA 4BY6C 4MENA 2PU9B 4XTWA 2O4XA 4M77C 3PT9A 2RHXA 4M77G 4C92F 4J0SA 2K2VA 4C0FA 5A0LA 4EPCA 3RUXA 3RMQA 5D6YA 1YBYA 5GANf 5L99A 4PJOD 2DEQA 2Y90A 1HK9A 5HEMA 1VQNA 1Y07A 1N8RC 4E96A 3DB3A 3Q2EA 1U1SA 4NR6A 2A7YA 4XU1A 2QQAA 5EWWA 2E64A 3FRNA 1BI0A 5LKTA 2V8IA 4YABA 2EQMA 3J81E 3JCMh 5A2QE 4YC9A 3C95A 4F7UF 1WQ7A 5IT9E 4LC2A 1G3WA 3G71A 4MEOA 3UVXA 5F62A 4M7AD 4EMHA 5HM0A 4ALGA 2JN0A 2DVVA 3OW2S 5E9VA 1N6AA 3N5BB 5GAN7 3MP6A 2KTBB 1JSPB 5CQ7A 5C85A 5DY9A 3MQMA 3JCMg 5ENBA 3DKMA 5EPSA 5CUEA 3OA6A 3VU3C 2O01E 5CKBA 2I2LA 4OGJA 4M75C 4M75G 3GIBA 2JTMA 3U5PA 3CEYA 3CCET 4HXMA 4M75E 5D3JA 4LDUA 4QEVA 3CD6A 2QTXA 5HRXA 1Y71A 4QR3A 2WP2A 2G4AA 1I8FA 2ZCFB 2CS7A 5LJ5d 5GANh 4A9IA 4C5EA 3URGA 3VUBA 3BY7A 4A9NA 4IR4A 4A4EA 5FG5A 4QYLA 3UPUA 2FSAA 3I56A 4TZ8A 4CUUA 4J8OA 3VKIA 5GANg 4YYGA 5EG2A 4MR3A 3QZ5B 2DD4A 4PNOA 2LX9A 3L2RA 3P8DA 1NJIU 4UYHA 5E0RA 5FB0A 4YYNA 2FYKA 5GAMf 2A3LA 4DA4A 2IG0A 4CUTA 4XUAA 5CQ4A 3GNGA 2RJFA 5ENIA 4C8QE 4ZN1A 4NR5A 4TQNA 1X0JA 5A5PA 1QP3A 4GPJA 1I4K1 4MZMA 2DXBA 4QVZA 5FH8A 1VQNT 1YITA 4FLPA 4M75A 5HQ6A 4TU4A 4BI3A 4RMOA 2PVDB 2RK1A 3LGLA 2K3XA 4J5YA 5HFQA 2L84A 4JDSA 2RHZA 4M77D 3V7CA 4TT4A 1OZ3A 5CVIA 1NJIC 4QSUA 5F63A 3G71T 2WSCE 5HENA 3FB9A 4KV1A 5JWMA 4NYVA 5CAIA 5CGPA 5LJ3g 3CCMA 4Z1SA 5E73A 4YBSA 4F7UG 2LCCA 2RNWA 5CK9A 5L8TA 4BY6B 4MMLA 1W2BA 4F7UE 1VQ5A 4M77B 5H1VA 5D3RA 3JCMb 4HT9A 1F68A 5CUBA 5FE6A 4BJXA 4M7DF 4C8QA 5GAMh 3CD6T 4VUBA 3JB9J 3VV0A 1YCYA 5GAOn 2E12A 2ZGWA 1WUMA 3QZTA 5H85A 2RO0A 3CXCA 5A5NA 5FE4A 1NPPA 1YJNA 2L8DA 2DZCA 1V29B 1VIFA 2EQUA 3PFSA 4KULA 4BHWA 2DWWA 5KCHA 1ZQ1A 4J0RA 3T9NA 5EICA 5D7XA 2FL7A 2M1HA 2R0VA 3G0JA 5FRNA 4HXPA 4J7FA 4O7FA 4WHUA 4FT4A 3ZEHA 4MDXA 3JCMV 1AHJB 1KD1U 5FE3A 4P5NA 2CZ7B 4NS5A 1N9SA 3O36A 4A9FA 3QJYA 4RCBA 5A85A 4JJNK 3AADA 5CKFA 2HQXA 4M75B 1WJSA 4NR7A 3JCMd 1FX7A 1NE8A 2ZPEB 4DQ2A 4OGEA 4MR5A 4HKEA 1TH7A 3MB3A 3ZYUA 4YYKA 3QBYA 3J80E 3JB9G 1YITT 1VQPA 3JCMW 4A4FA 3I55A 3SVGA 4IOQA 3G4SA 1U1TA 3L42A 3L2UA 3HL8A 2RI3A 2H3JA 2RJEA 3NTIA 1BIBA 2KSSA 4CL9A 4R55A 4RG2A 3UVWA 3HMEA 4QZSA 5FE1A 1M9SA 3CCUA 5I21A 3M55A 4IR5A 2DVSA 1MHNA 1KD1C 4QQDA 3UV4A 5FU7C 4OMFB 3MXFA 2XKOC 4L59A 4O5VA 4C92D 1Q82U 2MMPA 5F1HA 1VQLA 4BB7A 4C8QB 1VQ5T 4IUQA 3PTAA 3LW5E 5GANd 4JRKA 4BW1A 1KHCA 5C6SA 3JSCA 2EWNA 2L5EA 3QO3A 4UIVA 4A4KA 2JUFA 5CY9A 4HXOA 2PQWA 5GAN4 2R10A 5CQ8A 5FDZA 4GLKA 2EIFA 4TT2A 2ZPIB 3TREA 4ZGJB 3OS0A 3OW2A 1KC8U 2OO1A 5FE8A 4EDUA 3CPFA 4ZTFA 3V8LA 4C0GA 1YJNT 3WVDB 5DY7A 3UDCA 2HBPA 5CRMA 5ETDA 3RIRA 2DK3A 2RK2A 1Q82C 3FDRA 2LCLA 5I2SA 4JLGA 5AD2A 3HMFA 1VQ7A 2DATA 2L3RA 3U5KA 3H6ZA 2HNIA 3M58A 2VYTA 1N9RA 2V8JA 5E3DA 4XY9A 1BI1A 2KVQG 4F7UB 1PSEA 4PJOE 4QSWA 3TCJA 5A5RA 2V8KA 5F25A 5I1QA 1KQ1A 3LYIA 3E1SA 1GXIE 3E19A 4XAXB 1KC8C 1SSFA 5LJ3d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCX A;  5KHM A;  2CKK A;  2O4X A;  3OYG A;  5EA1 A;  2RHX A;  5ENG A;  4J0S A;  4LYS A;  2N9G A;  3OYI A;  4Q0O A;  3UV5 A;  2OUO A;  5IID A;  5KTW A;  5LKU A;  2RHY A;  3BDL A;  2X4W A;  4TZ2 A;  5D6Y A;  4QEW A;  5H1U A;  5EPR A;  3L2W A;  2X4Y A;  5E9K A;  2EQK A;  4QBM A;  5D3H A;  5TB6 A;  3E9F A;  5L99 A;  5KU3 A;  2YEL A;  5FE0 A;  5DYC A;  4N3W A;  2R57 A;  5HEM A;  3OMC A;  2F6N A;  2LDM A;  1EQF A;  2RNY A;  3QZV A;  5IBN A;  4E96 A;  3DB3 A;  4PLI A;  3Q2E A;  4CRI A;  2G3R A;  4HXK A;  4NR6 A;  1E6I A;  5FE2 A;  2FHD A;  3LLR A;  2RJC A;  3OYM A;  5EWW A;  5IG6 A;  5A5S A;  4LYI A;  1XNI A;  5LKT A;  3GG3 A;  4E7J A;  4YH4 A;  4J3I A;  4YAB A;  5I40 A;  5CQ3 A;  2EQM A;  4LRG A;  4UYF A;  4BDY A;  4NUE A;  4UYD A;  4YC9 A;  3O34 A;  4QEU A;  3S92 A;  4A4G A;  4NYW A;  4OGI A;  1WGS A;  4FL6 A;  5C8G A;  2YEM A;  4LC2 A;  5LJ2 A;  1OZ2 A;  4YYM A;  4MEO A;  4UIZ A;  4QST A;  5F62 A;  3UVX A;  4IUP A;  4TS8 A;  5HM0 A;  5HLS A;  5KE2 A;  5J39 A;  4ALG A;  4BE0 A;  3MET A;  2DVV A;  3FKM X;  5E9V A;  2R5A A;  3U5L A;  1JM4 B;  3LJW A;  4HBX A;  3QZS A;  2BKD N;  3P8H A;  5FG6 A;  3MP6 A;  4BAC A;  2KTB B;  5L97 A;  5I80 A;  5CQ7 A;  3TLP A;  5C85 A;  1JSP B;  3MQM A;  3PMT A;  2YW5 A;  4ZQL A;  3OMG A;  5EV9 A;  3MEU A;  3OYE A;  1H3Z A;  5ENB A;  5FFV A;  5A5O A;  5EPS A;  3C4S A;  5CUE A;  3OA6 A;  4YY4 A;  5IGK A;  2YRV A;  4IUR A;  3MP1 A;  3M9Q A;  3MB4 A;  5CRZ A;  4NUC A;  4CUQ A;  2GF7 A;  2QQR A;  4OGJ A;  5D3P A;  4B9X A;  2XK0 A;  4QR5 A;  4CFK A;  2GFU A;  5G4S A;  5IGL A;  4NR9 A;  5F61 A;  3U5P A;  3CEY A;  2EKO A;  4YBM A;  4HXM A;  5ENF A;  3OYB A;  5D3J A;  4QEV A;  4UIY A;  5BT5 A;  3QII A;  4B9W A;  5FE9 A;  4A9K A;  4X34 A;  5CUG A;  4QSR A;  4HCZ A;  5DYA A;  5HRX A;  4QR3 A;  5H1T A;  2WP2 A;  3OS1 A;  4NR4 A;  4UYE A;  2G4A A;  4UIW A;  4LZR A;  5F5Z A;  4C66 A;  3O8V A;  4A9M A;  3MP8 A;  2JTF A;  4A9I A;  4C5E A;  4BDZ A;  2M16 A;  5FBX A;  1WJQ A;  4J1P A;  4A9O A;  4A9N A;  5LJ1 A;  2LSP B;  2WP1 A;  5DFC A;  2E6N A;  4IR4 A;  4F3I A;  4A4E A;  5KO4 A;  5FG5 A;  1N72 A;  4E7L A;  4QYL A;  4Y03 A;  2P0K A;  5M9O A;  3UV2 A;  3LGF A;  5D3L A;  3SD4 A;  1WJR A;  5KCO A;  4GY5 A;  5BT4 A;  4NQM A;  2FSA A;  3DAI A;  3MUL A;  3OYK A;  3JVM A;  5D26 A;  3IU6 A;  4TZ8 A;  4CUU A;  2B8A A;  3UVY A;  4YYG A;  4MR3 A;  2I8N A;  2D9E A;  3L2R A;  4UIU A;  5L8U A;  3P8D A;  4PKL A;  2XDP A;  5D6X A;  3UT1 A;  5G4R A;  2E7N A;  4UYH A;  5E0R A;  5FB0 A;  5HQ5 A;  2GFA A;  2MJV B;  3P1D A;  5DW2 A;  4HBW A;  4AKN A;  4YYN A;  2NLU A;  5CQA A;  3I3J A;  4UC4 A;  4LZS A;  5CZG A;  3OYJ A;  3K2J A;  3JVL A;  4IKF A;  2IG0 A;  3S6W A;  4QB3 A;  5DYX A;  4XUA A;  4CUT A;  5I89 A;  5CTL A;  5CQ4 A;  4CFL A;  2QQS A;  3O37 A;  2DIG A;  4HXL A;  2MWO A;  2RJF A;  5I7X A;  3F70 A;  5ENI A;  3E9G A;  5DFD A;  4ZC9 A;  2DIQ A;  5C0M A;  5ENC A;  4NR5 A;  4TQN A;  1X0J A;  3U5O A;  5A5P A;  3U5J A;  5COI A;  4GPJ A;  4C5H A;  3FEO A;  4NXJ A;  5EIS A;  4XYA A;  5ENH A;  4QVZ A;  3NTK A;  4LD6 A;  5FH8 A;  5I83 A;  4YAT A;  3QJ6 A;  5FRM A;  4QQG A;  5LKX A;  3FC3 A;  4FLP A;  5C7N A;  3NXB A;  4UYF B;  4PCI A;  5IGN A;  5HQ6 A;  4TU4 A;  4NRA A;  2X35 A;  5IAY A;  3U5N A;  5LKZ A;  5LVR A;  5ENE A;  5FG4 A;  4IUU A;  3JVK A;  5AD3 A;  4BE2 A;  4HXN A;  3LH0 A;  3LGL A;  5DFB A;  2K3X A;  4BD3 A;  5HFQ A;  2L84 A;  1WUG A;  2RHZ A;  