4N4GA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
209
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 63
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4gA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4gA02
5E7DA 4N4HA 4LDFA 5EI4A 5KO4A 5EWHA 4E96A 5AD3A 3DLMA 5CTLA 2OSSA 3SVFA 5ENBA 2M0OA 5DFCA 5ETDA 2M1HA 2NLUA 5D6XA 4UYGA 5F61A 4II1A 4NR8A 4NUDA 5CQ3A 2GFUA 3RCWA 3FKMX 2EQKA 3P8DA 4ZQLA 4O72A 3MXFA 5EWCA 5ENIA 2FHDA 2RO1A 5A85A 2LSPB 4C67A 4LZSA 5EGUA 2JTFA 3OYCA 5CUAA 3OYKA 2YEKA 3O36A 5D25A 3MUKA 4YYMA 2HQEA 4BD3A 5CFWA 4YH4A 2X4YA 5IAYA 2M16A 4WHUA 4CUQA 4CRIA 5H1TA 4UIZA 5FH6A 4YATA 4Z93A 3P1EA 3JVKA 4B9XA 2YYNA 4N3WA 4Q0NA 5D3TA 3HMFA 4OGJA 4A4FA 4WHWA 4PKLA 5A7CA 3QZSA 4BW4A 5FFWA 4BW2A 3OA6A 3MULA 5D3RA 4YYJA 5ETBA 4ZW1A 5H1VA 3UV4A 4LYIA 5CIUA 1RI0A 2MJVB 4J3IA 2F6JA 5FE7A 2EKOA 3UT1A 5II2A 3O8VA 4LRGA 4Z6HA 3U5NA 5I29A 2K3YA 3OYHA 2RHIA 4UIYA 4QR3A 4WIVA 5DLXA 4C66A 5IGMA 5FB1A 2DIGA 5A5PA 3OYGA 5D3HA 5LKZA 5G4RA 3SVGA 2R0YA 3L2QA 3K2JA 2RNWA 5FRMA 2JZ2A 4IORA 5ENGA 4Q0OA 3L2RA 5I7YA 4PCEA 5HCLA 4BDZA 4BJXA 4BDYA 4QYDA 4IUTA 3LH0A 1JM4B 4BW3A 3P1CA 1EQFA 4MR5A 4PS5A 4CFLA 2QQRA 3FDRA 4N4IA 4O7CA 3PMTA 4IR5A 5KU3A 2RJDA 5I89A 4TT6A 5EPSA 1OZ2A 2E3KA 2L84A 3HMHA 4J0SA 2GFAA 3P5OA 3UVWA 2F5KA 5KE2A 4MR3A 4NR9A 2YELA 4GPJA 3META 4AKNA 2DAQA 2RNYA 4QC3A 2MWPA 3MB3A 5IIDA 4A9HA 4IR3A 5EA1A 5EP7A 1WGSA 3UVYA 2YDWA 5F36A 3S3MA 3MP1A 5E9VA 4NQMA 4O76A 3OQ5A 5L98A 2R58A 5I86A 3AADA 3UV2A 1OYXA 5E9LA 4MEPA 5D26A 2XK0A 5KHMA 1KHCA 4TYLA 5HQ5A 3L2UA 4E7IA 3QZTA 2RNXA 3OS1A 5LJ1A 4QSUA 5DBMA 3UW9A 3BDLA 5FRNA 4O70A 2RJFA 2WACA 3P8HA 5DFBA 5LKXA 2E5QA 4PY6A 2RHYA 4HXMA 5D3NA 5D24A 5DYAA 5LJ2A 5C8GA 5CQ5A 4DONA 5C0MA 1G5VA 5CUGA 2G4AA 3S91A 4QSWA 3U5LA 3LQHA 4HBYA 4YY6A 3U5KA 4HXSA 4UYEA 5DKHA 2BIVA 4X2IA 5LVRA 4ZTFA 3SVHA 5CRZA 3EAEA 4KCXA 5FH8A 5TCMA 3O33A 5D3JA 5IGLA 4NQNA 5DYCA 3MP8A 4YBTA 5E9YA 5J26A 5H1UA 3OYDA 5LUUA 3ZEHA 5CQ8A 5FFYA 2HQXA 2I8NA 2LVMA 4TTEA 5ENEA 4PTBA 4FLPA 5CGPA 4TT2A 4LC2A 5FBXA 2LDMA 2XDPA 4NR6A 5A81A 5KCOA 3LJWA 5L97A 5KTWA 4CURA 4RVRA 3ASKA 3GOXA 4BE2A 5FG6A 1F68A 5KCHA 3OYMA 3I3JA 5EWVA 3OY9A 4QEWA 2P0KA 2FSAA 4NYWA 4HXPA 3MEVA 3NTIA 2B8AA 3LQIA 5E9KA 3E9FA 4IUPA 5FB0A 5DFDA 4FL6A 4HXRA 5TB6A 5CZGA 1WJRA 4PLLA 5EPRA 4OGIA 5HRXA 5FDZA 2R57A 5BT4A 2EQMA 3F70A 3L2WA 2DVRA 5BT5A 4QVZA 4QSSA 4UIXA 5DX4A 5FE0A 4YYHA 4E7KA 4A9EA 4UYFA 3LYIA 5JWMA 3H8ZA 2R0VA 3SD4A 4XYAA 5IN1A 4TZ8A 4NRBA 1N27A 3ME9A 4UYDA 5A5QA 5HRWA 5E9IA 4BACA 3L42A 4QUTA 4YK0A 1OZ3A 4YYDA 4Z02A 3P1FA 4IUVA 5KTXA 5HM0A 5ENFA 5FROA 2L5EA 5E3DA 4QR4A 4TZ2A 5I83A 2DATA 4CLBA 4QW2A 2QQSA 5E3GA 4NR5A 3JVJA 2GF7A 2NXBA 4IR6A 5L96A 5FE9A 5CS8A 4BE1A 5JI8A 3NXBA 4LR6A 5CPEA 5C85A 4O7BA 2E6NA 5EWWA 4O75A 5AD2A 4J0RA 3Q2FA 3DAIA 4OUFA 5ENCA 3P1DA 4QQGA 4QB3A 2RI3A 1WJSA 3IU6A 2IG0A 3H6ZA 4QNSA 5LVQA 4HXKA 4UIWA 2R5AA 2RI2A 3QKJA 1WJQA 4YYNA 3O37A 4QY4A 4QYLA 2RHXA 4CL9A 4NYXA 1WUGA 3S6WA 4IUUA 4O78A 4E7LA 3DB3A 3ZYUA 3U5JA 5CQTA 4KV4A 2RHZA 2D9EA 4UYFB 5CRMA 4F3IA 5AMEA 4C5EA 5I80A 5F62A 5IGNA 5KH6A 5CQAA 5EK9A 4NR7A 5F60A 2L89A 3FLGA 5C6SA 5HELA 5FE6A 4IOQA 3O34A 5FE4A 4XUBA 4O77A 5FE2A 4TQNA 3JVMA 5EWDA 5I40A 4UIUA 3UVDA 2WP1A 5I88A 3PNWC 5HFQA 3Q2EA 1WUMA 4XY8A 5HEMA 3MEUA 5EQ1A 4X34A 5F5ZA 4PCIA 4A9IA 5E73A 5A5NA 4TU4A 5D0CA 4C5HA 2LTOA 4HXNA 5HQ6A 4Q5WA 3OS0A 4E7JA 4YBSA 2R0SA 3U5OA 2O4XB 4NUEA 5EVAA 5CP5A 2GRCA 1ZS5A 4NUCA 4Z6IA 2DVVA 4O7FA 4BW1A 5DY7A 4TS8A 4OVAA 4QSPA 2DKWA 2YEMA 1H3ZA 4CFKA 4IKFA 5ENHA 4QQDA 4YH3A 5HLSA 4RG2A 4YY4A 2G3RA 2WP2A 5A82A 5CQ7A 4A9NA 4UITA 5D6WA 1N72A 3JVLA 4LZ2A 4QSQA 4MEOA 3U5PA 3OS2A 5C7NA 2LRQA 2D9TA 4UC4A 5LKUA 3S92A 4YC9A 4NYVA 4IURA 2D82A 4CUTA 2X4WA 5C89A 2DVSA 2RS9B 3OB9A 5E74A 1E6IA 3TLPA 5M9OA 3MQMA 4MENA 3S3NA 3QIIA 4E7HA 3NTKA 4BE0A 3OYFA 4QSXA 4CUUA 3E9GA 2EQJA 4IUQA 3LGLA 3PMIA 5CUDA 5HENA 4QZSA 4L59A 3G0JA 5ENJA 3OMCA 4HBXA 4A9MA 1MHNA 4YBMA 3Q1JA 5E9MA 