3O33 A;  4XY8 A;  4YAX A;  4YYD A;  3LX7 A;  5C87 A;  5KH6 A;  3KUF A;  4TT4 A;  1OI1 A;  1OZ3 A;  4A9H A;  2DKW A;  4O7C A;  5CQ6 A;  5EVA A;  4QSU A;  5F2P A;  4HXS A;  5C4Q A;  4A9E A;  4HBY A;  5F63 A;  5JI8 A;  2MWP A;  5F36 A;  4CLB A;  4O70 A;  4YYJ A;  5HEN A;  4KV1 A;  4XUB A;  3LQJ A;  5JWM A;  2RHI A;  4NYV A;  4O74 A;  4C5I A;  4QSQ A;  5CGP A;  5FE7 A;  4TTE A;  3PNW C;  5E74 A;  4Z1S A;  5J26 A;  3LQI A;  4QC1 A;  5E73 A;  4YBS A;  2LRQ A;  5D3S A;  2LCC A;  3L2Q A;  2RNW A;  3LQH A;  5A5Q A;  2L89 A;  2E3K A;  5DKD A;  5L8T A;  5LUU A;  2HQE A;  5CP5 A;  4QNS A;  4QSP A;  5I88 A;  5HFR A;  5D3T A;  4HXR A;  3ONI A;  4TYL A;  4CUR A;  2RI5 A;  4HBV A;  3HMH A;  5E9M A;  5H1V A;  5D3R A;  5A7C A;  3DWY A;  5E7D A;  4Z02 A;  5FFY A;  1F68 A;  3OYC A;  4O71 A;  4UYG A;  5CUB A;  3OB9 A;  4QY4 A;  5FE6 A;  4II1 A;  4IUT A;  4A4H A;  4N4I A;  4BJX A;  4O7E A;  5CIU A;  3UWN A;  4Z6I A;  5DLZ A;  3MEW A;  4IUV A;  2GRC A;  4C67 A;  4A9J A;  3OYL A;  3S91 A;  1WUM A;  2H60 A;  3QZT A;  2BUD A;  3EAE A;  2OSS A;  5EGU A;  5H85 A;  2RO0 A;  4QW2 A;  4MR4 A;  5A5N A;  2F6J A;  5FE4 A;  1ZS5 A;  3OQ5 A;  3MUK A;  4PS5 A;  2L8D A;  4PLL A;  3P5O A;  3OS2 A;  2EQU A;  3PFS A;  4Z1Q A;  4BHW A;  4QSS A;  5E3G A;  2DWW A;  5FH7 A;  3ME9 A;  4O76 A;  5KCH A;  1RI0 A;  4IOO A;  4QSX A;  4YYH A;  3O35 A;  2E7O A;  4J0R A;  5EIC A;  3OYF A;  4O7B A;  5D3N A;  5D7X A;  3UW9 A;  5I7Y A;  2M1H A;  5CQT A;  2R0V A;  3G0J A;  3NTH A;  4C5G A;  5CQ5 A;  5FRN A;  4HXP A;  4O7F A;  4WHU A;  5ENJ A;  5EWC A;  3ZEH A;  5E9Y A;  3D7C A;  3IU5 A;  4TU6 A;  5EPB A;  4WIV A;  5FE3 A;  4QUT A;  5D0C A;  4NS5 A;  5DX4 A;  4BW3 A;  5HRW A;  3O36 A;  4O77 A;  4A9F A;  5ETB A;  4OVA A;  5A85 A;  3DB4 A;  3S3O A;  4E7I A;  3AAD A;  4BE1 A;  5D24 A;  4PTB A;  2HQX A;  5DKH A;  1WJS A;  4MEP A;  4NR7 A;  2D9T A;  2RI7 A;  3Q2F A;  4CUP A;  4MR5 A;  4E7K A;  2YYN A;  2EFI A;  4ALH A;  4NRB A;  3MEA A;  3MB3 A;  3ZYU A;  3SVF A;  2R58 A;  2JZ2 A;  4YYK A;  2EQJ A;  3QBY A;  4PCE A;  5TCM A;  2RS9 B;  3OYD A;  4YK0 A;  4A4F A;  3SVG A;  2WAC A;  5BT3 A;  4IOQ A;  4PL6 A;  5IGM A;  5F3A A;  5L96 A;  5D6W A;  3L42 A;  3LXJ A;  3L2U A;  5CPE A;  5LJ0 A;  4UIX A;  2RHU A;  5EM3 A;  4QQ6 A;  2RI3 A;  5II1 A;  3FLG A;  5FE5 A;  4UIT A;  4LZ2 A;  5EQ1 A;  5EWH A;  3RCW A;  4CL9 A;  3SVH A;  5I29 A;  2RJE A;  3UVW A;  3NTI A;  4RG2 A;  4QYD A;  4QZS A;  3HME A;  5FE1 A;  3S3N A;  3AQA A;  5FH6 A;  1G5V A;  2RJD A;  2RFJ A;  5EWV A;  2X4X A;  4IR5 A;  2DVS A;  5DBM A;  4IOR A;  5C89 A;  1MHN A;  2LTO A;  2R0Y A;  4A9L A;  5CUD A;  3UV4 A;  2R5M A;  4QQD A;  4Z93 A;  5A82 A;  3MXF A;  5AME A;  3S3M A;  2K3Y A;  4Q0N A;  3GOX A;  4BW2 A;  4MEQ A;  1N27 A;  5CUC A;  4L59 A;  4CUS A;  5EWD A;  4QUU A;  3ASK A;  3OY9 A;  4NUD A;  4FU6 A;  4Z6H A;  5F60 A;  3Q1J A;  5KE3 A;  4N4G A;  5II2 A;  4YY6 A;  5F1H A;  2M0O A;  4IR6 A;  4QC3 A;  3MEV A;  5LVQ A;  2E5Q A;  5D25 A;  4O7A A;  5A81 A;  2BIV A;  3U5M A;  2DVR A;  2R0S A;  4IUQ A;  2NXB A;  4BW1 A;  3OYN A;  1KHC A;  5C6S A;  2L5E A;  4UIV A;  3OYA A;  4N4F A;  2YDW A;  3DLM A;  5CY9 A;  2YQD A;  4HXO A;  2PQW A;  5HRV A;  4O78 A;  4QSV A;  4KV4 A;  5L98 A;  5AMF A;  2R10 A;  4LDF A;  5CQ8 A;  5FDZ A;  3OS0 A;  4TT2 A;  5DKC A;  5EI4 A;  5CS8 A;  4LR6 A;  3PMI A;  5DLX A;  2OO1 A;  5FE8 A;  4EDU A;  3UVD A;  4OUF A;  1OYX A;  4ZTF A;  4NQN A;  4E7H A;  5F1L A;  4TT6 A;  5A83 A;  4MR6 A;  5HJC A;  4PY6 A;  5K29 A;  4YBT A;  5DY7 A;  5IN1 A;  3H8Z A;  4RVR A;  3P1E A;  2D82 A;  4NRC A;  5CRM A;  5HEL A;  4QR4 A;  5ETD A;  4NR8 A;  5CFW A;  3FDR A;  5CU8 A;  5FB1 A;  4YAD A;  2RO1 A;  5I86 A;  5FFW A;  5AD2 A;  2YEK A;  3HMF A;  4O72 A;  2DAT A;  3MO8 A;  3OYH A;  4DON A;  5KTU A;  5CUA A;  5HQ7 A;  2L3R A;  2RI2 A;  3U5K A;  3P1F A;  3G0L A;  3H6Z A;  5J0D A;  2VYT A;  4NYX A;  5FRO A;  2F5K A;  5E3D A;  5DYU A;  4XY9 A;  3JVJ A;  4YH3 A;  4QSW A;  2DAQ A;  4ZTJ A;  5ACY A;  2LVM A;  4ZW1 A;  3P1C A;  5A5R A;  5DW1 A;  5F25 A;  4BW4 A;  5I1Q A;  4X2I A;  4YYI A;  3L2V A;  2RNX A;  2O4X B;  3LYI A;  4IR3 A;  4N4H A;  5E9L A;  2I7K A;  2L85 A;  5EU1 A;  5EK9 A;  5KTX A;  5HCL A;  3QKJ A;  4WHW A;  1SSF A;  4MEN A;  5EP7 A;  4Q5W A;  4O75 A;  4LYW A;  5E9I A;  2DVQ A; 
#chains in the Genus database with same CATH topology
 4KCX A;  5KHM A;  3OYG A;  1QW1 A;  3HPW A;  5EA1 A;  5ENG A;  4FYY B;  4NL3 A;  4Q0O A;  1UG1 A;  5IID A;  2LQW A;  3BDL A;  1D1A A;  4M7A C;  4M7A G;  4TZ2 A;  5I2M A;  4DOW A;  5EPR A;  2MOX A;  1RUW A;  5E9K A;  3EG9 A;  4PKC C;  1YJW Q;  1OPL A;  5LJ5 j;  1VQP T;  3I55 T;  2YEL A;  1KSW A;  5FE0 A;  3A8G B;  5DYC A;  3TQ7 P;  3G4S T;  4M7A E;  4N0A C;  1RAI B;  3CCR Q;  1YHQ A;  2RNY A;  3CME Q;  2EGA A;  1YJ9 Q;  3H0F A;  1TXQ A;  4HXK A;  1E6I A;  5FE2 A;  2FHD A;  2RJC A;  2HQH A;  4LYI A;  2V1R A;  2JVV A;  3C12 A;  4E7J A;  4YH4 A;  4HVW A;  3CCU T;  5CQ3 A;  1X27 A;  2ZPB B;  2JXB A;  4ZN3 A;  2NUP B;  3O34 A;  4NYW A;  4OGI A;  1WGS A;  4FL6 A;  5C8G A;  2YEM A;  3QYH B;  1K8A R;  1E6H A;  5LJ2 A;  5GAM d;  4UIZ A;  1WDX A;  8AT1 B;  4C0D C;  3VKH A;  2A0F B;  3FKM X;  2PTK A;  2R5A A;  3MET A;  1QVF S;  1JM4 B;  3CCQ T;  1VQ4 Q;  2XDB A;  3LJW A;  4HBX A;  3QZS A;  1NZ9 A;  1XTD A;  2D0Q B;  5FG6 A;  4PJO A;  5I80 A;  3PMT A;  3TLP A;  2KRO A;  1JJ2 S;  2YW5 A;  2HAX A;  3MEU A;  3VS4 A;  3CCS Q;  4DEY A;  2D8J A;  5GMK e;  3VRY A;  1TOV A;  2OAW A;  2LQK A;  2YRV A;  3M9Q A;  4Z8A A;  2DET A;  1VQO Q;  5CRZ A;  4NUC A;  3V7R A;  4B9X A;  4QR5 A;  4CFK A;  3CMA A;  1M2V A;  1UDL A;  3EH1 A;  2EKO A;  1Y57 A;  4UIY A;  1LNX A;  1B34 A;  4ELY C;  4B9W A;  3ERR A;  4A9K A;  1ZSZ C;  4X34 A;  4YTL A;  3CCL Q;  1MMN A;  4A54 A;  4M7A A;  4ME7 A;  3MJX A;  1OU8 A;  3BDU A;  2BE7 D;  4LZR A;  2JTF A;  2JNG A;  5FBX A;  1I5L A;  1VYV A;  2DTO A;  3M0Q A;  4J1P A;  2E65 A;  5LJ1 A;  5CKH A;  2WP1 A;  5DFC A;  1AWJ A;  1VQ7 T;  4Y28 E;  5KO4 A;  1N72 A;  5FU7 B;  1IHW A;  5CCA A;  2P0K A;  3UV2 A;  3LGF A;  3SD4 A;  2DVE A;  1Y0M A;  3I5R A;  4JLI A;  3DAI A;  3EHR A;  5D26 A;  1Y96 B;  4AKH A;  2B8A A;  3QSU A;  3HRU A;  3CC7 A;  3CPW S;  2RA2 A;  4HCK A;  2YUN A;  2D9E A;  4UIU A;  