5DYXA 4QEUA 4MEQA 3D7CA 4BHWA 3LXJA 5I1QA 4HBVA 4QQ6A 4XUAA 3IU5A 5F2PA 5A5OA 2I7KA 4TU6A 2H60A 3ONIA 5BT3A 4NRCA 3OYEA 4HXOA 4Y03A 5EPBA 3AQAA 4A9FA 5FH7A 4ZC9A 4QUUA 4A9LA 4YABA 3S3OA 4Z1SA 3QZVA 2DVQA 4PLIA 4HXLA 5L8UA 2X4XA 3OYJA 2R10A 2E7NA 5FE8A 3PFSA 4C5GA 2OO1A 4PL6A 5DW2A 5A83A 4B9WA 5C4QA 5D7XA 1JSPB 5HRVA 4A9JA 5FE3A 4LYWA 3QBYA 3DB4A 5CQ6A 3NTHA 4QSVA 2EQUA 1SSFA 3OYAA 5KTUA 5IGKA 4YADA 5G4SA 3GG3A 5HFRA 4ALHA 4IOOA 4C5IA 4ZTJA 5II1A 5F25A 2DIQA 5D3PA 2BKDN 4NXJA 4GY5A 4LD6A 5I7XA 4HBWA 4A9KA 4ALGA 5DLZA 5J39A 4Z1QA 2YRVA 3DWYA 5ACYA 3OYNA 5D3LA 2PQWA 2RI5A 3M9QA 1XNIA 2K3XA 5CU8A 2O4XA 3QJ6A 2L3RA 5LJ0A 4A4HA 4NR4A 5FE5A 5HQ7A 4A9OA 3U5MA 5K29A 2RHUA 3HMEA 4UYHA 4YYKA 4QR5A 5CQ4A 4O7AA 3MEWA 2LCCA 5EM3A 3MB4A 4IR4A 5CUEA 3MO8A 3OMGA 3LGFA 5EICA 5EISA 3KUFA 5F1LA 2N9GA 4J1PA 2L8DA 3C4SA 3O35A 3OYLA 3UV5A 4N4FA 4A4GA 4NRAA 5CY9A 5L8TA 5CUBA 4A4EA 4LYSA 5DKCA 5D3SA 1OI1A 3OYIA 4HCZA 5DKDA 4XY9A 2RJCA 5F1HA 5EU1A 4YAXA 3OYBA 2EFIA 4QSRA 4O74A 2VYTA 4QEVA 4QC1A 2RFJA 2CKKA 5IBNA 5DW1A 5FG4A 5FG5A 5IG6A 5C87A 3G0LA 2RJEA 5J0DA 2R5MA 4UIVA 4N4GA 3MEAA 5FE1A 5F3AA 3FC3A 5COIA 5H85A 3LLRA 4TT4A 3LQJA 2F6NA 4O71A 2X35A 4YYIA 5CUCA 2L85A 3UVXA 4MR6A 4CUPA 2YQDA 5LKTA 4KV1A 3FEOA 4FU6A 2E7OA 3MP6A 2YW5A 4O7EA 5A5RA 3LX7A 2DWWA 3L2VA 2BUDA 2MWOA 4MR4A 3UWNA 2RO0A 4YYGA 5L99A 5KE3A 5EV9A 4LZRA 5F63A 2OUOA 5D6YA 5E0RA 2KTBB 2RI7A 4NS5A 1X0JA 4EDUA 5A5SA 4QBMA 5DYUA 5FFVA 4CUSA 4QSTA 5HJCA 5AMFA 3CEYA
chains in the Genus database with same CATH superfamily
5E7DA 5EI4A 1N9SA 4E7ZA 1QVPA 4LUDA 5AT1B 3CC4Q 4E96A 1VQ4A 1YJ9T 4LN2A 1Q81C 4HCKA 3SHWA 3A1PA 4ELZC 5D6XA 4C8QG 3CCEQ 4NR8A 1RABB 2GCXA 4XU3A 4A4KA 2DM1A 3I35A 3RCWA 2EQKA 4O72A 4M7AA 3CPWA 1R0BG 3MXFA 3RMSA 2FHDA 2LSPB 2JOYA 2I2LA 5LL6S 1OX8A 5CVIA 1PWTA 3O36A 5D25A 4J9CA 3M54A 3MUKA 1AVZC 4YH4A 2ED0A 5H1TA 4PFOA 4RG8A 3JVKA 3M4YA 1M2VB 4N3WA 3HMFA 1PRLC 4PK4A 5FFWA 1BB9A 2YRCA 3OA6A 4E7SA 3JCMX 1YJWA 3CMET 1M27C 3UA7A 5CIUA 2QQBA 1YN8A 1BCOA 2NWMA 5II2A 4LRGA 3CQTA 1V29B 5I29A 1BU1A 3QO3A 2RHIA 3CXCP 5GMKl 2VC8A 2K57A 3JCMb 1SSHA 2DXCA 3SVGA 3MKDA 1BKBA 1Y96A 4IORA 2FRWA 4M4ZA 2ZCFB 1K9MU 2ATCB 5HCLA 3CC4A 3VKHA 4BDZA 2F5TX 4BDYA 4QYDA 3LH0A 4CC3A 4AG2C 3P1CA 1EQFA 4PS5A 2QEXQ 5GAN8 2XD0A 4C92F 3CCEA 3CCRT 3JB9H 3PIPA 3CCQA 4ESRA 4Z8AA 5KYYB 2L84A 3PIOA 1WA7A 1H8KA 3PVLA 2JT4A 2GFAA 3M4GA 4LDVA 3H0HA 3CCUT 2LQKA 1I4K1 2RNYA 2LQWA 4QC3A 2DL5A 3CC7T 3CCSA 4IR3A 1AD5A 1B7TA 4F17A 3S3MA 4F7UF 1Y96B 1C1AA 3MP1A 5E9VA 1KD1C 3A8LB 4NQMA 1NPPA 5J3BA 3AADA 3UV2A 1FXXA 2QTXA 4LNPA 3CD6Q 5D26A 1KFZA 4E7IA 1MMAA 2RNXA 3UW9A 2F2VA 5FLXE 2RJFA 2KEAA 2RHYA 2E5QA 5D3NA 4JDSA 5D24A 4DONA 1R77A 2EQIA 3U5LA 4DBFA 2J6KA 4PJJA 1PSFA 3JCMV 1VQ6A 5LVRA 5CRZA 4XTWA 1A0NB 1MMNA 5DYCA 4BB7A 2HQXA 2LVMA 2I8NA 5IHKA 1TSFA 2QASA 1QVGP 4HCBA 4JZ3A 4TT2A 1KQSA 2FPEA 2QQ9A 2CT3A 4NR6A 1ZHIA 5GAMf 2QEXA 5L97A 4BE2A 2E3HA 4EMKB 3GLXA 3OYMA 3CMAA 2RQVA 1TOVA 3KFVA 1WNLA 4KUDK 1VIFA 4QEWA 1X6OA 2EAYA 2EYXA 2P0KA 2VUBA 2AKLA 3NTIA 2ZPFB 5E9KA 3E9FA 1I1JA 1QCNA 1D3BA 4JLGA 5FB0A 1NBEB 4FL6A 1WIEA 2E41A 1WJRA 4DA4A 4OMOA 2JVVA 3QWYA 1PD0A 4L6V5 4PLLA 1VQ7Q 3I55A 4OGIA 5GAOm 5FDZA 2R57A 5BT4A 3VS7A 3UDCA 2HZYA 5FE0A 4YYHA 4FW2A 1GRIA 4X9DA 3JCMg 3CCLT 4E7KA 1M90R 2JN0A 3CD6A 4XYAA 1K73C 4XK8E 1Q82R 3ME9A 5A5QA 4FW1A 4BACA 1K0XA 4YK0A 1AEYA 2M51A 2OTLQ 2FPDA 3NHNA 4IUVA 1O75A 5KTXA 2L5EA 1VIEA 1YHQQ 4QR4A 4TZ2A 2DATA 1EX4A 4CLBA 2K4YA 3G71T 3A8MB 3U23A 5E3GA 2W10A 5CS8A 4LR6A 1I5OB 5C85A 4O7BA 4MZPA 4O75A 2P0QA 2GBQA 3Q2FA 3QXEB 4OUFA 5L23A 2RI3A 1ZX6A 3H6ZA 3MHXA 4HXKA 2AZVA 1WJQA 2RA2A 4CL9A 1QKWA 4C92E 2HSEB 3ZYUA 1Y57A 1VQMT 4C0GA 4JS5A 2DJQA 5EK9A 4JRPA 4J9GA 5HELA 2OAUA 2PUOB 3TQ7P 4XUBA 2DEQA 5FE2A 2XKOC 3JVMA 5EWDA 5I40A 3UVDA 4DEYA 2WP1A 5HFQA 1VQOA 3OSSC 4LDXA 1BK2A 5I2SA 4XY8A 1PNJA 1TG0A 3MEUA 5CQYA 1SF9A 2EGEA 5F5ZA 1PCXA 4HXNA 1W2BA 2YXYA 2O4XB 2YUQA 5EVAA 1ZS5A 4Z6IA 4J9IA 4J8OA 2DVVA 