5L8U A;  1W6X A;  2XDP A;  3CC2 T;  4OB0 B;  5G4R A;  2GFA A;  4M7D D;  1S72 Q;  1S1N A;  4UC4 A;  3I3J A;  3EG9 B;  1K1Z A;  3PVQ A;  1NPR A;  3V7S A;  4CFL A;  3M5A A;  2DIG A;  4M77 E;  1KQS A;  1KQ2 A;  2GBQ A;  3U5J A;  2K7A A;  1WHH A;  4XYA A;  5ENH A;  4LD6 A;  1M30 A;  4YAT A;  1Q81 U;  5FRM A;  2P4T A;  4QQG A;  5LKX A;  3FC3 A;  4NOY A;  5FU6 C;  1X6G A;  5KYN A;  1UGS B;  1VQ9 A;  4PCI A;  5HK0 A;  2X35 A;  5IAY A;  5LVR A;  2RNA A;  5AD3 A;  1G2B A;  2Y4Y A;  1VQ6 Q;  4RTV A;  2VXE A;  5GAN 5;  1WUG A;  4XY8 A;  2MPX C;  5C87 A;  3TU4 K;  3G7Z A;  2DKW A;  5EVA A;  4A63 B;  4PJO B;  4HXS A;  2CP2 A;  2MWP A;  4A9E A;  1WYX A;  4CLB A;  1KQS P;  2VGM A;  4YYJ A;  2QG9 B;  3VUZ A;  3VYG A;  1HJD A;  1IRE B;  2RHI A;  1NEB A;  3CCV A;  4C5I A;  4QSQ A;  5FE7 A;  4Z89 A;  1MV3 A;  5J26 A;  3LQI A;  4QC1 A;  2LRQ A;  5D3S A;  1M2V B;  2JOY A;  1TWB A;  4FW2 A;  3L2Q A;  3P8B B;  1MGQ A;  2KQW A;  2E3K A;  5DKD A;  5KYX A;  1YCS B;  2E41 A;  2BTT A;  4QSP A;  3QZ9 B;  5D3T A;  4HXR A;  4TYL A;  3QG1 A;  1Q81 C;  3HMH A;  3H0I A;  1VQM A;  1B34 B;  5A7C A;  3DWY A;  1UGR B;  2WSF E;  3A8O B;  3CMA T;  2COZ A;  4UYG A;  3OB9 A;  4M7A B;  2YLB A;  1SPK A;  1KFZ A;  2E3I A;  2EBP A;  4M77 A;  2A28 A;  1V1C A;  4L5G A;  4A4H A;  3UWN A;  1QKX A;  1H64 1;  5A0D A;  1PKT A;  3CC4 Q;  4Z6I A;  4KH0 B;  5DLZ A;  3MEW A;  1YJ9 A;  2XG8 D;  2IPO B;  4C67 A;  2J06 A;  4A9J A;  3OYL A;  3S91 A;  1Z9Q A;  2KI7 A;  2C0T A;  1RAD B;  1ZS5 A;  1JO8 A;  2DJQ A;  3OQ5 A;  2XI9 A;  4PLL A;  1B3Q A;  2GTO A;  2RN8 A;  3OS2 A;  2EVR A;  3JCM Q;  4Z1Q A;  3ME9 A;  3OSV A;  1OU9 A;  2H3E B;  1IGQ A;  2W10 A;  4E2F B;  1WI7 A;  2F69 A;  2E7O A;  2PVO B;  5HKC A;  4O7B A;  1VQ4 A;  1SHG A;  4C0D B;  3CC7 T;  4XU3 A;  1BCO A;  5GAN j;  2HCK A;  2VB6 A;  4C5G A;  4MZP A;  3A8L B;  5AT1 B;  3D7C A;  3IU5 A;  1WX6 A;  3PVL A;  3CCJ A;  2C06 A;  3JV3 A;  4QUT A;  5D0C A;  5LJ5 e;  1VQO A;  4BW3 A;  3L2Z A;  3DB4 A;  1M3A A;  4E7I A;  2EJN A;  5D24 A;  5DKH A;  4MEP A;  2J05 A;  1Q95 G;  2HSE B;  3Q2F A;  4CUP A;  1RAC B;  4E7K A;  1RAH B;  4CC4 B;  1VUB A;  4C92 C;  4ALH A;  4C92 G;  1NYG A;  2CUD A;  4Z88 A;  2R58 A;  2EQJ A;  4OB3 B;  3JCM J;  1KIK A;  2RS9 B;  1ZSZ B;  3OYD A;  1VQ9 T;  4JPB W;  4C92 E;  2WAC A;  2KAF A;  2RQV A;  1M90 U;  4V2S A;  5IGM A;  5F3A A;  2L5Q A;  3LXJ A;  3QWY A;  5CPE A;  5LJ0 A;  2PVG B;  3OSS C;  1EIF A;  2LCS A;  4C0Z A;  2VAS A;  2D1X A;  2DD5 A;  4UIT A;  1U06 A;  4MDW A;  1VYT A;  4OMQ A;  4QYD A;  2PZ1 A;  4HXJ A;  3M0P A;  5FH6 A;  1JRI A;  5EWV A;  2X4X A;  1K0X A;  1ZSG A;  1PC0 A;  5HCK A;  5C89 A;  2KY9 A;  4A9L A;  4GLM A;  3VJP A;  2DL4 A;  4WF2 A;  5A82 A;  3X20 B;  3CBO A;  2AKL A;  4MEQ A;  3D7S B;  2KNB B;  4RTT A;  4LDY A;  3ASK A;  3WVE B;  5LJ3 j;  5F60 A;  4RTY A;  5KE3 A;  2AT1 B;  1WIE A;  4BI8 B;  1WZO A;  3G6E Q;  5II2 A;  3GP8 A;  2M0O A;  2OTJ Q;  3E2U A;  3MEV A;  2M9U A;  4O7A A;  2BIV A;  4F17 A;  3U5M A;  2DVR A;  2R0S A;  4J6W A;  4JRI A;  2RM4 A;  5KYU A;  4JJB A;  1CKA A;  4KT0 E;  1VQM T;  4RG8 A;  4FSX A;  3ZL7 C;  4M78 F;  2EJF A;  3VS7 A;  1H8K A;  2CP5 A;  3OYA A;  2EYW A;  5HK3 A;  5A0G A;  2BZX A;  1M90 C;  2YDW A;  1D3B A;  3I5S A;  2MI6 A;  4O6J A;  5GMK j;  4KV4 A;  4A53 A;  5AMF A;  2F2W A;  1BIA A;  4J9F A;  3GBQ A;  1QVF A;  5CS8 A;  2CH4 A;  5FU6 B;  3PIP A;  5DLX A;  2P4R A;  1K0S A;  2DLP A;  1JJ2 A;  2VVK A;  4NQN A;  4DBH A;  4RKU E;  4TT6 A;  1E6G A;  1RI9 A;  4C92 A;  4MR6 A;  1G8X A;  5GAM g;  3GF5 A;  4PY6 A;  4YBT A;  2MIO A;  4KUI A;  3P1E A;  2OX7 A;  2CP3 A;  3CBP A;  4AG2 C;  3FIF A;  5CFW A;  4HCC A;  3OBY A;  3QHS A;  4YAD A;  1QQJ A;  5FLX E;  2ABL A;  3I56 T;  5I86 A;  3EG0 A;  2YEK A;  2QA4 A;  3OYH A;  3MO8 A;  1P92 A;  2L2P A;  1VQ4 T;  3G0L A;  3EFO B;  1VQ8 Q;  3PIO A;  3KBG A;  1HD3 A;  5J0D A;  4J6X A;  4KUD K;  1C0M A;  1GRI A;  4HVV A;  4BW4 A;  3CCJ T;  3L2V A;  1VQO T;  2MF2 A;  4N4H A;  1JJ2 P;  1FWZ A;  5EU1 A;  4F7U A;  1HYO A;  1X2K A;  3QKJ A;  1K73 R;  4WHW A;  2LNV A;  5EP7 A;  4Q5W A;  4LYW A;  5LKZ A;  5E9I A;  2DVQ A;  2CKK A;  1DJ7 B;  1NYF A;  1YWP A;  4LYS A;  2N9G A;  3UV5 A;  5KTW A;  2O2O A;  3D1B A;  4PJN A;  3EFS A;  4QEW A;  3L2W A;  2EQK A;  3TSW A;  2FPF A;  5IHN A;  4QBM A;  5TB6 A;  3CPW A;  5KU3 A;  3RER A;  3OMC A;  1YI2 A;  2F6N A;  1Q86 U;  2LDM A;  1M4Z A;  4F14 A;  1EQF A;  3QZV A;  2CT4 A;  5IBN A;  2ZZD A;  1UEC A;  3O5Z A;  2F2X A;  1PM3 A;  3LLR A;  5IG6 A;  2OTL A;  5A5S A;  2HBW A;  2KE9 A;  1XNI A;  1Q7Y R;  4E7S A;  5CR2 A;  4J3I A;  1RL2 A;  5I40 A;  2CUB A;  4JS5 A;  2A37 A;  1GBR A;  4BDY A;  4NUE A;  3JCM e;  4QEU A;  2AK5 A;  3CCM T;  1GCQ C;  5KYU B;  4YYM A;  2LQ8 A;  2KK4 A;  4IUP A;  3HHT B;  1X69 A;  4AFU C;  4BE0 A;  3UA6 A;  3U5L A;  3LWH A;  1GFD A;  1M1K R;  2BKD N;  5L97 A;  1D3B B;  3ULR B;  4ZQL A;  3OMG A;  3SHW A;  1W70 A;  1X01 A;  4AFQ C;  5FFV A;  3C4S A;  2RPN A;  4YY4 A;  5IGK A;  1WNL A;  3MB4 A;  3RKX A;  1Q86 C;  4CUQ A;  2GF7 A;  2AZS A;  2GTJ A;  2MAM A;  2XK0 A;  2SRC A;  2RMO A;  4RCC A;  4C92 B;  2EPD A;  5IGL A;  4NR9 A;  1WPY A;  4ELZ C;  4M78 C;  2EKH A;  1UEB A;  4M78 G;  4DOV A;  2D6F A;  4M7D C;  1FXX A;  2M0Y A;  3LH5 A;  5FE9 A;  4M7D G;  4J7I A;  5CUG A;  4QSR A;  3I9Q A;  2CP7 A;  4HCZ A;  1M8V A;  1G3S A;  2W0Z A;  1AWX A;  3R6O A;  4M78 E;  2A08 A;  1K9M R;  4NR4 A;  4M7D E;  1BB9 A;  1WXU A;  3EHQ A;  4C66 A;  3O8V A;  4A9M A;  3MP8 A;  5GAN e;  2PNI A;  4BDZ A;  2RB6 A;  2M16 A;  1VQN Q;  4AMC A;  2OJ2 A;  3QUI A;  2IIM A;  2QA4 T;  2CZ0 B;  2JTE A;  2K57 A;  4E7L A;  3QYG B;  3RR6 A;  4Y03 A;  5M9O A;  3M4G A;  5BT4 A;  4NQM A;  3FJP A;  2ATC B;  2EJG A;  3G6E A;  4WCI A;  3IU6 A;  2DFU A;  1YIJ A;  1ZUY A;  3C0C A;  2AIR B;  3ZFJ A;  5D6X A;  3ZBD A;  1QVG S;  2K5F A;  1Y96 A;  3P1D A;  2NLU A;  3G71 Q;  4LZS A;  5CZG A;  2DIL A;  5D7U A;  3K2J A;  3S6W A;  2NWM A;  4QB3 A;  1XOV A;  4KH1 B;  1WQW A;  5I89 A;  5CQX A;  1RLQ C;  2V26 A;  2C0O A;  3O37 A;  3X24 B;  3F70 A;  4WTO B;  5DFD A;  5L8R E;  1ACM B;  2DIQ A;  2Y4X A;  3U23 A;  5C0M A;  2CZ6 B;  1N8R R;  3U5O A;  2HL3 A;  4C5H A;  3FEO A;  5EIS A;  1ZBX A;  1UGV A;  2M02 A;  2DKG