4BW1A 5DY7A 4FYWB 3M0QA 2OTLA 2DKWA 2YEMA 2P0PA 4CFKA 3JCMh 5HLSA 4Z88A 2WP2A 2DTIA 2KYMA 5GAOr 2EW3A 3UPUA 1N72A 3FJ5A 3FIFA 5I11A 4MEOA 1NLPC 3CC2Q 2D82A 4CUTA 1R8OB 4QT7A 4AKHA 2X4WA 1YI2T 5C89A 2DVEA 2A7YA 1E6IA 2CP0A 3S3NA 3QIIA 5IHIA 4E7HA 1VQPQ 1OU9A 3MCAB 3QJYA 3X20B 4IUQA 4JS4A 3LGLA 2IPOB 2V1QA 3OMCA 2P4TA 2ED1A 1T3LA 1FMWA 3OW2A 3VKGA 4MEQA 4BHWA 2E3IA 2HDAA 2QDYB 2RQRA 4M77D 4OMMA 3C94A 3IU5A 2AKKA 2BTTA 5BT3A 4TU6A 3ONIA 4M77G 5KYWB 4NRCA 4HXOA 4N0AC 3AQAA 4A9FA 2KQWA 4OMNA 4ZC9A 2RK2A 4M77B 1NG2A 4EMHA 3CXCS 3HL8A 5FE8A 1RAAB 3V8LA 1WI7A 2QDLA 4PL6A 5DW2A 2C0TA 1M8MA 3VS2A 3QBYA 3DB4A 3NTHA 1Q86R 2EQUA 2JMCA 4M7AE 3OYAA 1KC8U 1VYVA 2OAWA 5G4SA 3GG3A 1G3WA 2M0YA 3EG1A 4MZMA 2VV5A 4C5IA 1GFCA 2DIQA 2LNHB 1B3QA 4GY5A 4HBWA 4ALGA 5J39A 1WXUA 4LDWA 1H92A 5D3LA 3AT1B 4Y28E 3M9QA 3QJ6A 4A9OA 5K29A 2EJNA 2LCSA 4UYHA 5CQ4A 3MEWA 1MMDA 1XJWB 4IR4A 2DX1A 1ZSGA 3MO8A 2A37A 4M75D 1VQPA 5EISA 3OYLA 2L8DA 3C4SA 4M75G 2ZZDA 3UV5A 2KVQG 4A4GA 5L8TA 2COZA 4F04B 3JB9D 4HCZA 4M75B 5A0GA 1PKTA 4YAXA 3JB9G 2HNIA 1WYXA 2JS2A 3C12A 2CKKA 2RPNA 5IBNA 2J6OA 4ME7A 3EGUA 1GXIE 3G0LA 2PTKA 2R5MA 4DEXA 1W1FA 1TUGB 2QTVA 5FE1A 3VS4A 4IIOA 4JRIA 5H85A 2FB7A 3LLRA 3LQJA 4DBQA 5FWBA 2EYQA 1D0YA 2XI9A 3EH2A 1S72T 1VQNQ 1M2OA 2L2PA 3M5AA 1PC0A 2YW5A 5A5RA 1YIJQ 2DL4A 3SB2A 4JRQA 1KG1A 4C0DC 1QVGS 4GLMA 5FWCA 2D8HA 2RF0A 5KE3A 5EV9A 5F63A 1WQ7A 2OUOA 1NLOC 2CP3A 2RI7A 3JCMc 3EFOA 2DF6A 4RTUA 4J5YA 1OULA 4N4HA 5KO4A 1X6GA 5EWHA 1KIKA 4BUGA 3JCMe 3A5ZB 5GJWB 2OSSA 2EIFA 3LW5E 5DFCA 2NLUA 2X3XD 1Q81R 2QI2A 1QVFS 1ZLMA 2NYSA 1K0SA 2E64A 1OPLA 3PTAA 5CO7A 5CQ3A 2KR3A 4D8KA 3FKMX 1M3CA 4ZQLA 4M77F 5A85A 3VUZA 5HY6A 3QZ5B 2JTFA 3OYCA 5CUAA 2YEKA 1X75C 3BFMA 4XTVA 5IAYA 2M16A 4WHUA 4CUQA 4QKUA 4XU0A 4CRIA 4YATA 3FB9A 1RACB 4Q0NA 4A4FA 3KBGA 3V8JA 4C8QC 4E47A 4PKLA 2W0ZA 2ZPBB 4BW4A 1W70A 5DLQE 2D0NA 2XDBA 4HVUA 5D3RA 5ETBA 3UV4A 2DBKA 2FPFA 4LYIA 3HSBA 2QXFA 3V7CA 1RI0A 4J3IA 2F6JA 2NUPA 1YIJA 3H41A 3M0SA 5FE7A 1QMCA 5I2MA 2LQNA 1KQ2A 1E7OA 1VYTA 3UT1A 2DYIA 3O8VA 4ZNXA 2CZ0B 2PNIA 1N8RC 4QR3A 5DLXA 3CMEQ 2L3QA 1K9MC 3DKMA 3URGA 4FYXB 4RCCA 3MPUB 4PJNA 2R0YA 3K2JA 3ZFJA 2CZ6B 2JZ2A 2DXUA 3EGXB 4F7UA 3O5ZA 1TUCA 1T0JA 4PCEA 2A3LA 4RTTA 2VGNA 4XU2A 4IUTA 4MR5A 4CFLA 1WXBA 4N4IA 4IR5A 1VA7A 4DOVA 1V1CA 5KU3A 5I89A 1TH7A 3DLLA 5EPSA 3REBB 1G2BA 3JB9F 2MI6A 1VUBA 4AG1C 4C0DB 3P5OA 5LJ3j 2EPDA 2HBPA 2YLBA 5KE2A 3META 8AT1B 4AKNA 2DNUA 2DAQA 1BIAA 1N6AA 2CYZB 4J6WA 3GIBA 1NJIU 3M57A 2F1LA 3V8KA 5F36A 2O9VA 5CQXA 1U3OA 3CCUQ 2PU9B 4C8QA 2O88A 5L98A 2V8KA 1P92A 1KD1R 1E6HA 5GAN6 2XK0A 4TYLA 3L2UA 4GLKA 3RDVA 3CC7Q 4MDXA 1WZOA 2QG9B 5FRNA 4O70A 2FL7A 2O2OA 1U06A 5CR2A 2LT4A 4PJOC 5AYFA 5DYAA 5LJ2A 3CBOA 5C0MA 1G5VA 2G4AA 4MDWA 3S91A 5GJVB 2NUTB 4HBYA 1M2VA 3RESA 3CMEA 2BIVA 2OTJA 4X2IA 1BCMA 1BI3A 1VOMA 4ZTFA 3EAEA 2RQUA 3RKWA 4KCXA 5FH8A 1XOVA 4M7DC 1GCQC 3TCJA 4C8QD 3JCMf 2AIRB 3ER0A 5E9YA 2ZPHB 4BI4A 5J26A 2YLCA 2DO3A 3OYDA 3ZEHA 1ARKA 1YJNT 4TTEA 2BZXA 4CC4B 4FLPA 4OMPA 5LJ5j 4C8QB 1N5ZA 2MF2A 2YUPA 5KCOA 3LJWA 2EGAA 4RVRA 1F68A 5KCHA 4EMGA 5GAN3 3I3JA 5EWVA 1YWPA 2VWFA 3LWHA 4ATOA 4HXPA 1YCYA 1K1ZA 2B8AA 3LQIA 1ZUYA 5DFDA 4L5GA 5GMKh 3INZA 4HA8A 1MUZA 3J7AF 2DMOA 2KAFA 3EGDB 5KYXA 1ZUKA 2KRNA 1IREB 4UIXA 3HRTA 5D7UA 4A9EA 4EMKC 5KYYA 3H8ZA 1M1GA 4NRBA 1N27A 4UYDA 1QP3A 1K73R 3L42A 3TVTA 3P1FA 1FMKA 3CCLQ 2MMPA 5ENFA 4PJOA 4KGZB 4QW2A 3VS3A 3EG2A 1IXDA 4IR6A 1RADB 1N8RU 4JJCA 4HT9A 4HCCA 1IGUA 1RAIB 1ZA1B 1FYNA 4M7DA 1GCQA 1LPLA 2K7AA 1VQ4T 4CC2A 1WJSA 3IU6A 1YP5A 5LJ3h 3G71Q 3EG9B 5KYXB 2RQWA 4YYNA 4QY4A 4QYLA 2RHXA 1OEBA 5A0LA 4O78A 1UGQB 4PFPA 2KRMA 4E7LA 5CQTA 3BY7A 3C95A 4KV4A 4PJOD 2QK0A 5IGNA 4PJOG 1NM7A 2LP5A 4NR7A 5F60A 3RNJA 3T9NA 5FE6A 2A08A 3O34A 1F1BB 5FE4A 2XICA 4D6WA 1VQMQ 2G6FX 1ZBJA 2DEUA 2E10A 4PJOB 3EFSA 1Y0MA 4TQNA 3M0TA 4M7DD 1K76A 3E2UA 1NE8A 4M7DG 5GANh 2XHCA 4X34A 3NMZC 5L8RE 4X1VA 4EMKA 1M9SA 4M7DB 5E73A 5A5NA 1YJWT 2FYKA 3OS0A 4E7JA 4YBSA 1PG5B 2KT8A 5CP5A 4J6XA 2K6DA 4J9FA 3CXCA 3X25B 4MMLA 4TS8A 5HK0A 3CCLA 1H3ZA 1WX6A 5LJ5h 1NYGA 1O9SA 2X9HA 2CDTA 1YBYA 2CGHA 5CQ7A 1JB0E 2GQVA 3HFOA 1TWBA 3U5PA 3QDRB 3CC4T 5LKUA 3S92A 4YC9A 4C8QF 3D1BA 2L0AA 3G71A 2V1RA 2K2VA 3HRUA 3CCET 2COWA 5E74A 4KBMB 3MQMA 3CCQT 4BE0A 2QQAA 1XQHA 2RK1A 3OYFA 4CUUA 5IXBA 1ABOA 3VS6A 2KY9A 5CUDA 4FSXA 1WDXA 2EYYA 5DM7R 1YI2Q 5CKHA 5GAOl 3RIRA 4FYVB 1MHNA 3Q1JA 5I1QA 3LXJA 1WHLA 1JRIA 4QQ6A 3CCST 1QW1A 1M30A 3OYEA 1QVFP 4NOYA 5EPBA 1ZQ1A 2Y90A 1HD3A 3VS0A 4JRKA 1UGVA 4JJBA 3QZVA 4PLIA 1BIBA 2R10A 3PFSA 1M1KU 1KC8C 5C4QA 5D7XA 1JJ2P 3I5RA 4A9JA 3ZBDA 2DERA 2CS7A 5CQ6A 3V7SA 5KTUA 2FZCB 5IGKA 3EHRA 4YADA 1EZZB 3D1DA 4ALHA 2XMFA 4OF1A 4ZTJA 2BE7D 5II1A 1VQ6T 5D3PA 4HVWA 1VQ9T 4FT4A 4M77C 4A9KA 3N5BB 3R6NA 4AFUC 3DWYA 3OYNA 2F69A 1BI0A 5CU8A 2O4XA 2L3RA 2C0OA 4NR4A 2ECZA 1QVGA 5HQ7A 4YYKA 1WHGA 3GNFB 2A36A 4QR5A 2FRYA 2QEXT 3MB4A 1IO6A 2KBTA 1K4US 3CMAT 1SG5A 3LGFA 4C0ZA 1K8AC 5GAN2 3KUFA 3IQLA 1SHGA 2D8JA 5FU7C 4PJOF 4A4EA 2KSSA 4KT0E 2ROLA 2DKGA 5D3SA 4HXJA 5DKDA 3UATA 4XY9A 5F1HA 3OYBA 3I55T 4IIMA 3G1JA 1VQ7A 1JO8A 2E5KA 4F7UE 4O74A 4XQ3A 4QC1A 4TVRA 1KK7A 1J3TA 4M7DF 2FO0A 4OGCA 5IG6A 2B86A 1LCKA 3JAME 1D1BA 3LH5A 2DRMA 1ZA2B 2HD0A 4TT4A 4R56A 2X35A 5CUCA 2L85A 4M75C 4MR6A 2F2WA 1Q7YU 5LKTA 4KV1A 1AZGB 2K5LA 1K9AA 1XTDA 2CZ7B 2GGRA 3H9NA 4FU6A 3MP6A 1YHQA 4AT1B 4O7EA 5KYWA 1UEBA 2VXFA 4Y92A 3UWNA 1CKAA 2HSPA 2EKHA 2RO0A 2SRCA 4YYGA 4LD9K 4M77A 1KJWA 5L99A 1X2KA 2KTBB 2KXDA 2RN8A 4NS5A 1M8VA 1X0JA 4EDUA 1W6XA 2JNGA 1RLQC 2H3JA 4C8QE 5DYUA 2JJ9A 4CUSA 5CKBA 5HJCA 3VKIA 4OB2B 3CEYA 2M9UA 1QCFA 4RTZA 4PKCC 4FYYB 3VV0A 2CP6A 5CTLA 3M53A 3SVFA 1WLPB 1Y71A 4RKUE 2M0OA 4HT8A 3JCMP 2M1HA 1PD1A 4II1A 2HEQA 3CCJQ 4HKEA 4NUDA 2QAZA 2GFUA 2Y4YA 3P8DA 2CP5A 4LE9A 1VQOT 4J7FA 2MOXA 1RL2A 3JCMd 1AWWA 2RO1A 1UB4A 4LZSA 5GAMj 3GP8A 2FEIA 1IRXA 4BD3A 5CFWA 1MNEA 1X6BA 4UIZA 4Z93A 3QYHB 3RBBB 2LC4A 3OS5A 1OOTA 2ZPGB 4OGJA 4M75A 3JSCA 5A7CA 1AOJA 3RERA 4WCIA 1PHTA 4XTUA 3MULA 3EHQA 4ZW1A 5H1VA 1I5LA 4RMOA 2MJVB 3THKA 1X27A 1Y7XA 5FU7B 2EKOA 1LVKA 4JPBW 4RTYA 4ELYC 3U5NA 3OYHA 4UIYA 4GBQA 3REAB 4WIVA 4C66A 5IGMA 2DIGA 1N8RR 3OYGA 3CC2A 5LKZA 2CP2A 2LCLA 1K9MR 5FRMA 1ZUUA 2XU8A 5ENGA 4Q0OA 1IZ6A 1VQ5Q 5I7YA 4XTZA 3TU4K 2P4RA 3OSVA 4BJXA 2EGCA 1TS9A 1JM4B 4BW3A 1G3YA 4ZN3A 3CCMQ 4PJOE 2LZ6B 2QQRA 3FDRA 4O7CA 3PMTA 1K8AU 1QWFA 3CCJA 1M1FA 1T3SA 4FSSA 1C0MA 1W4SA 1IB8A 2LJ0A 3HMHA 2PVGB 1SRLA 4M7DE 1NJIC 4LXCA 5IXFA 3M55A 2GTOA 3TSZA 1YITQ 1I81A 1VQKQ 2F5KA 4GPJA 3MB3A 2DILA 4FCYA 2QGGA 2WSEE 1QP2A 1C6VX 2JXBA 4XAXB 2DPPB 3BE3A 5I86A 4MEPA 1JQQA 1QQJA 4Z89A 5KHMA 1KHCA 1V76A 4MZTA 3VYGA 5HQ5A 4D8DA 3G7ZA 5LJ1A 4QSUA 2EBPA 1UUEA 4DQ2A 3EG3A 2E12A 1SKUB 3ULRB 3P8HA 5DFBA 5LKXA 1UDLA 2JM9A 4KGVB 2KDSA 3GPLA 5C8GA 3G6EQ 4X9CA 4DOWA 1G8XA 1MGQA 2BZ8A 3LQHA 4YY6A 3U5KA 4HXSA 4UYEA 3BDUA 3SVHA 3M58A 4M78A 4JJDA 3O33A 2LJ3A 4Y91A 1UTIA 1VQ8T 1OQKA 2OX7A 3RKYA 3H0FA 4YBTA 1VQ5A 5H1UA 4XU1A 3AHUA 5LUUA 5KYUB 5CQ8A 5GAMh 1KSWA 4RCBA 5FU6C 5ENEA 4PTBA 3CCMA 4LC2A 1G3TA 1RAHB 2VKNA 3UA6A 2E70A 2XDPA 4ANJA 5KTWA 4JZ4A 1YJ9Q 5FG6A 2HL5C 1YFNA 2YRDA 3OY9A 1JJ2S 1HK9A 3QYGB 2DD4A 1WHKA 1MNDA 4OB3B 3EGXA 2FSAA 3JCMJ 4IUPA 4OP0A 2DBMA 2XIDA 1YITA 4M78D 1VQKA 1PKSA 2KK4A 5CK9A 2EJ9A 2EYWA 5HRXA 4M78G 1W2BS 2EQMA 5A0DA 3F70A 2DVRA 4QVZA 4M78B 2MK5A 1VQNA 4EIKA 4UYFA 3LYIA 1TTHB 1LJOA 5GMKj 2RQTA 5IN1A 1BBZA 4PNOA 1M90U 2AT1B 2WSCE 4QUTA 2Z0WA 2RMOA 1Q82U 3QDFA 5HM0A 5E3DA 1M3AA 4KH0B 5I83A 1Y07A 3V7RA 2QQSA 4KULA 3G6EA 4NR5A 3JVJA 2L3PA 2NXBA 5L96A 4BE1A 3NXBA 2KI7A 1AHJB 2E6NA 5EWWA 2OJ2A 3I56T 2QA4T 3DAIA 4QQGA 4QB3A 1SEMA 5LVQA 2R5AA 4UIWA 2RI2A 4M75F 1RLPC 1NYFA 3OBWA 3NPFA 4O6JA 2K79A 5HK3A 2RHZA 2LNVA 4UYFB 4F3IA 5AMEA 2KROA 3SFMA 1VQ4Q 4C5EA 2NUTA 3TREA 1YJ9A 5F62A 1OX9A 1WHMA 2HCKA 5C6SA 2ESWA 4C92D 3QWXX 3CCRQ 4C92G 2MAMA 2JS0A 3M0PA 3QG1A 3VU3C 4ZGDB 2DTHA 3PNWC 2J06A 3Q2EA 1WUMA 3CPWP 4PJLA 