A;  2KT1 A;  5IXF A;  1YI2 T;  1T0H A;  3BFM A;  1I0C A;  2E5K A;  2DF6 A;  3NXB A;  4X9C A;  1QP2 A;  2DER A;  4NRA A;  3U5N A;  2OTL T;  2CZ1 B;  5ENE A;  3JVK A;  2ESW A;  2ZAE A;  4BE2 A;  4HXN A;  5DFB A;  1RAF B;  4FW1 A;  4BD3 A;  2CRE A;  5KYY A;  3CD6 Q;  2DL5 A;  2FRW A;  5LJ3 e;  4M7D A;  3O33 A;  4YYD A;  3GLX A;  2K5L A;  3HKS A;  2YSQ A;  3EGU A;  4JUV A;  1VOM A;  1VQ8 A;  5F2P A;  3EFR A;  5CKE A;  5JI8 A;  4HBY A;  5F36 A;  1R8O B;  3H9N A;  4O70 A;  1KJW A;  3I35 A;  4IIO A;  1ABQ A;  3SDZ A;  4O74 A;  1G83 A;  1VQL T;  3PNW C;  4TTE A;  5CQY A;  4Y92 A;  1SRM A;  2FZK B;  2X51 A;  2DTI A;  1JU5 C;  3LQH A;  5A5Q A;  5LUU A;  2HQE A;  1TUG B;  2LC4 A;  4KBM B;  3V8J A;  2RI5 A;  3ONI A;  5E9M A;  4M75 F;  2P0P A;  4J9D A;  1SEM A;  4HT8 A;  3OYC A;  1AZG B;  4O71 A;  5GAN 8;  2J6F A;  2MK5 A;  3HTR A;  4QY4 A;  2CSQ A;  3HRT A;  4CI0 C;  2DE0 X;  1VA7 A;  4II1 A;  4O7E A;  3VYH B;  2QTV A;  1JBM A;  2DVJ A;  2VXF A;  5HY6 A;  4IUV A;  3SFM A;  1PD0 A;  4HA8 A;  1UFF A;  2GNC A;  5GAO r;  2BUD A;  3EAE A;  1M5Q 1;  1KG1 A;  3WXM B;  5EGU A;  4N0A A;  2E4H A;  3DLL A;  4J9H A;  4D8D A;  5GMK m;  3EGD A;  2LT1 A;  4PS5 A;  1RAG B;  4LDX A;  2KDS A;  2LT4 A;  4QSS A;  5GAO q;  4OP0 A;  2HD0 A;  4XU2 A;  1AWW A;  2QAZ A;  4QSX A;  4FSS A;  2DXC A;  2DBK A;  1IRX A;  3G6E T;  5D3N A;  4M78 D;  1PUO A;  3UW9 A;  5I7Y A;  1YIJ T;  2RF0 A;  3H0H A;  1EX4 A;  2CGH A;  5ENJ A;  1NBE B;  5EWC A;  4JJC A;  5AYF A;  4C8Q F;  1AEY A;  1PCX A;  5DX4 A;  5HRW A;  4O77 A;  2BZY A;  5ETB A;  3S3O A;  2FG0 A;  2FRY A;  1JQQ A;  1SF9 A;  4XTX A;  4ZNX A;  2K3B A;  1I5O B;  1M1G A;  1K8A U;  2EFI A;  4M78 B;  3MEA A;  1YHQ T;  5KYY B;  1AT1 B;  2EYY A;  1AOJ A;  2YHT A;  4M7D B;  4LN2 A;  5TCM A;  3KFV A;  2FB7 A;  1WHK A;  2JMA A;  4YK0 A;  3JRZ A;  5FWC A;  5BT3 A;  1EZZ B;  4XTY A;  1BK2 A;  2L3S A;  5L96 A;  2YXY A;  3X26 B;  2KRN A;  2ZPG B;  1NJI R;  1PSF A;  4NL2 A;  1MMD A;  1ZSZ A;  4QQ6 A;  3L1A A;  3FLG A;  5IHK A;  1X75 C;  5EWH A;  4LZ2 A;  3VKG A;  1TUC A;  1VIE A;  3QWX X;  3MCA B;  1VQ8 T;  1EFN A;  3C94 A;  3V8K A;  5GAO l;  3SEM A;  2KYM A;  4FT2 A;  4LXC A;  4CC7 A;  4IOR A;  2R0Y A;  3ER0 A;  2R5M A;  1C6V X;  1YJN Q;  2FZC B;  2LJ0 A;  1D0X A;  3HP9 A;  5AME A;  1M1F A;  2K3Y A;  4Q0N A;  2OAU A;  3GOX A;  1N27 A;  3S3M A;  5CUC A;  3M57 A;  5EWD A;  3OY9 A;  1QCO A;  4FU6 A;  5GAN 2;  1WHM A;  4Z6H A;  2GGR A;  3M53 A;  4N4G A;  4JRQ A;  7AT1 B;  4R56 A;  3A8H B;  1K8A C;  5I22 A;  5LVQ A;  2E5Q A;  5D25 A;  1BI3 A;  2ZPH B;  3A8M B;  3X25 B;  3OYN A;  3AHU A;  1YJW A;  2RD1 A;  4N4F A;  3DLM A;  3CCR A;  2YQD A;  4QSV A;  3CME A;  1J3T A;  5L98 A;  4X1V A;  3EGD B;  4LDF A;  3RNJ A;  1D1C A;  1OUL A;  2X3W D;  5DKC A;  1QLY A;  1MUZ A;  3QDR B;  4LR6 A;  1O9S A;  3PMI A;  2L3P A;  3UVD A;  5LJ3 f;  4OUF A;  1OYX A;  3IQL A;  2QYZ A;  2JJ9 A;  3INZ A;  4E7H A;  5A83 A;  1PNJ A;  5LL6 S;  3RMS A;  3M59 A;  1IB8 A;  5IN1 A;  3H8Z A;  4RVR A;  3PGG A;  5HEL A;  3BE3 A;  3I55 Q;  2X4J A;  4JZ3 A;  3G4S Q;  2ECZ A;  5CU8 A;  1PRM C;  2RO1 A;  4QVC A;  5FFW A;  4O72 A;  5KTU A;  2RI2 A;  3P1F A;  5EC7 A;  2YUO A;  3CCS A;  4LUD A;  5FRO A;  1G3Y A;  2F5K A;  5DYU A;  2K4Y A;  3JVJ A;  4YH3 A;  5J3B A;  3P1C A;  5DW1 A;  3EFO A;  4YYI A;  2O4X B;  2RQW A;  2DL3 A;  5E9L A;  1Y7X A;  1QMC A;  2I7K A;  2AZV A;  4OB2 B;  5HCL A;  3AT1 B;  2COY A;  3TVT A;  1K76 A;  4PFO A;  4O75 A;  4XQ3 A;  3J7A F;  2F5T X;  3EG1 A;  3CCQ Q;  2YLC A;  4C8Q C;  5GAN 6;  1BYM A;  2XID A;  4C8Q G;  3OYI A;  1WHL A;  3CCL A;  2OUO A;  2RHY A;  5LKU A;  1WFW A;  3JB9 F;  1R77 A;  2KMT A;  1AD5 A;  2X4W A;  4XTV A;  4J83 A;  5H1U A;  2X4Y A;  3REA B;  5D3H A;  3E9F A;  1M27 C;  2XMF A;  4KGX B;  4N3W A;  2R57 A;  1ZHI A;  1QVG A;  4ZGD B;  5DM7 R;  4XU0 A;  4PLI A;  4CRI A;  1OV3 A;  1YP5 A;  2G3R A;  3VS1 A;  1KD1 R;  3RKY A;  2V1Q A;  3OYM A;  2YRC A;  3GG3 A;  1M2O A;  5CO7 A;  4F16 A;  8ATC B;  3JAM E;  1BCM A;  2Z0W A;  2DXU A;  3M0T A;  4LRG A;  2P0Q A;  4LDV A;  4UYF A;  3TEE A;  2QEX Q;  4UYD A;  5LJ3 h;  2HZY A;  1GBQ A;  2CYZ B;  3S92 A;  4A4G A;  3CCV T;  1ZBJ A;  4OB1 B;  2QDL A;  4RTZ A;  1UGP B;  1F1B B;  1S72 A;  1OZ2 A;  1W4S A;  1LPL A;  4QST A;  2EYQ A;  5KE2 A;  4TS8 A;  5HLS A;  5J39 A;  1VQK Q;  1BI2 A;  2PUO B;  1LJO A;  2K5I A;  1VQ7 Q;  2EJ9 A;  1B07 A;  3P8H A;  4DBR A;  4BAC A;  1UJ0 A;  2IVW A;  4BUG A;  3OYE A;  5EV9 A;  1H3Z A;  3M0R A;  4R0K A;  4LNP A;  2EYX A;  5A5O A;  2YT6 A;  1N5Z A;  5GMK h;  2DPP B;  1YJW T;  3UA7 A;  4IUR A;  3MP1 A;  2QAS A;  1PWT A;  3CCR T;  2QQR A;  3MKD A;  5D3P A;  2JS0 A;  3CME T;  1YJ9 T;  3CC2 Q;  2GFU A;  3JB9 I;  5G4S A;  2K6D A;  2RQT A;  5F61 A;  1CKB A;  4XTZ A;  4KGV B;  2HKQ B;  4YBM A;  5ENF A;  4JRP A;  1E7O A;  1UGQ B;  2CH4 W;  4EMK C;  5GMK l;  3OYB A;  1VQ6 A;  5BT5 A;  3NFC A;  3QII A;  2LNH B;  1TS9 A;  1Q82 R;  1B7T A;  3HSB A;  5DYA A;  1FMK A;  2E6Z A;  5H1T A;  3OS1 A;  4UYE A;  5GAM j;  4UIW A;  5F5Z A;  3A98 A;  1I07 A;  3TSZ A;  1O75 A;  3JCM c;  4FCY A;  3SWN C;  1WJQ A;  4A9O A;  4PJO F;  2LSP B;  2COW A;  2E6N A;  4F3I A;  2GCX A;  2A36 A;  1UTI A;  3CCS T;  1TU0 B;  5D3L A;  5GMK i;  2QQB A;  1WJR A;  5KCO A;  2RH2 A;  4GY5 A;  4M75 D;  3CBM A;  3MUL A;  3OYK A;  3JVM A;  2XU8 A;  1QVF P;  1KQS S;  1KC8 R;  1NM7 A;  3HFN A;  3UVY A;  4J6Y A;  4BI4 A;  1PKS A;  2G6F X;  4OMM A;  2I8N A;  3LWI A;  4PKL A;  3UT1 A;  2E7N A;  1KHI A;  5HQ5 A;  2MJV B;  5DW2 A;  4HBW A;  4AKN A;  5CKD A;  5CQA A;  4PFP A;  1ZUU A;  2HSP A;  4DBF A;  2J6K A;  3OYJ A;  3JVL A;  4IKF A;  5DYX A;  5CTL A;  2QQS A;  2ZPF B;  3CC4 A;  1D09 B;  4K11 A;  4M7A F;  4HXL A;  1QWE A;  2MWO A;  5I7X A;  3CCL T;  3EGX B;  1T3L A;  4ZC9 A;  3E9G A;  4HCB A;  5ENC A;  4D8K A;  1RAB B;  2VWF A;  2RQR A;  5COI A;  2VV5 A;  2DXT A;  2PUK B;  4NXJ A;  2EAY A;  2CSI A;  3NTK A;  9ATC B;  2DEU A;  1BKB A;  1ZKR A;  1IGU A;  5I83 A;  1X6O A;  3QJ6 A;  1PD1 A;  2E10 A;  2QGG A;  5C7N A;  4UYF B;  2FZG B;  3CCE Q;  2XDD A;  3BW1 A;  5IGN A;  2GQV A;  4D6W A;  4MZT A;  5FG4 A;  4IUU A;  3LH0 A;  4EMK A;  4RTU A;  2LMJ A;  5KH6 A;  4YAX A;  3LX7 A;  2JMC A;  2K9G A;  3KUF A;  1OI1 