3GNGA 4LUEA 2VVKA 4ZGEB 2K9GA 2E4HA 4ZGJB 1WXTA 8ATCB 2CSIA 4TU4A 5D0CA 4C5HA 2LTOA 1G3SA 2KNBB 5HQ6A 5IHNA 1I0CA 2KT1A 4K11A 2R0SA 2LMJA 2E1HA 2JUFA 4NUEA 5FU6B 2DZCA 2KXCA 5LJ3g 2GRCA 5A2QE 5GANj 1VQLT 4QSPA 1X69A 2DXBA 4R55A 3EGDA 1YJWQ 1RUWA 4IKFA 5ENHA 1HYOA 1QKXA 4QQDA 4RG2A 1MV3A 2G3RA 1E6GA 4ORZA 4WF2A 2LX9A 4A9NA 2K3BA 5D6WA 4XTYA 4CC7A 3JVLA 3HPWA 3OS2A 1CSKA 1UHFA 4V2SA 1R0CB 4IURA 2CH4W 2V8IA 5GAN5 1JXMA 1ACMB 3CCVT 2XDDA 2RS9B 3SDZA 2IVWA 5GANg 4MENA 3G4ST 3NTKA 3VS1A 4M77E 1B34B 3E9GA 2EQJA 2MPXC 3EG0A 1IGQA 3PMIA 4QZSA 3HTRA 5ENJA 3NFCA 2GNCA 4HBXA 4A9MA 1WFWA 4YBMA 5DYXA 4QEUA 3D7CA 3CCQQ 3CCRA 2V26A 4OMQA 5GAMe 3EG9A 4XUAA 5A5OA 2I7KA 4M78F 2H60A 1M1KC 1TXQA 5LJ5g 2E65A 3CCUA 4A9LA 4QUUA 4JUVA 2DVQA 4LDYA 5IH2A 5L8UA 2X4XA 1ZSZB 3OYJA 2E7NA 4C5GA 1TUDA 4KH1B 3CCSQ 5A83A 3CC7A 1YWOA 1KC8R 1AZEA 2O31A 2LX7A 4LYWA 4QSVA 2A28A 2L5QA 2DYBA 4F16A 1Q86U 1D09B 4IOOA 5F25A 2OTJT 1RI9A 2BKDN 5I7XA 1H3HA 4M7AD 5CKFA 2X3WD 5DLZA 2CT4A 4Z1QA 1UGSB 4M7AG 2YRVA 1HXDA 2PQWA 2RI5A 4ZN1A 5CCAA 2K3XA 4M75E 4A4HA 4M7AB 1VQ6Q 1U5SA 2RHUA 3VUBA 5GMKm 1VQ9Q 3EH1A 7AT1B 4O7AA 3A8GB 4J6YA 2DXTA 4AFSC 5CUEA 1KHIA 5EICA 5F1LA 2N9GA 1GBQA 2KYBA 1D0XA 3O35A 2WSFE 3I9QA 4N4FA 1K8AR 5CY9A 5CUBA 5GAN4 4LYSA 5DKCA 3OYIA 1KQSP 2RJCA 3J81E 4J9DA 5EU1A 2YDLA 1ABQA 2RH2A 2ZPIB 3CMAQ 4QSRA 2VYTA 1BI2A 2RFJA 3CBMA 2ZPEB 5DW1A 2PVDB 5FG4A 5C87A 4OMLA 5J0DA 4UIVA 1Q7YC 3I55Q 5F3AA 4FIBA 2VASA 5LJ3d 4YYIA 3HRSA 2E7OA 4QVDA 1Z9ZA 3LX7A 2D1XA 5CKEA 3RKXA 4J9EA 3L2VA 2BUDA 2H8HA 3J80E 5CAIA 3A8HB 4LZRA 4XTXA 5D6YA 5E0RA 3WXMB 3HP9A 5A5SA 1T0HA 2CH4A 1IHVA 1NEBA 5AMFA 4BI3A 5GANd 4LDFA 1VQ9A 5GAOq 2A0FB 5AD3A 2HL3A 3DLMA 3P8BB 4A53A 4WTOB 5ENBA 5ETDA 2HAXA 4UYGA 5F61A 1BYMA 2DJZA 1AWOA 2MCNA 4JJNK 1VQMA 1Q81U 2COYA 2F2XA 2FVUA 1UHCA 4M78E 1B07A 5LJ5d 5EWCA 5ENIA 3M0UA 2DETA 4C67A 5EGUA 1PSEA 3OYKA 1WPYA 3NGPA 1QLYA 1UECA 2HQEA 4YYMA 2P84A 2X4YA 1VQOQ 4OB1B 5FH6A 3P1EA 2NUZA 5GMKe 4J83A 4KUIA 4B9XA 2YYNA 5D3TA 2HQHA 4WHWA 5ECAA 3QZSA 1PRMC 4JLIA 4BW2A 2CZ1B 5DY9A 2FG0A 2HKNA 1AWXA 4YYJA 1EFNA 2H3EB 2RM4A 4PJMA 1W2BP 2CREA 3WVDB 4C0FA 3WVEB 3L1AA 2HMAA 2DVJA 4Z6HA 2K3YA 3C0CA 4M7AF 4VUBA 3QZ9B 5FB1A 2Y4XA 3SWNC 5A5PA 3GF5A 5D3HA 1JU5C 5G4RA 1IHWA 2LQ8A 3L2QA 2MYSA 4J9HA 2RNWA 2YUNA 2FZGB 1SRMA 3L2RA 1D3BB 2YT6A 3PE0A 2PVOB 1OU8A 2KGTA 3RUXA 1JXOA 3CPWS 3JCMW 1I07A 4O5VA 1LOJA 4A54A 2EYZA 1YI2A 5LJ3e 1GCPA 2RJDA 2RD1A 4TT6A 5EC7A 1OZ2A 2E3KA 1QVFA 3HHTB 1OV3A 4J0SA 3QPHA 1I8FA 3A8OB 4OGEA 2K2MA 1NEGA 2KRSA 3UVWA 2DL8A 1ZKRA 1RAFB 2ABLA 1NJIR 4MR3A 4NR9A 2YELA 4AKGA 3I5SA 3OW2P 3CD6T 6AT1B 2QGFB 5GMKi 2MWPA 1JJ2A 5IIDA 4A9HA 5EA1A 5EP7A 1WGSA 3UVYA 3JV3A 2GTJA 2YDWA 2MIOA 1X2QA 3OQ5A 4O76A 3VS5A 2E6ZA 2R58A 1Z9QA 5KYNA 1OYXA 5E9LA 2JW4A 5GANe 2X4JA 3A98A 1BI1A 1KD1U 3QZTA 4B6MA 1D0ZA 3OS1A 2OI3A 5DBMA 3BDLA 1S72Q 2WACA 2X51A 4BI8B 4PY6A 4HXMA 4AFQC 1ZBXA 1AT1B 3VJPA 4LDUA 5CQ5A 2EJFA 1WHJA 5CUGA 3X26B 3SWNA 1JEGA 4QSWA 4QVCA 3D7SB 5DKHA 4HVVA 5TCMA 5LJ5e 5D3JA 1Q95G 5IGLA 4NQNA 2CSQA 3MP8A 3JCMQ 3M59A 1JBMA 5FFYA 1RAGB 5CGPA 3TSWA 5FBXA 2LDMA 2CUBA 5A81A 1VQ8Q 3GOXA 4CURA 5EG2A 3ASKA 3JB9I 1VQ7T 1QWEA 2YUOA 3JRZA 4OMFB 3OYYA 2EVRA 1CKBA 4NYWA 2O01E 3MEVA 1UJYA 4A63B 1M5Q1 4HXRA 5TB6A 5CZGA 2JM8A 5EPRA 3LWIA 3SWNB 5GAOn 1MV0B 1SHFA 4R0KA 2ZGWA 2DA9A 2RB6A 3R6OA 3L2WA 5BT5A 1M90C 4QSSA 5DX4A 2OTLT 2HBWA 4AKIA 4J7IA 3VYHB 2DL7A 1YHQT 1N9RA 5JWMA 2AZSA 1UG1A 1Q82C 2R0VA 1H641 2LJ1A 3SD4A 3BW1A 4TZ8A 5HRWA 5E9IA 4NL3A 1X01A 5IT9E 2HKQB 1OZ3A 2DZ9A 5GAMg 1PUOA 4YYDA 5GAOp 2JMAA 4Z02A 1U8RA 1S72A 5FROA 1K73U 5CKDA 4CI0C 1G83A 2GF7A 1AWJA 5FE9A 3L2ZA 4M78C 5JI8A 3H0IA 5CPEA 4RTXA 3FRNA 1KQSS 5AD2A 1UGPB 4KGXB 4J0RA 5ENCA 2CP7A 3P1DA 2K5IA 2IG0A 4QNSA 4RUGA 3QKJA 3TEEA 3O37A 3S6WA 4NYXA 1WUGA 2ZAEA 4YTLA 4IUUA 3RMQA 3DB3A 3U5JA 2K5FA 5LJ3f 2V8JA 3EFRA 2DRKA 2D9EA 3I56Q 5CRMA 2QA4Q 2ENMA 1VQ8A 2DE0X 5I80A 2PZ1A 3M0RA 3QUIA 5KH6A 5CQAA 2L89A 1QCOA 5I21A 3FLGA 3OBYA 4IOQA 1GFDA 3PGGA 4O77A 5KYUA 2FZKB 1U1TA 2D0QB 4UIUA 5I88A 1U1SA 1VYUA 1TU0B 5HEMA 3VRYA 4MMKA 2KMTA 5EQ1A 2DFUA 4RTVA 1WQWA 4N0AA 4PCIA 4PFZA 3M56A 4A9IA 5DLOA 5GANf 2EJGA 2BZYA 2L3SA 4Q5WA 1KQ1A 1WHHA 3KXTA 3U5OA 1FX7A 3CBPA 1EIFA 4E2FB 4NUCA 4O7FA 4OVAA 3QSUA 1YCSB 2CUDA 4C92C 1UJ0A 1UGRB 2GQIA 3CC2T 2I0NA 2QYZA 3X24B 4YH3A 4YY4A 4DBHA 5A82A 1M3BA 4AMCA 5LJ5f 4UITA 4LZ2A 4QSQA 1VQLQ 1VQPT 2XG8D 5C7NA 2LRQA 5HKCA 2D9TA 2DL3A 4UC4A 2LT1A 1HSQA 4NYVA 4KRTA 2DVSA 3OB9A 3CCJT 3TLPA 5M9OA 3JB9J 4QSXA 3I56A 2QA4A 1YJNQ 4OB0B 1DJ7B 4AFZC 5HENA 4L59A 1NZ9A 3G0JA 2VGMA 3HFNA 3CCVQ 4BY6C 2C06A 5E9MA 3G4SQ 1OPKA 1S1NA 4HBVA 1D1CA 2J7IA 4AI6A 5F2PA 2ROTA 3QHSA 1HJDA 4Y03A 2KE9A 1PM3A 1NPRA 5FH7A 4YABA 1M1KR 3S3OA 4Z1SA 4HXLA 4EPCA 2OO1A 4B9WA 1YNZA 1JSPB 5GAMd 5HRVA 1Q86C 5FE3A 3PT9A 2IIMA 3X28B 3EFOB 1SSFA 2YWWA 2M02A 5HFRA 4C92A 2YSQA 2JTMA 4NXJA 2PUKB 4LD6A 2AHJB 1ZSZC 1FMVA 4J9BA 2C0IA 1VQ5T 5ACYA 2YHTA 1VQLA 1XNIA 3SEMA 2DLPA 5LJ0A 5FE5A 2DTOA 3U5MA 2OTJQ 3HKSA 3CCMT 3HMEA 3RR6A 1FWZA 2LCCA 5EM3A 3OW2S 1GL5A 4FT2A 5HCKA 3OMGA 9ATCB 1LNXA 1SPKA 4J1PA 1YJNA 4NRAA 4DBRA 3VRZA 1OI1A 2JTEA 3PVQA 3CCVA 1YITT 1VQKT 2AK5A 2EFIA 3UF4A 4C92B 4M7AC 3G4SA 4QEVA 1MMGA 3FJPA 4FM4B 5FW9A 2NUPB 1UE9A 5FG5A 2DK3A 4F14A 2RJEA 1VQNT 2EWNA 3CPFA 4N4GA 1B34A 3MEAA 2BE9B 3ZL7C 1YIJT 2D6FA 2J6FA 3FC3A 2VB6A 5COIA 4P5NA 4F7UG 1Q7YR 2F6NA 4O71A 3UVXA 3E1SA 3MJXA 4CUPA 2YQDA 3FEOA 4F7UB 2VXEA 4NL2A 2DWWA 3G6ET 3E19A 2MWOA 4MR4A 1RAEB 4E6RA 1D1AA 1M4ZA 1UFFA 4BY6B 3GBQA 3ERRA 1ZSZA 2J05A 5I22A 1X43A 4QBMA 2SEMA 5FFVA 4QSTA 2O9SA 2RNAA 2DD5A 4RTWA 1GBRA 5GAN7
chains in the Genus database with same CATH topology
5E7DA 5EI4A 1N9SA 1QVPA 4E96A 1VQ4A 1YJ9T 1Q81C 4ELZC 5D6XA 4C8QG 4NR8A 2GCXA 4XU3A 4A4KA 3RCWA 2EQKA 4O72A 4M7AA 3CPWA 3MXFA 3RMSA 2FHDA 2LSPB 2JOYA 2I2LA 5LL6S 5CVIA 3O36A 5D25A 3M54A 3MUKA 4YH4A 5H1TA 4RG8A 3JVKA 3M4YA 4N3WA 3HMFA 5FFWA 3OA6A 3JCMX 1YJWA 3CMET 5CIUA 2QQBA 5II2A 4LRGA 1V29B 5I29A 3QO3A 2RHIA 5GMKl 2VC8A 2K57A 3JCMb 2DXCA 3SVGA 1BKBA 1Y96A 4IORA 2ZCFB 1K9MU 5HCLA 3CC4A 4BDZA 2F5TX 4BDYA 4QYDA 3LH0A 3P1CA 1EQFA 4PS5A 5GAN8 2XD0A 4C92F 3CCEA 3CCRT 3JB9H 3PIPA 3CCQA 2L84A 3PIOA 2GFAA 3M4GA 4LDVA 3CCUT 2LQKA 1I4K1 2RNYA 4QC3A 3CC7T 3CCSA 4IR3A 3S3MA 4F7UF 1Y96B 3MP1A 5E9VA 1KD1C 3A8LB 4NQMA 1NPPA 5J3BA 3AADA 3UV2A 1FXXA 2QTXA 5D26A 4E7IA 2RNXA 3UW9A 5FLXE 2RJFA 2RHYA 2E5QA 5D3NA 4JDSA 5D24A 4DONA 3U5LA 3JCMV 1VQ6A 1PSFA 5LVRA 5CRZA 4XTWA 5DYCA 4BB7A 2HQXA 2LVMA 2I8NA 4HCBA 1KQSA 4TT2A 2QQ9A 4NR6A 1ZHIA 5GAMf 2QEXA 5L97A 4BE2A 4EMKB 3GLXA 3OYMA 3CMAA 4KUDK 1WNLA 1VIFA 4QEWA 1X6OA 2EAYA 2VUBA 2P0KA 3NTIA 2ZPFB 5E9KA 3E9FA 4JLGA 1D3BA 5FB0A 4FL6A 2E41A 1WJRA 4DA4A 2JVVA 4L6V5 4PLLA 3I55A 4OGIA 5GAOm 5FDZA 2R57A 5BT4A 3UDCA 5FE0A 4YYHA 4X9DA 4E7KA 3JCMg 3CCLT 2JN0A 3CD6A 4XYAA 1K73C 4XK8E 3ME9A 5A5QA 4BACA 4YK0A 4IUVA 1O75A 5KTXA 2L5EA 1VIEA 4QR4A 4TZ2A 2DATA 4CLBA 2K4YA 3G71T 3A8MB 5E3GA 5CS8A 4LR6A 5C85A 4O7BA 4MZPA 4O75A 2P0QA 3Q2FA 3QXEB 4OUFA 2RI3A 3H6ZA 3MHXA 4HXKA 1WJQA 2RA2A 4CL9A 4C92E 3ZYUA 1VQMT 4C0GA 4JS5A 5EK9A 4JRPA 5HELA 2OAUA 2PUOB 4XUBA 2DEQA 5FE2A 2XKOC 3JVMA 5EWDA 5I40A 3UVDA 2WP1A 5HFQA 1VQOA 3OSSC 4LDXA 5I2SA 4XY8A 5CQYA 3MEUA 5F5ZA 4HXNA 1W2BA 2O4XB 5EVAA 1ZS5A 4Z6IA 4J8OA 2DVVA 4BW1A 5DY7A 2OTLA 2DKWA 2YEMA 2P0PA 4CFKA 3JCMh 5HLSA 2WP2A 2DTIA 5GAOr 3UPUA 1N72A 3FIFA 4MEOA 2D82A 4CUTA 1R8OB 2X4WA 1YI2T 5C89A 2DVEA 2A7YA 1E6IA 3S3NA 3QIIA 4E7HA 3MCAB 3QJYA 3X20B 4IUQA 4JS4A 3LGLA 3OMCA 2P4TA 3OW2A 4MEQA 4BHWA 2QDYB 4M77D 3C94A 3IU5A 5BT3A 4TU6A 3ONIA 4M77G 4NRCA 4HXOA 4N0AC 3AQAA 4A9FA 2KQWA 4ZC9A 2RK2A 4M77B 4EMHA 3CXCS 3HL8A 5FE8A 3V8LA 4PL6A 5DW2A 3QBYA 3DB4A 3NTHA 2EQUA 4M7AE 3OYAA 1KC8U 5G4SA 3GG3A 1G3WA 4MZMA 2VV5A 4C5IA 2DIQA 4GY5A 4HBWA 4ALGA 5J39A 4LDWA 5D3LA 4Y28E 3M9QA 3QJ6A 4A9OA 5K29A 4UYHA 5CQ4A 3MEWA 4IR4A 3MO8A 4M75D 1VQPA 5EISA 3OYLA 2L8DA 3C4SA 4M75G 2ZZDA 3UV5A 2KVQG 4A4GA 5L8TA 