A;  4A9H A;  1WHG A;  4C8Q D;  1IZ6 A;  4O7C A;  5CQ6 A;  1S72 T;  1QVP A;  5C4Q A;  2LJ3 A;  5GAO m;  5LJ5 f;  2ROL A;  3SWN A;  4OMO A;  4XUB A;  3LQJ A;  3CPW P;  4XK8 E;  2NYS A;  2LZ6 B;  2K2M A;  4RUG A;  5E74 A;  4MMK A;  2L89 A;  3JCM P;  1LCK A;  5CP5 A;  5GJV B;  4QNS A;  2F1L A;  5I88 A;  3CCQ A;  5HFR A;  4CUR A;  2VGN A;  1YFN A;  4HBV A;  3SB2 A;  3CC7 Q;  4LD9 K;  1D0Z A;  5E7D A;  4Z02 A;  5FFY A;  2AKK A;  4OMN A;  4OGC A;  2XIC A;  2QI2 A;  4QT7 A;  4AKI A;  3JB9 H;  4IUT A;  2E70 A;  1G3T A;  4N4I A;  2DZ9 A;  5CIU A;  1VQ6 T;  1OPK A;  2GRC A;  3VRZ A;  5GAN 3;  4J9E A;  2H60 A;  2OSS A;  4EMG A;  3HFO A;  2H8H A;  4QW2 A;  3VS0 A;  4QVD A;  2FVU A;  4MR4 A;  2VKN A;  1QCF A;  2F6J A;  3MUK A;  1K73 U;  1UB4 A;  3HRS A;  2QEX A;  3KXT A;  3P5O A;  3GNF B;  2QXF A;  5E3G A;  5FH7 A;  4DEX A;  4O76 A;  1RI0 A;  4ATO A;  1TTH B;  4IOO A;  4YYH A;  3O35 A;  4E47 A;  1HXD A;  2OTJ A;  2O31 A;  3OYF A;  1VQK A;  4LDW A;  1I81 A;  1LOJ A;  4JS4 A;  5CQT A;  1PHT A;  4PJO C;  1R0B G;  1GCQ A;  4PJO G;  1XQH A;  3NTH A;  5CQ5 A;  1MNE A;  4M77 F;  1MV0 B;  5E9Y A;  4TU6 A;  5EPB A;  4WIV A;  3QDF A;  2DMO A;  5LJ5 h;  3X28 B;  3G1J A;  1QKW A;  1Q7Y U;  2DTH A;  4AT1 B;  3CC4 T;  2DL7 A;  4PJJ A;  4OVA A;  3CC2 A;  2KRS A;  4FIB A;  4BE1 A;  4PTB A;  2XD0 A;  2D9T A;  4RTX A;  2RI7 A;  2XHC A;  1X43 A;  2YYN A;  4FM4 B;  3VS2 A;  4NRB A;  4EMK B;  1UHC A;  1K73 C;  3A5Z B;  3SVF A;  4XTU A;  2JZ2 A;  1VQM Q;  2DBM A;  4J9I A;  5LJ5 g;  4PCE A;  1YWO A;  3R6N A;  4PK4 A;  2DJZ A;  2KXD A;  4M78 A;  3JCM X;  1M1K U;  4AI6 A;  3RKW A;  4PL6 A;  1LVK A;  2DRK A;  3M56 A;  5D6W A;  2ED1 A;  4UIX A;  2VUB A;  4M4Z A;  2RHU A;  5EM3 A;  1H3H A;  3SWN B;  5II1 A;  5FE5 A;  4Y91 A;  5EQ1 A;  3RCW A;  3SVH A;  3QPH A;  5I11 A;  5I29 A;  1W2B S;  1JB0 E;  3S3N A;  3AQA A;  1G5V A;  2RJD A;  1SG5 A;  2RFJ A;  1U3O A;  5DBM A;  4FYX B;  2LTO A;  1D0Y A;  5CUD A;  1SHF A;  4Z93 A;  2F2V A;  2DYI A;  1Q7Y C;  1FMV A;  4BW2 A;  5DLO A;  4CUS A;  4QUU A;  1K9A A;  4NUD A;  1Q81 R;  2AHJ B;  3GPL A;  3Q1J A;  1ZA2 B;  2DL8 A;  3I56 Q;  4L6V 5;  3JB9 D;  2QQ9 A;  3OS5 A;  4YY6 A;  2VC8 A;  4IR6 A;  1K9M U;  1FYN A;  4QC3 A;  5A81 A;  3QXE B;  4J9G A;  3CXC S;  2CP6 A;  2YWW A;  4OF1 A;  5GAO p;  2NXB A;  3M0S A;  4B6M A;  1M1K C;  1U8R A;  2QDY B;  5GAM e;  2FPD A;  3CCJ Q;  5HRV A;  4O78 A;  4TVR A;  5IH2 A;  2JW4 A;  3CCE A;  5EI4 A;  3M4Y A;  3OYY A;  4KRT A;  3NMZ C;  3JCM f;  3MPU B;  5F1L A;  3A1P A;  5HJC A;  4OMP A;  1YIT Q;  2YDL A;  5K29 A;  4X9D A;  2E1H A;  2QEX T;  2D82 A;  4NRC A;  4QR4 A;  4NR8 A;  5FB1 A;  3RES A;  3MHX A;  1K9M C;  1N8R U;  4ZGE B;  2OTJ T;  4DON A;  5CUA A;  5HQ7 A;  2KRM A;  1VQK T;  2M51 A;  1RAA B;  4NYX A;  2DO3 A;  3UAT A;  2DAQ A;  4ZTJ A;  5ACY A;  2LVM A;  4ZW1 A;  3M54 A;  4X2I A;  3OBW A;  2RNX A;  2C0I A;  4IIM A;  3CCM Q;  4IR3 A;  2QK0 A;  5DLQ E;  1W1F A;  2WSE E;  2L85 A;  5EK9 A;  5KTX A;  4BY6 C;  4MEN A;  1BBZ A;  2PU9 B;  4XTW A;  2O4X A;  4M77 C;  3PT9 A;  2RHX A;  4M77 G;  4C92 F;  4J0S A;  1VQ5 Q;  1IO6 A;  2K2V A;  3NHN A;  4C0F A;  5A0L A;  4EPC A;  3RUX A;  1FMW A;  2ROT A;  3RMQ A;  5D6Y A;  1YBY A;  5GAN f;  5L99 A;  4KGZ B;  3EG3 A;  4PJO D;  2DEQ A;  2Y90 A;  1HK9 A;  5HEM A;  1VQN A;  3UF4 A;  1Y07 A;  1N8R C;  4E96 A;  3DB3 A;  3Q2E A;  1U1S A;  4NR6 A;  2A7Y A;  4XU1 A;  2QQA A;  5EWW A;  2E64 A;  3FRN A;  1BI0 A;  5LKT A;  2KEA A;  2V8I A;  4EIK A;  2O9V A;  4YAB A;  2EQM A;  3J81 E;  4HVU A;  1OEB A;  1GFC A;  1A0N B;  2J6O A;  3JCM h;  5A2Q E;  4YC9 A;  5FWB A;  1WLP B;  3C95 A;  4F7U F;  1WQ7 A;  4PFZ A;  5IT9 E;  6AT1 B;  4LC2 A;  1G3W A;  3G71 A;  4MEO A;  3UVX A;  5F62 A;  4M7A D;  4EMH A;  5HM0 A;  4ALG A;  2JN0 A;  2DVV A;  3OW2 S;  5E9V A;  1N6A A;  2JT4 A;  3N5B B;  2QA4 Q;  2CT3 A;  2NUZ A;  5GAN 7;  3EG2 A;  1M90 R;  3MP6 A;  1M3B A;  2KTB B;  1JSP B;  5CQ7 A;  5C85 A;  1PG5 B;  5DY9 A;  3MQM A;  3JCM g;  2HDA A;  1TUD A;  4AG1 C;  5ENB A;  3DKM A;  2QGF B;  5EPS A;  5CUE A;  3OA6 A;  3VU3 C;  4GBQ A;  4RTW A;  2O01 E;  5CKB A;  3REB B;  3NGP A;  4E6R A;  2I2L A;  4OGJ A;  4E7Z A;  4M75 C;  4M75 G;  2D8H A;  4AKG A;  3GIB A;  4PJL A;  2JTM A;  3U5P A;  3CEY A;  1YNZ A;  3CCE T;  1YN8 A;  1IXD A;  4HXM A;  5L23 A;  1SKU B;  4M75 E;  5D3J A;  4LDU A;  4QEV A;  3CD6 A;  1OX9 A;  2QTX A;  5IXB A;  3CQT A;  1SRL A;  5HRX A;  2DNU A;  1Y71 A;  4QR3 A;  1AWO A;  1VQP Q;  2WP2 A;  2MCN A;  2G4A A;  1ZA1 B;  1I8F A;  2ZCF B;  2CS7 A;  1AVZ C;  2DA9 A;  5LJ5 d;  2LJ1 A;  2E3H A;  5GAN h;  4A9I A;  4C5E A;  1YI2 Q;  3URG A;  4J9B A;  3VUB A;  1MMG A;  3BY7 A;  4A9N A;  4IR4 A;  1U5S A;  4A4E A;  5FG5 A;  4QYL A;  3UPU A;  2OTL Q;  3CCU Q;  4AFZ C;  2FSA A;  1NEG A;  1M3C A;  3I56 A;  4TZ8 A;  4CUU A;  4J8O A;  3VKI A;  5GAN g;  4YYG A;  5EG2 A;  4MR3 A;  3QZ5 B;  2DD4 A;  4PNO A;  2LX9 A;  3L2R A;  2EGC A;  3P8D A;  1NJI U;  1JXO A;  4UYH A;  5E0R A;  5FB0 A;  4YYN A;  1M8M A;  1WA7 A;  2FYK A;  5GAM f;  2DX1 A;  2A3L A;  4DA4 A;  2IG0 A;  4CUT A;  4XUA A;  2K79 A;  5CQ4 A;  1VQL Q;  3GNG A;  5FW9 A;  2RJF A;  1H92 A;  5ENI A;  2JS2 A;  4FYV B;  4ORZ A;  2NUT A;  4C8Q E;  4ZN1 A;  4NR5 A;  4TQN A;  1X0J A;  5A5P A;  1MND A;  1QP3 A;  4ESR A;  4GPJ A;  1I4K 1;  4MZM A;  2DXB A;  4QVZ A;  2P84 A;  3EGX A;  3VS3 A;  5FH8 A;  1VQN T;  2KR3 A;  3RBB B;  1YIT A;  4FLP A;  4M75 A;  5HQ6 A;  4TU4 A;  1NG2 A;  3VS5 A;  4BI3 A;  4RMO A;  2PVD B;  3H41 A;  2RK1 A;  1GL5 A;  3LGL A;  2K3X A;  4J5Y A;  5HFQ A;  2L84 A;  1MMA A;  3D1D A;  4JDS A;  2RHZ A;  4M77 D;  3V7C A;  4TT4 A;  1OZ3 A;  5CVI A;  5ECA A;  1NJI C;  4QSU A;  1D1B A;  2YRD A;  5F63 A;  3G71 T;  1HSQ A;  1I1J A;  2WSC E;  2ENM A;  2FO0 A;  5KYW A;  5HEN A;  2LQN A;  2HMA A;  4KV1 A;  3FB9 A;  5JWM A;  4NYV A;  5KYX B;  2I0N A;  1QCN A;  5CAI A;  5CGP A;  5LJ3 g;  1QVG P;  3CCM A;  1T0J A;  4LUE A;  1SSH A;  1Q86 R;  4Z1S A;  5E73 A;  4YBS A;  4F7U G;  2LCC A;  2RNW A;  5CK9 A;  5L8T A;  4BY6 B;  4MML A;  1W2B A;  4F7U E;  1YIJ Q;  1VQ5 A;  4M77 B;  5H1V A;  4LE9 A;  5D3R A;  3JCM b;  4HT9 A;  1F68 A;  2DM1 A;  5IHI A;  4JJD A;  5CUB A;  1KK7 A;  1AZE A;  5FE6 A;  2DRM A;  4CC3 A;  4BJX A;  4M7D F;  4C8Q A;  5GAM h;  3CD6 T;  2FPE A;  1TSF A;  4VUB A;  3JB9 J;  3VV0 A;  1YCY A;  2MYS A;  5GAO n;  2E12 A;  2ZGW A;  1OX8 A;  1WUM A;  3QZT A;  1ZLM A;  5H85 A;  2RO0 A;  3CXC A;  4JZ4 A;  4QKU A;  2HL5 C;  5A5N A;  5FE4 A;  1YHQ Q;  1NPP A;  1IHV A;  1YJN A;  2L8D A;  2DZC A;  3EH2 A;  4F04 B;  1V29 B;  1VIF A;  2EQU A;  3PFS A;  4KUL A;  1W2B P;  4BHW A;  2DWW A;  5KCH A;  2EQI A;  1ZUK A;  1ZQ1 A;  2DYB A;  4J0R A;  5GJW B;  3T9N A;  5EIC A;  2EGE A;  2LX7 A;  5D7X A;  4PJM A;  2FL7 A;  2M1H A;  2R0V A;  3G0J A;  1UE9 A;  2X3X D;  5FRN A;  4HXP A;  2YUQ A;  4O7F A;  4WHU A;  2OI3 A;  4FT4 A;  4J7F A;  3ZEH A;  2FEI A;  2NUT B;  4MDX A;  4CC2 A;  3THK A;  2KBT A;  3JCM V;  1AHJ B;  1KD1 U;  5FE3 A;  4P5N A;  2CZ7 B;  4NS5 A;  1N9S A;  3FJ5 A;  3O36 A;  3CXC P;  4A9F A;  1Z9Z A;  3QJY A;  4RCB A;  5A85 A;  4JJN K;  3AAD A;  4OML A;  5CKF A;  2HQX A;  4M75 B;  1JEG A;  1WJS A;  4NR7 A;  3JCM d;  2HKN A;  1FX7 A;  1NE8 A;  2ED0 A;  2ZPE B;  4DQ2 A;  4OGE A;  4MR5 A;  2LP5 A;  1RLP C;  4HKE A;  3VS6 A;  1TH7 A;  3MB3 A;  3ZYU A;  3M0U A;  1RAE B;  3CMA Q;  4YYK A;  3QBY A;  3J80 E;  3RDV A;  3JB9 G;  1YIT T;  1UHF A;  2X9H A;  1VQP A;  3JCM W;  4A4F A;  2D0N A;  3I55 A;  3SVG A;  1XJW B;  4IOQ A;  3G4S A;  1U1T A;  3L42 A;  3L2U A;  3HL8 A;  2BE9 B;  3PE0 A;  2RI3 A;  5KYW B;  2HEQ A;  2H3J A;  2RJE A;  3NTI A;  1BIB A;  2KSS A;  1WXT A;  4CL9 A;  4RG2 A;  4R55 A;  3UVW A;  1BU1 A;  3HME A;  4QZS A;  5FE1 A;  2SEM A;  1M9S A;  2CDT A;  2KXC A;  5I21 A;  3CCU A;  1CSK A;  3M55 A;  4IR5 A;  2DVS A;  2O88 A;  1R0C B;  1MHN A;  1KD1 C;  4QQD A;  3UV4 A;  5FU7 C;  4OMF B;  1C1A A;  3MXF A;  2XKO C;  1QWF A;  4L59 A;  4O5V A;  4C92 D;  1Q82 U;  1X2Q A;  2MMP A;  2NUP A;  4DBQ A;  5F1H A;  1JXM A;  1VQL A;  2RQU A;  2EW3 A;  4BB7 A;  4C8Q B;  4J9C A;  1VQ5 T;  4IUQ A;  1T3S A;  2CP0 A;  3PTA A;  3LW5 E;  5GAN d;  4JRK A;  1PRL C;  4BW1 A;  1KHC A;  5C6S A;  3JSC A;  2EWN A;  2L5E A;  3QO3 A;  4UIV A;  2JM9 A;  4A4K A;  2JUF A;  5CY9 A;  4HXO A;  2J7I A;  2L0A A;  2PQW A;  1UJY A;  5GAN 4;  2R10 A;  1NLP C;  1ZX6 A;  5CQ8 A;  5FDZ A;  1OQK A;  2EIF A;  4TT2 A;  2ZPI B;  4GLK A;  3TRE A;  4ZGJ B;  3OS0 A;  3OW2 A;  1KC8 U;  4ANJ A;  2OO1 A;  3NPF A;  5FE8 A;  4EDU A;  3CPF A;  4ZTF A;  3V8L A;  1TG0 A;  1WHJ A;  2KGT A;  4C0G A;  2KYB A;  1YJN T;  3WVD B;  5DY7 A;  1OOT A;  2HBP A;  3UDC A;  4AFS C;  1VQ9 Q;  5CRM A;  5ETD A;  2BZ8 A;  3RIR A;  2DK3 A;  2RK2 A;  2O9S A;  1Q82 C;  3FDR A;  2LCL A;  5I2S A;  4JLG A;  5AD2 A;  2GQI A;  3HMF A;  1VQ7 A;  2DAT A;  2L3R A;  2L3Q A;  3U5K A;  1UUE A;  1WXB A;  2HNI A;  3H6Z A;  1GCP A;  3M58 A;  2KT8 A;  2VYT A;  1N9R A;  2V8J A;  5E3D A;  1K4U S;  2B86 A;  4XY9 A;  1BI1 A;  2KVQ G;  4F7U B;  1PSE A;  4PJO E;  4QSW A;  3TCJ A;  5A5R A;  3OW2 P;  2V8K A;  5F25 A;  5I1Q A;  1VYU A;  3CCV Q;  1V76 A;  1KQ1 A;  1X6B A;  2YUP A;  3LYI A;  4FYW B;  2EYZ A;  1ABO A;  1ARK A;  3E1S A;  1GXI E;  3E19 A;  4XAX B;  1KC8 C;  1SSF A;  5LJ3 d;  2JM8 A;  1NLO C; 
#chains in the Genus database with same CATH homology
 4KCX A;  5KHM A;  3OYG A;  1QW1 A;  3HPW A;  5EA1 A;  5ENG A;  4NL3 A;  4Q0O A;  5IID A;  3BDL A;  4M7A C;  4M7A G;  4TZ2 A;  5I2M A;  4DOW A;  5EPR A;  5E9K A;  4PKC C;  1VQP T;  5LJ5 j;  3I55 T;  2YEL A;  5FE0 A;  3A8G B;  5DYC A;  3G4S T;  4M7A E;  4N0A C;  1YHQ A;  2RNY A;  4HXK A;  1E6I A;  5FE2 A;  2FHD A;  2RJC A;  4LYI A;  2JVV A;  3C12 A;  4E7J A;  4YH4 A;  3CCU T;  5CQ3 A;  2ZPB B;  4ZN3 A;  3O34 A;  4NYW A;  4OGI A;  1WGS A;  4FL6 A;  5C8G A;  2YEM A;  3QYH B;  5LJ2 A;  5GAM d;  4UIZ A;  4C0D C;  3MET A;  3FKM X;  2R5A A;  1QVF S;  1JM4 B;  3CCQ T;  2XDB A;  3LJW A;  4HBX A;  3QZS A;  1NZ9 A;  1XTD A;  2D0Q B;  5FG6 A;  4PJO A;  5I80 A;  3PMT A;  3TLP A;  1JJ2 S;  2HAX A;  2YW5 A;  3MEU A;  5GMK e;  2LQK A;  2YRV A;  3M9Q A;  5CRZ A;  4NUC A;  3V7R A;  4B9X A;  4QR5 A;  4CFK A;  3CMA A;  2EKO A;  4UIY A;  1LNX A;  1B34 A;  4ELY C;  4B9W A;  4A9K A;  4X34 A;  4YTL A;  4A54 A;  4M7A A;  4ME7 A;  3BDU A;  4LZR A;  2JTF A;  2JNG A;  5FBX A;  1I5L A;  2DTO A;  4J1P A;  2E65 A;  5LJ1 A;  5CKH A;  2WP1 A;  5DFC A;  1VQ7 T;  4Y28 E;  5KO4 A;  1N72 A;  5FU7 B;  5CCA A;  2P0K A;  3UV2 A;  3LGF A;  3SD4 A;  2DVE A;  4JLI A;  3DAI A;  5D26 A;  1Y96 B;  2B8A A;  3QSU A;  3HRU A;  3CC7 A;  3CPW S;  2RA2 A;  2D9E A;  4UIU A;  5L8U A;  2XDP A;  3CC2 T;  4OB0 B;  5G4R A;  2GFA A;  4M7D D;  4UC4 A;  3I3J A;  1NPR A;  3V7S A;  4CFL A;  3M5A A;  2DIG A;  4M77 E;  1KQS A;  1KQ2 A;  3U5J A;  4XYA A;  5ENH A;  4LD6 A;  4YAT A;  1Q81 U;  5FRM A;  2P4T A;  4QQG A;  5LKX A;  3FC3 A;  4NOY A;  5FU6 C;  1UGS B;  1VQ9 A;  4PCI A;  5HK0 A;  2X35 A;  5IAY A;  5LVR A;  5AD3 A;  2Y4Y A;  2VXE A;  5GAN 5;  1WUG A;  4XY8 A;  5C87 A;  3TU4 K;  3G7Z A;  2DKW A;  5EVA A;  4PJO B;  4HXS A;  2MWP A;  4A9E A;  4CLB A;  2VGM A;  4YYJ A;  3VUZ A;  3VYG A;  1IRE B;  2RHI A;  3CCV A;  4C5I A;  4QSQ A;  5FE7 A;  5J26 A;  3LQI A;  4QC1 A;  2LRQ A;  5D3S A;  2JOY A;  3L2Q A;  3P8B B;  1MGQ A;  2KQW A;  2E3K A;  5DKD A;  2E41 A;  4QSP A;  3QZ9 B;  5D3T A;  4HXR A;  4TYL A;  3QG1 A;  1Q81 C;  3HMH A;  1VQM A;  1B34 B;  5A7C A;  3DWY A;  1UGR B;  2WSF E;  3A8O B;  3CMA T;  4UYG A;  3OB9 A;  4M7A B;  2YLB A;  4M77 A;  4L5G A;  4A4H A;  3UWN A;  1H64 1;  5A0D A;  4Z6I A;  5DLZ A;  3MEW A;  1YJ9 A;  2XG8 D;  4C67 A;  4A9J A;  3OYL A;  3S91 A;  1ZS5 A;  3OQ5 A;  2XI9 A;  4PLL A;  3OS2 A;  3JCM Q;  4Z1Q A;  3ME9 A;  3OSV A;  2F69 A;  2E7O A;  2PVO B;  5HKC A;  4O7B A;  1VQ4 A;  4C0D B;  3CC7 T;  4XU3 A;  5GAN j;  4C5G A;  4MZP A;  3A8L B;  3D7C A;  3IU5 A;  3CCJ A;  2C06 A;  4QUT A;  5D0C A;  5LJ5 e;  1VQO A;  4BW3 A;  3L2Z A;  3DB4 A;  4E7I A;  5D24 A;  5DKH A;  4MEP A;  3Q2F A;  4CUP A;  4E7K A;  1VUB A;  4C92 C;  4ALH A;  4C92 G;  2R58 A;  2EQJ A;  4OB3 B;  3JCM J;  2RS9 B;  3OYD A;  1VQ9 T;  4C92 E;  2WAC A;  2KAF A;  1M90 U;  4V2S A;  5IGM A;  5F3A A;  2L5Q A;  3LXJ A;  5CPE A;  5LJ0 A;  2PVG B;  3OSS C;  1EIF A;  4C0Z A;  2DD5 A;  4UIT A;  4MDW A;  4QYD A;  5FH6 A;  1JRI A;  5EWV A;  2X4X A;  5C89 A;  2KY9 A;  4A9L A;  3VJP A;  4WF2 A;  5A82 A;  3X20 B;  3CBO A;  4MEQ A;  4LDY A;  3ASK A;  3WVE B;  5LJ3 j;  