3JB9D 4HCZA 4M75B 5A0GA 4YAXA 3JB9G 2HNIA 3C12A 2CKKA 5IBNA 4ME7A 1GXIE 3G0LA 2R5MA 5FE1A 4JRIA 5H85A 2FB7A 3LLRA 3LQJA 2EYQA 2XI9A 1S72T 3M5AA 2YW5A 5A5RA 3SB2A 4JRQA 1KG1A 4C0DC 1QVGS 5KE3A 5EV9A 5F63A 1WQ7A 2OUOA 2RI7A 3JCMc 4J5YA 4N4HA 5KO4A 5EWHA 4BUGA 3JCMe 3A5ZB 2OSSA 2EIFA 3LW5E 5DFCA 2NLUA 2QI2A 1QVFS 2E64A 3PTAA 5CO7A 5CQ3A 3FKMX 4ZQLA 4M77F 5A85A 3VUZA 5HY6A 3QZ5B 2JTFA 3OYCA 5CUAA 2YEKA 1X75C 3BFMA 4XTVA 5IAYA 2M16A 4WHUA 4CUQA 4XU0A 4CRIA 4YATA 3FB9A 4Q0NA 4A4FA 3KBGA 3V8JA 4C8QC 4E47A 4PKLA 2ZPBB 4BW4A 5DLQE 2XDBA 5D3RA 5ETBA 3UV4A 4LYIA 3HSBA 2QXFA 3V7CA 1RI0A 4J3IA 2F6JA 1YIJA 5FE7A 5I2MA 1KQ2A 3UT1A 3O8VA 2CZ0B 1N8RC 4QR3A 5DLXA 1K9MC 3DKMA 3URGA 4RCCA 2R0YA 3K2JA 3ZFJA 2CZ6B 2JZ2A 2DXUA 4F7UA 4PCEA 2A3LA 2VGNA 4XU2A 4IUTA 4MR5A 4CFLA 4N4IA 4IR5A 4DOVA 5KU3A 5I89A 1TH7A 3DLLA 5EPSA 3JB9F 2MI6A 1VUBA 4C0DB 3P5OA 5LJ3j 2HBPA 2YLBA 5KE2A 3META 4AKNA 2DAQA 1BIAA 1N6AA 2CYZB 4J6WA 3GIBA 1NJIU 3M57A 3V8KA 5F36A 5CQXA 2PU9B 4C8QA 5L98A 2V8KA 1P92A 5GAN6 2XK0A 4TYLA 3L2UA 4GLKA 4MDXA 5FRNA 4O70A 2FL7A 5CR2A 2LT4A 4PJOC 5AYFA 5DYAA 5LJ2A 3CBOA 5C0MA 1G5VA 2G4AA 4MDWA 3S91A 4HBYA 3RESA 3CMEA 2BIVA 2OTJA 4X2IA 1BI3A 4ZTFA 3EAEA 3RKWA 4KCXA 5FH8A 1XOVA 4M7DC 3TCJA 4C8QD 3JCMf 3ER0A 4BI4A 5E9YA 2ZPHB 5J26A 2YLCA 2DO3A 3OYDA 3ZEHA 1YJNT 4TTEA 4FLPA 5LJ5j 4C8QB 2MF2A 5KCOA 3LJWA 4RVRA 1F68A 5KCHA 4EMGA 5GAN3 3I3JA 5EWVA 3LWHA 4ATOA 4HXPA 1YCYA 2B8AA 3LQIA 5DFDA 4L5GA 5GMKh 3INZA 4HA8A 3J7AF 2KAFA 1IREB 4UIXA 3HRTA 4EMKC 4A9EA 3H8ZA 1M1GA 4NRBA 1N27A 4UYDA 1QP3A 3L42A 3P1FA 4PJOA 2MMPA 5ENFA 4QW2A 4IR6A 1N8RU 4HT9A 4HCCA 4M7DA 1VQ4T 1WJSA 3IU6A 5LJ3h 4YYNA 4QY4A 4QYLA 2RHXA 5A0LA 4O78A 1UGQB 4E7LA 5CQTA 3BY7A 3C95A 4KV4A 4PJOD 5IGNA 4PJOG 4NR7A 5F60A 3T9NA 5FE6A 3O34A 4D6WA 5FE4A 2XICA 4PJOB 2E10A 3EFSA 4TQNA 4M7DD 1NE8A 4M7DG 5GANh 2XHCA 4X34A 5L8RE 4EMKA 1M9SA 4M7DB 5E73A 5A5NA 1YJWT 2FYKA 3OS0A 4E7JA 4YBSA 5CP5A 4J6XA 3CXCA 3X25B 4MMLA 4TS8A 5HK0A 3CCLA 1H3ZA 5LJ5h 1O9SA 1YBYA 2CGHA 5CQ7A 1JB0E 2GQVA 3HFOA 3U5PA 3QDRB 3CC4T 5LKUA 3S92A 4YC9A 4C8QF 3G71A 2K2VA 3HRUA 3CCET 5E74A 4KBMB 3MQMA 3CCQT 4BE0A 2QQAA 1XQHA 2RK1A 3OYFA 4CUUA 2KY9A 5CUDA 4FSXA 5DM7R 5CKHA 5GAOl 3RIRA 1MHNA 3Q1JA 5I1QA 3LXJA 1JRIA 4QQ6A 3CCST 1QW1A 3OYEA 4NOYA 5EPBA 1ZQ1A 2Y90A 4JRKA 3QZVA 4PLIA 1BIBA 2R10A 3PFSA 1M1KU 1KC8C 5C4QA 5D7XA 3ZBDA 4A9JA 2CS7A 5CQ6A 3V7SA 5KTUA 5IGKA 4YADA 4ALHA 4OF1A 4ZTJA 5II1A 1VQ6T 5D3PA 1VQ9T 4FT4A 4M77C 4A9KA 3N5BB 3DWYA 3OYNA 2F69A 1BI0A 5CU8A 2O4XA 2L3RA 4NR4A 1QVGA 5HQ7A 4YYKA 3GNFB 4QR5A 2QEXT 3MB4A 3CMAT 3LGFA 4C0ZA 1K8AC 5GAN2 3KUFA 5FU7C 4PJOF 4A4EA 2KSSA 4KT0E 2DKGA 5D3SA 5DKDA 4XY9A 5F1HA 3OYBA 3I55T 1VQ7A 4F7UE 4O74A 4XQ3A 4QC1A 4TVRA 4M7DF 4OGCA 5IG6A 3JAME 2HD0A 4TT4A 4R56A 2X35A 5CUCA 2L85A 4M75C 4MR6A 1Q7YU 5LKTA 4KV1A 2K5LA 4FU6A 2CZ7B 1XTDA 3MP6A 1YHQA 4O7EA 1UEBA 2VXFA 3UWNA 2RO0A 4YYGA 4LD9K 4M77A 5L99A 2KTBB 4NS5A 1M8VA 1X0JA 4EDUA 2JNGA 4C8QE 2H3JA 5DYUA 4CUSA 5CKBA 5HJCA 3VKIA 4OB2B 3CEYA 2M9UA 4PKCC 3VV0A 5CTLA 3M53A 3SVFA 1Y71A 4RKUE 2M0OA 4HT8A 3JCMP 2M1HA 4II1A 4HKEA 4NUDA 2GFUA 2Y4YA 3P8DA 1VQOT 4J7FA 1RL2A 3JCMd 2RO1A 1UB4A 4LZSA 5GAMj 3GP8A 4BD3A 5CFWA 4UIZA 4Z93A 3QYHB 2LC4A 3OS5A 2ZPGB 4OGJA 4M75A 3JSCA 5A7CA 3RERA 4XTUA 3MULA 4ZW1A 5H1VA 1I5LA 4RMOA 2MJVB 1Y7XA 5FU7B 2EKOA 4ELYC 3U5NA 3OYHA 4UIYA 4WIVA 4C66A 5IGMA 2DIGA 3OYGA 3CC2A 5LKZA 2LCLA 5FRMA 2XU8A 5ENGA 4Q0OA 1IZ6A 5I7YA 4XTZA 3TU4K 3OSVA 4BJXA 1JM4B 4BW3A 1G3YA 4ZN3A 4PJOE 2QQRA 3FDRA 4O7CA 3PMTA 1K8AU 3CCJA 1M1FA 1W4SA 3HMHA 2PVGB 4M7DE 1NJIC 3M55A 1I81A 2F5KA 4GPJA 3MB3A 2WSEE 1QP2A 4XAXB 2DPPB 5I86A 4MEPA 5KHMA 1KHCA 4MZTA 3VYGA 5HQ5A 3G7ZA 5LJ1A 4QSUA 4DQ2A 2E12A 3P8HA 5DFBA 5LKXA 2KDSA 3GPLA 5C8GA 4X9CA 4DOWA 1MGQA 3LQHA 4YY6A 3U5KA 4HXSA 4UYEA 3BDUA 3SVHA 3M58A 4M78A 3O33A 4Y91A 1VQ8T 3RKYA 4YBTA 1VQ5A 5H1UA 4XU1A 3AHUA 5LUUA 5CQ8A 5GAMh 4RCBA 5FU6C 5ENEA 4PTBA 3CCMA 4LC2A 1G3TA 2XDPA 2E70A 5KTWA 5FG6A 3OY9A 