5F60 A;  5KE3 A;  4BI8 B;  5II2 A;  3GP8 A;  2M0O A;  3MEV A;  2M9U A;  4O7A A;  2BIV A;  3U5M A;  2DVR A;  2R0S A;  4J6W A;  4JRI A;  2RM4 A;  4KT0 E;  1VQM T;  4RG8 A;  4FSX A;  4M78 F;  2EJF A;  3OYA A;  5HK3 A;  5A0G A;  1M90 C;  2YDW A;  1D3B A;  2MI6 A;  4O6J A;  5GMK j;  4KV4 A;  4A53 A;  5AMF A;  1BIA A;  1QVF A;  5CS8 A;  5FU6 B;  3PIP A;  5DLX A;  1JJ2 A;  4NQN A;  4RKU E;  4TT6 A;  4C92 A;  4MR6 A;  5GAM g;  3GF5 A;  4PY6 A;  4YBT A;  4KUI A;  3P1E A;  3CBP A;  3FIF A;  5CFW A;  4HCC A;  3OBY A;  3QHS A;  4YAD A;  5FLX E;  3I56 T;  5I86 A;  2YEK A;  2QA4 A;  3OYH A;  3MO8 A;  1P92 A;  1VQ4 T;  3G0L A;  3PIO A;  3KBG A;  5J0D A;  4J6X A;  4KUD K;  4BW4 A;  3CCJ T;  3L2V A;  1VQO T;  2MF2 A;  4N4H A;  1FWZ A;  5EU1 A;  4F7U A;  3QKJ A;  4WHW A;  2LNV A;  5EP7 A;  4Q5W A;  4LYW A;  5LKZ A;  5E9I A;  2DVQ A;  2CKK A;  1DJ7 B;  4LYS A;  2N9G A;  3UV5 A;  5KTW A;  3EFS A;  4QEW A;  3L2W A;  2EQK A;  4QBM A;  5TB6 A;  3CPW A;  5KU3 A;  3RER A;  3OMC A;  1YI2 A;  2F6N A;  1Q86 U;  2LDM A;  1M4Z A;  1EQF A;  3QZV A;  5IBN A;  2ZZD A;  3LLR A;  5IG6 A;  2OTL A;  5A5S A;  1XNI A;  5CR2 A;  4J3I A;  1RL2 A;  5I40 A;  4JS5 A;  4BDY A;  4NUE A;  3JCM e;  4QEU A;  3CCM T;  4YYM A;  2LQ8 A;  2KK4 A;  4IUP A;  3HHT B;  4BE0 A;  3U5L A;  3LWH A;  2BKD N;  5L97 A;  1D3B B;  4ZQL A;  3OMG A;  1X01 A;  5FFV A;  3C4S A;  4YY4 A;  5IGK A;  1WNL A;  3MB4 A;  3RKX A;  1Q86 C;  4CUQ A;  2GF7 A;  2MAM A;  2XK0 A;  4RCC A;  4C92 B;  5IGL A;  4NR9 A;  1WPY A;  4ELZ C;  4M78 C;  1UEB A;  4M78 G;  4DOV A;  2D6F A;  4M7D C;  1FXX A;  5FE9 A;  4M7D G;  4J7I A;  5CUG A;  4QSR A;  4HCZ A;  1M8V A;  1G3S A;  3R6O A;  4M78 E;  4NR4 A;  4M7D E;  4C66 A;  3O8V A;  4A9M A;  3MP8 A;  5GAN e;  4BDZ A;  2RB6 A;  2M16 A;  3QUI A;  2QA4 T;  2CZ0 B;  2K57 A;  4E7L A;  3QYG B;  4Y03 A;  5M9O A;  3M4G A;  5BT4 A;  4NQM A;  3FJP A;  2EJG A;  3G6E A;  3IU6 A;  1YIJ A;  3ZFJ A;  5D6X A;  3ZBD A;  1QVG S;  2K5F A;  1Y96 A;  3P1D A;  2NLU A;  4LZS A;  5CZG A;  3K2J A;  3S6W A;  4QB3 A;  1XOV A;  5CQX A;  1WQW A;  5I89 A;  3O37 A;  3X24 B;  3F70 A;  5DFD A;  5L8R E;  2DIQ A;  2Y4X A;  5C0M A;  2CZ6 B;  3U5O A;  4C5H A;  3FEO A;  5EIS A;  1ZBX A;  2DKG A;  1YI2 T;  3BFM A;  3NXB A;  4X9C A;  1QP2 A;  4NRA A;  3U5N A;  2OTL T;  2CZ1 B;  5ENE A;  3JVK A;  4BE2 A;  4HXN A;  5DFB A;  4BD3 A;  5LJ3 e;  4M7D A;  3O33 A;  4YYD A;  3GLX A;  2K5L A;  3HKS A;  4JUV A;  1VQ8 A;  5F2P A;  3EFR A;  5CKE A;  5JI8 A;  4HBY A;  5F36 A;  1R8O B;  4O70 A;  3SDZ A;  4O74 A;  1VQL T;  3PNW C;  4TTE A;  5CQY A;  2DTI A;  3LQH A;  5A5Q A;  5LUU A;  2HQE A;  2LC4 A;  4KBM B;  3V8J A;  2RI5 A;  3ONI A;  5E9M A;  4M75 F;  2P0P A;  4HT8 A;  3OYC A;  4O71 A;  5GAN 8;  4QY4 A;  3HRT A;  4CI0 C;  4II1 A;  4O7E A;  3VYH B;  1JBM A;  2VXF A;  5HY6 A;  4IUV A;  3SFM A;  4HA8 A;  5GAO r;  2BUD A;  3EAE A;  1M5Q 1;  1KG1 A;  3WXM B;  5EGU A;  4N0A A;  3DLL A;  5GMK m;  2LT1 A;  4PS5 A;  4LDX A;  2KDS A;  2LT4 A;  4QSS A;  5GAO q;  4OP0 A;  2HD0 A;  4XU2 A;  4QSX A;  2DXC A;  3G6E T;  5D3N A;  4M78 D;  3UW9 A;  5I7Y A;  1YIJ T;  2CGH A;  5ENJ A;  5EWC A;  5AYF A;  4C8Q F;  5DX4 A;  5HRW A;  4O77 A;  5ETB A;  3S3O A;  4XTX A;  1M1G A;  1K8A U;  2EFI A;  4M78 B;  3MEA A;  1YHQ T;  2YHT A;  4M7D B;  5TCM A;  2FB7 A;  4YK0 A;  3JRZ A;  5BT3 A;  4XTY A;  5L96 A;  3X26 B;  2ZPG B;  1PSF A;  4NL2 A;  4QQ6 A;  3L1A A;  3FLG A;  1X75 C;  5EWH A;  4LZ2 A;  1VIE A;  1VQ8 T;  3MCA B;  3C94 A;  3V8K A;  5GAO l;  4FT2 A;  4IOR A;  2R0Y A;  3ER0 A;  2R5M A;  3HP9 A;  5AME A;  1M1F A;  2K3Y A;  4Q0N A;  2OAU A;  3GOX A;  1N27 A;  3S3M A;  5CUC A;  3M57 A;  5EWD A;  3OY9 A;  4FU6 A;  5GAN 2;  4Z6H A;  3M53 A;  4N4G A;  4JRQ A;  4R56 A;  3A8H B;  1K8A C;  5LVQ A;  2E5Q A;  5D25 A;  1BI3 A;  2ZPH B;  3A8M B;  3X25 B;  3OYN A;  3AHU A;  1YJW A;  2RD1 A;  4N4F A;  3DLM A;  3CCR A;  2YQD A;  4QSV A;  3CME A;  5L98 A;  4LDF A;  5DKC A;  3QDR B;  4LR6 A;  1O9S A;  3PMI A;  3UVD A;  5LJ3 f;  4OUF A;  1OYX A;  4E7H A;  3INZ A;  5A83 A;  5LL6 S;  3RMS A;  3M59 A;  5IN1 A;  3H8Z A;  4RVR A;  3PGG A;  5HEL A;  2X4J A;  5CU8 A;  2RO1 A;  4QVC A;  5FFW A;  4O72 A;  5KTU A;  2RI2 A;  3P1F A;  3CCS A;  5FRO A;  1G3Y A;  2F5K A;  5DYU A;  2K4Y A;  3JVJ A;  4YH3 A;  5J3B A;  3P1C A;  5DW1 A;  4YYI A;  2O4X B;  5E9L A;  1Y7X A;  2I7K A;  4OB2 B;  5HCL A;  4XQ3 A;  4O75 A;  3J7A F;  2F5T X;  2YLC A;  4C8Q C;  5GAN 6;  1BYM A;  2XID A;  4C8Q G;  3OYI A;  3CCL A;  2OUO A;  2RHY A;  5LKU A;  3JB9 F;  2KMT A;  2X4W A;  4XTV A;  4J83 A;  5H1U A;  2X4Y A;  5D3H A;  3E9F A;  4N3W A;  2R57 A;  1ZHI A;  1QVG A;  4ZGD B;  5DM7 R;  4XU0 A;  4PLI A;  4CRI A;  2G3R A;  3RKY A;  3OYM A;  3GG3 A;  5CO7 A;  3JAM E;  2DXU A;  4LRG A;  2P0Q A;  4LDV A;  4UYF A;  3TEE A;  4UYD A;  5LJ3 h;  2CYZ B;  3S92 A;  4A4G A;  3CCV T;  4OB1 B;  1UGP B;  1S72 A;  1OZ2 A;  1W4S A;  4QST A;  2EYQ A;  5KE2 A;  4TS8 A;  5HLS A;  5J39 A;  1BI2 A;  2PUO B;  1LJO A;  2K5I A;  2EJ9 A;  3P8H A;  4BAC A;  2IVW A;  4BUG A;  3OYE A;  5EV9 A;  1H3Z A;  5A5O A;  5GMK h;  2DPP B;  1YJW T;  4IUR A;  3MP1 A;  3CCR T;  2QQR A;  5D3P A;  3CME T;  1YJ9 T;  2GFU A;  3JB9 I;  5G4S A;  5F61 A;  4XTZ A;  4YBM A;  5ENF A;  4JRP A;  1UGQ B;  4EMK C;  5GMK l;  3OYB A;  1VQ6 A;  5BT5 A;  3NFC A;  3QII A;  3HSB A;  5DYA A;  2E6Z A;  5H1T A;  3OS1 A;  4UYE A;  5GAM j;  4UIW A;  5F5Z A;  1O75 A;  3JCM c;  3SWN C;  1WJQ A;  4A9O A;  4PJO F;  2LSP B;  2E6N A;  4F3I A;  2GCX A;  3CCS T;  5D3L A;  5GMK i;  2QQB A;  1WJR A;  5KCO A;  2RH2 A;  4GY5 A;  4M75 D;  3CBM A;  3MUL A;  3OYK A;  3JVM A;  2XU8 A;  1KQS S;  3HFN A;  3UVY A;  4J6Y A;  4BI4 A;  2I8N A;  3LWI A;  4PKL A;  3UT1 A;  2E7N A;  1KHI A;  5HQ5 A;  2MJV B;  5DW2 A;  4HBW A;  4AKN A;  5CKD A;  5CQA A;  3OYJ A;  3JVL A;  4IKF A;  5DYX A;  5CTL A;  2QQS A;  2ZPF B;  3CC4 A;  4M7A F;  4HXL A;  2MWO A;  5I7X A;  3CCL T;  3E9G A;  4ZC9 A;  4HCB A;  5ENC A;  5COI A;  2VV5 A;  2DXT A;  2PUK B;  4NXJ A;  2EAY A;  3NTK A;  1BKB A;  5I83 A;  1X6O A;  3QJ6 A;  2E10 A;  5C7N A;  4UYF B;  2XDD A;  3BW1 A;  5IGN A;  2GQV A;  4D6W A;  4MZT A;  5FG4 A;  4IUU A;  3LH0 A;  4EMK A;  5KH6 A;  4YAX A;  3LX7 A;  3KUF A;  1OI1 A;  4A9H A;  4C8Q D;  1IZ6 A;  4O7C A;  5CQ6 A;  1S72 T;  1QVP A;  5C4Q A;  5GAO m;  5LJ5 f;  3SWN A;  4XUB A;  3LQJ A;  4XK8 E;  5E74 A;  4MMK A;  2L89 A;  3JCM P;  5CP5 A;  4QNS A;  3CCQ A;  5I88 A;  5HFR A;  4CUR A;  2VGN A;  3SB2 A;  4HBV A;  4LD9 K;  5E7D A;  4Z02 A;  5FFY A;  4OGC A;  2XIC A;  2QI2 A;  3JB9 H;  4IUT A;  2E70 A;  1G3T A;  4N4I A;  2DZ9 A;  5CIU A;  1VQ6 T;  2GRC A;  5GAN 3;  2H60 A;  2OSS A;  4EMG A;  3HFO A;  4QW2 A;  4QVD A;  2FVU A;  4MR4 A;  2F6J A;  3MUK A;  1K73 U;  1UB4 A;  3HRS A;  2QEX A;  3KXT A;  3P5O A;  3GNF B;  2QXF A;  5E3G A;  5FH7 A;  4O76 A;  1RI0 A;  4ATO A;  4IOO A;  4YYH A;  3O35 A;  4E47 A;  1HXD A;  2OTJ A;  3OYF A;  1VQK A;  4LDW A;  1I81 A;  1LOJ A;  4JS4 A;  5CQT A;  4PJO C;  4PJO G;  1XQH A;  3NTH A;  5CQ5 A;  4M77 F;  5E9Y A;  4TU6 A;  5EPB A;  4WIV A;  5LJ5 h;  3X28 B;  1Q7Y U;  2DTH A;  3CC4 T;  4OVA A;  3CC2 A;  4FIB A;  4BE1 A;  4PTB A;  2XD0 A;  2D9T A;  2RI7 A;  2XHC A;  2YYN A;  4FM4 B;  4NRB A;  4EMK B;  1K73 C;  3A5Z B;  3SVF A;  4XTU A;  2JZ2 A;  5LJ5 g;  4PCE A;  2DJZ A;  4M78 A;  3JCM X;  1M1K U;  3RKW A;  4PL6 A;  3M56 A;  5D6W A;  4UIX A;  2VUB A;  2RHU A;  5EM3 A;  3SWN B;  5II1 A;  5FE5 A;  4Y91 A;  3QPH A;  5EQ1 A;  3RCW A;  3SVH A;  5I29 A;  1W2B S;  1JB0 E;  3S3N A;  3AQA A;  1G5V A;  2RJD A;  2RFJ A;  5DBM A;  2LTO A;  5CUD A;  4Z93 A;  1Q7Y C;  4BW2 A;  5DLO A;  4CUS A;  4QUU A;  4NUD A;  2AHJ B;  3GPL A;  3Q1J A;  3JB9 D;  4L6V 5;  2QQ9 A;  3OS5 A;  4YY6 A;  2VC8 A;  4IR6 A;  1K9M U;  4QC3 A;  5A81 A;  3QXE B;  3CXC S;  4OF1 A;  5GAO p;  2NXB A;  1M1K C;  1U8R A;  2QDY B;  5GAM e;  5HRV A;  4O78 A;  4TVR A;  3CCE A;  5EI4 A;  3M4Y A;  3OYY A;  3JCM f;  5F1L A;  5HJC A;  5K29 A;  4X9D A;  2E1H A;  2QEX T;  2D82 A;  4NRC A;  4QR4 A;  4NR8 A;  5FB1 A;  3RES A;  3MHX A;  1K9M C;  1N8R U;  4ZGE B;  2OTJ T;  4DON A;  5CUA A;  5HQ7 A;  1VQK T;  4NYX A;  2DO3 A;  2DAQ A;  4ZTJ A;  5ACY A;  2LVM A;  4ZW1 A;  3M54 A;  4X2I A;  3OBW A;  2RNX A;  4IR3 A;  5DLQ E;  2WSE E;  2L85 A;  5EK9 A;  5KTX A;  4BY6 C;  4MEN A;  2PU9 B;  4XTW A;  2O4X A;  4M77 C;  3PT9 A;  2RHX A;  4M77 G;  4C92 F;  4J0S A;  2K2V A;  4C0F A;  5A0L A;  4EPC A;  3RUX A;  3RMQ A;  5D6Y A;  1YBY A;  5GAN f;  5L99 A;  4PJO D;  2DEQ A;  2Y90 A;  1HK9 A;  5HEM A;  1VQN A;  1Y07 A;  1N8R C;  4E96 A;  3DB3 A;  3Q2E A;  1U1S A;  4NR6 A;  2A7Y A;  4XU1 A;  2QQA A;  5EWW A;  2E64 A;  3FRN A;  1BI0 A;  5LKT A;  2V8I A;  4YAB A;  2EQM A;  3J81 E;  3JCM h;  5A2Q E;  4YC9 A;  3C95 A;  4F7U F;  1WQ7 A;  5IT9 E;  4LC2 A;  1G3W A;  3G71 A;  4MEO A;  3UVX A;  5F62 A;  4M7A D;  4EMH A;  5HM0 A;  4ALG A;  2JN0 A;  2DVV A;  3OW2 S;  5E9V A;  1N6A A;  3N5B B;  5GAN 7;  3MP6 A;  2KTB B;  1JSP B;  5CQ7 A;  5C85 A;  5DY9 A;  3MQM A;  3JCM g;  5ENB A;  3DKM A;  5EPS A;  5CUE A;  3OA6 A;  3VU3 C;  2O01 E;  5CKB A;  2I2L A;  4OGJ A;  4M75 C;  4M75 G;  3GIB A;  2JTM A;  3U5P A;  3CEY A;  3CCE T;  4HXM A;  4M75 E;  5D3J A;  4LDU A;  4QEV A;  3CD6 A;  2QTX A;  5HRX A;  1Y71 A;  4QR3 A;  2WP2 A;  2G4A A;  1I8F A;  2ZCF B;  2CS7 A;  5LJ5 d;  5GAN h;  4A9I A;  4C5E A;  3URG A;  3VUB A;  3BY7 A;  4A9N A;  4IR4 A;  4A4E A;  5FG5 A;  4QYL A;  3UPU A;  2FSA A;  3I56 A;  4TZ8 A;  4CUU A;  4J8O A;  3VKI A;  5GAN g;  4YYG A;  5EG2 A;  4MR3 A;  3QZ5 B;  2DD4 A;  4PNO A;  2LX9 A;  3L2R A;  3P8D A;  1NJI U;  4UYH A;  5E0R A;  5FB0 A;  4YYN A;  2FYK A;  5GAM f;  2A3L A;  4DA4 A;  2IG0 A;  4CUT A;  4XUA A;  5CQ4 A;  3GNG A;  2RJF A;  5ENI A;  4C8Q E;  4ZN1 A;  4NR5 A;  4TQN A;  1X0J A;  5A5P A;  1QP3 A;  4GPJ A;  1I4K 1;  4MZM A;  2DXB A;  4QVZ A;  5FH8 A;  1VQN T;  1YIT A;  4FLP A;  4M75 A;  5HQ6 A;  4TU4 A;  4BI3 A;  4RMO A;  2PVD B;  2RK1 A;  3LGL A;  2K3X A;  4J5Y A;  5HFQ A;  2L84 A;  4JDS A;  2RHZ A;  4M77 D;  3V7C A;  4TT4 A;  1OZ3 A;  5CVI A;  1NJI C;  4QSU A;  5F63 A;  3G71 T;  2WSC E;  5HEN A;  3FB9 A;  4KV1 A;  5JWM A;  4NYV A;  5CAI A;  5CGP A;  5LJ3 g;  3CCM A;  4Z1S A;  5E73 A;  4YBS A;  4F7U G;  2LCC A;  2RNW A;  5CK9 A;  5L8T A;  4BY6 B;  4MML A;  1W2B A;  4F7U E;  1VQ5 A;  4M77 B;  5H1V A;  5D3R A;  3JCM b;  4HT9 A;  1F68 A;  5CUB A;  5FE6 A;  4BJX A;  4M7D F;  4C8Q A;  5GAM h;  3CD6 T;  4VUB A;  3JB9 J;  3VV0 A;  1YCY A;  5GAO n;  2E12 A;  2ZGW A;  1WUM A;  3QZT A;  5H85 A;  2RO0 A;  3CXC A;  5A5N A;  5FE4 A;  1NPP A;  1YJN A;  2L8D A;  2DZC A;  1V29 B;  1VIF A;  2EQU A;  3PFS A;  4KUL A;  4BHW A;  2DWW A;  5KCH A;  1ZQ1 A;  4J0R A;  3T9N A;  5EIC A;  5D7X A;  2FL7 A;  2M1H A;  2R0V A;  3G0J A;  5FRN A;  4HXP A;  4J7F A;  4O7F A;  4WHU A;  4FT4 A;  3ZEH A;  4MDX A;  3JCM V;  1AHJ B;  1KD1 U;  5FE3 A;  4P5N A;  2CZ7 B;  4NS5 A;  1N9S A;  3O36 A;  4A9F A;  3QJY A;  4RCB A;  5A85 A;  4JJN K;  3AAD A;  5CKF A;  2HQX A;  4M75 B;  1WJS A;  4NR7 A;  3JCM d;  1FX7 A;  1NE8 A;  2ZPE B;  4DQ2 A;  4OGE A;  4MR5 A;  4HKE A;  1TH7 A;  3MB3 A;  3ZYU A;  4YYK A;  3QBY A;  3J80 E;  3JB9 G;  1YIT T;  1VQP A;  3JCM W;  4A4F A;  3I55 A;  3SVG A;  4IOQ A;  3G4S A;  1U1T A;  3L42 A;  3L2U A;  3HL8 A;  2RI3 A;  2H3J A;  2RJE A;  3NTI A;  1BIB A;  2KSS A;  4CL9 A;  4R55 A;  4RG2 A;  3UVW A;  3HME A;  4QZS A;  5FE1 A;  1M9S A;  3CCU A;  5I21 A;  3M55 A;  4IR5 A;  2DVS A;  1MHN A;  1KD1 C;  4QQD A;  3UV4 A;  5FU7 C;  4OMF B;  3MXF A;  2XKO C;  4L59 A;  4O5V A;  4C92 D;  1Q82 U;  2MMP A;  5F1H A;  1VQL A;  4BB7 A;  4C8Q B;  1VQ5 T;  4IUQ A;  3PTA A;  3LW5 E;  5GAN d;  4JRK A;  4BW1 A;  1KHC A;  5C6S A;  3JSC A;  2EWN A;  2L5E A;  3QO3 A;  4UIV A;  4A4K A;  2JUF A;  5CY9 A;  4HXO A;  2PQW A;  5GAN 4;  2R10 A;  5CQ8 A;  5FDZ A;  4GLK A;  2EIF A;  4TT2 A;  2ZPI B;  3TRE A;  4ZGJ B;  3OS0 A;  3OW2 A;  1KC8 U;  2OO1 A;  5FE8 A;  4EDU A;  3CPF A;  4ZTF A;  3V8L A;  4C0G A;  1YJN T;  3WVD B;  5DY7 A;  3UDC A;  2HBP A;  5CRM A;  5ETD A;  3RIR A;  2DK3 A;  2RK2 A;  1Q82 C;  3FDR A;  2LCL A;  5I2S A;  4JLG A;  5AD2 A;  3HMF A;  1VQ7 A;  2DAT A;  2L3R A;  3U5K A;  3H6Z A;  2HNI A;  3M58 A;  2VYT A;  1N9R A;  2V8J A;  5E3D A;  4XY9 A;  1BI1 A;  2KVQ G;  4F7U B;  1PSE A;  4PJO E;  4QSW A;  3TCJ A;  5A5R A;  2V8K A;  5F25 A;  5I1Q A;  1KQ1 A;  3LYI A;  3E1S A;  1GXI E;  3E19 A;  4XAX B;  1KC8 C;  1SSF A;  5LJ3 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...