1JJ2S 1HK9A 3QYGB 2DD4A 4OB3B 2FSAA 3JCMJ 4IUPA 4OP0A 2XIDA 1YITA 4M78D 1VQKA 2KK4A 5CK9A 2EJ9A 5HRXA 4M78G 1W2BS 2EQMA 5A0DA 3F70A 2DVRA 4QVZA 4M78B 1VQNA 4UYFA 3LYIA 1LJOA 5GMKj 5IN1A 1M90U 4PNOA 2WSCE 4QUTA 1Q82U 5HM0A 5E3DA 5I83A 1Y07A 3V7RA 2QQSA 4KULA 3G6EA 4NR5A 3JVJA 4BE1A 2NXBA 5L96A 3NXBA 1AHJB 2E6NA 5EWWA 3I56T 2QA4T 3DAIA 4QQGA 4QB3A 5LVQA 2R5AA 4UIWA 2RI2A 4M75F 3OBWA 4O6JA 5HK3A 2RHZA 2LNVA 4UYFB 4F3IA 5AMEA 3SFMA 4C5EA 3TREA 1YJ9A 5F62A 5C6SA 4C92D 4C92G 2MAMA 3VU3C 3QG1A 4ZGDB 2DTHA 3PNWC 3Q2EA 1WUMA 3GNGA 4ZGEB 4ZGJB 4TU4A 5D0CA 4C5HA 2LTOA 1G3SA 5HQ6A 2R0SA 2E1HA 2JUFA 4NUEA 5FU6B 2DZCA 5LJ3g 2GRCA 5A2QE 5GANj 1VQLT 4QSPA 2DXBA 4R55A 4IKFA 5ENHA 4QQDA 4RG2A 2G3RA 4WF2A 2LX9A 4A9NA 5D6WA 4XTYA 3JVLA 3HPWA 3OS2A 4V2SA 4IURA 2V8IA 5GAN5 3CCVT 2XDDA 2RS9B 3SDZA 2IVWA 5GANg 4MENA 3G4ST 3NTKA 4M77E 1B34B 3E9GA 2EQJA 3PMIA 4QZSA 3NFCA 5ENJA 4HBXA 4A9MA 4YBMA 5DYXA 4QEUA 3D7CA 3CCRA 5GAMe 4XUAA 5A5OA 2I7KA 4M78F 2H60A 1M1KC 5LJ5g 2E65A 3CCUA 4A9LA 4QUUA 4JUVA 2DVQA 4LDYA 5L8UA 2X4XA 3OYJA 2E7NA 4C5GA 5A83A 3CC7A 4LYWA 4QSVA 2L5QA 1Q86U 4IOOA 5F25A 2OTJT 2BKDN 5I7XA 4M7AD 5CKFA 5DLZA 4Z1QA 1UGSB 4M7AG 2YRVA 1HXDA 2PQWA 2RI5A 4ZN1A 5CCAA 2K3XA 4M75E 4A4HA 4M7AB 2RHUA 3VUBA 5GMKm 4O7AA 3A8GB 4J6YA 2DXTA 5CUEA 1KHIA 5EICA 5F1LA 2N9GA 3O35A 2WSFE 4N4FA 5CY9A 5CUBA 5GAN4 4LYSA 5DKCA 3OYIA 2RJCA 3J81E 5EU1A 2RH2A 2ZPIB 4QSRA 2VYTA 1BI2A 2RFJA 3CBMA 2ZPEB 5DW1A 2PVDB 5FG4A 5C87A 5J0DA 4UIVA 1Q7YC 5F3AA 4FIBA 5LJ3d 4YYIA 3HRSA 2E7OA 4QVDA 5CKEA 3LX7A 3RKXA 3L2VA 2BUDA 3J80E 5CAIA 3A8HB 4LZRA 4XTXA 5D6YA 5E0RA 3WXMB 3HP9A 5A5SA 5AMFA 4BI3A 5GANd 4LDFA 1VQ9A 5GAOq 5AD3A 3DLMA 3P8BB 4A53A 5ENBA 5ETDA 2HAXA 4UYGA 5F61A 1BYMA 2DJZA 4JJNK 1VQMA 1Q81U 2FVUA 4M78E 5LJ5d 5EWCA 5ENIA 4C67A 5EGUA 1PSEA 3OYKA 1WPYA 2HQEA 4YYMA 2X4YA 4OB1B 5FH6A 3P1EA 5GMKe 4J83A 4KUIA 4B9XA 2YYNA 5D3TA 4WHWA 3QZSA 4JLIA 4BW2A 2CZ1B 5DY9A 4YYJA 2RM4A 3WVDB 4C0FA 3WVEB 3L1AA 4Z6HA 2K3YA 4M7AF 4VUBA 3QZ9B 5FB1A 2Y4XA 3SWNC 5A5PA 3GF5A 5D3HA 5G4RA 2LQ8A 3L2QA 2RNWA 3L2RA 1D3BB 2PVOB 3RUXA 3CPWS 3JCMW 4O5VA 1LOJA 4A54A 1YI2A 5LJ3e 2RJDA 2RD1A 4TT6A 1OZ2A 2E3KA 1QVFA 3HHTB 4J0SA 3QPHA 1I8FA 3A8OB 4OGEA 3UVWA 4MR3A 4NR9A 2YELA 3CD6T 5GMKi 2MWPA 1JJ2A 5IIDA 4A9HA 5EA1A 5EP7A 1WGSA 3UVYA 2YDWA 3OQ5A 4O76A 2E6ZA 2R58A 1OYXA 5E9LA 5GANe 2X4JA 1BI1A 1KD1U 3QZTA 3OS1A 5DBMA 3BDLA 2WACA 4BI8B 4PY6A 4HXMA 1ZBXA 3VJPA 4LDUA 5CQ5A 2EJFA 5CUGA 3X26B 3SWNA 4QSWA 4QVCA 5DKHA 5TCMA 5LJ5e 5D3JA 5IGLA 4NQNA 3MP8A 3JCMQ 3M59A 1JBMA 5FFYA 5CGPA 5FBXA 2LDMA 5A81A 3GOXA 4CURA 5EG2A 3ASKA 3JB9I 1VQ7T 3JRZA 4OMFB 3OYYA 4NYWA 2O01E 3MEVA 1M5Q1 4HXRA 5TB6A 5CZGA 5EPRA 3LWIA 3SWNB 5GAOn 2ZGWA 2RB6A 3R6OA 3L2WA 5BT5A 1M90C 4QSSA 5DX4A 2OTLT 4J7IA 3VYHB 1YHQT 1N9RA 5JWMA 1Q82C 2R0VA 1H641 3SD4A 3BW1A 4TZ8A 5HRWA 5E9IA 4NL3A 1X01A 5IT9E 1OZ3A 2DZ9A 5GAMg 4YYDA 5GAOp 4Z02A 1U8RA 1S72A 5FROA 1K73U 5CKDA 4CI0C 2GF7A 5FE9A 3L2ZA 4M78C 5JI8A 5CPEA 3FRNA 1KQSS 5AD2A 1UGPB 4J0RA 5ENCA 3P1DA 2K5IA 2IG0A 4QNSA 3QKJA 3TEEA 3O37A 3S6WA 4NYXA 1WUGA 4YTLA 3RMQA 4IUUA 3DB3A 3U5JA 2K5FA 5LJ3f 2V8JA 3EFRA 2D9EA 5CRMA 1VQ8A 5I80A 3QUIA 5KH6A 5CQAA 2L89A 5I21A 3FLGA 3OBYA 4IOQA 3PGGA 4O77A 1U1TA 4UIUA 5I88A 1U1SA 2D0QB 5HEMA 4MMKA 2KMTA 5EQ1A 1WQWA 4N0AA 4PCIA 3M56A 4A9IA 5DLOA 5GANf 2EJGA 4Q5WA 1KQ1A 3KXTA 3U5OA 1FX7A 3CBPA 1EIFA 4NUCA 4O7FA 4OVAA 3QSUA 4C92C 1UGRB 3CC2T 3X24B 4YH3A 4YY4A 5A82A 5LJ5f 4UITA 4LZ2A 4QSQA 1VQPT 2XG8D 5C7NA 2LRQA 5HKCA 2D9TA 4UC4A 2LT1A 4NYVA 2DVSA 3OB9A 3CCJT 3TLPA 5M9OA 3JB9J 4QSXA 3I56A 2QA4A 4OB0B 1DJ7B 5HENA 4L59A 1NZ9A 3G0JA 2VGMA 3HFNA 4BY6C 2C06A 5E9MA 4HBVA 5F2PA 3QHSA 4Y03A 1NPRA 5FH7A 4YABA 3S3OA 4Z1SA 4HXLA 4EPCA 2OO1A 4B9WA 1JSPB 5GAMd 5HRVA 1Q86C 5FE3A 3PT9A 3X28B 1SSFA 5HFRA 4C92A 2JTMA 4NXJA 2PUKB 4LD6A 2AHJB 1VQ5T 5ACYA 2YHTA 1VQLA 1XNIA 5LJ0A 5FE5A 2DTOA 3U5MA 3HKSA 3CCMT 3HMEA 1FWZA 2LCCA 5EM3A 3OW2S 4FT2A 3OMGA 1LNXA 4J1PA 1YJNA 4NRAA 1OI1A 3CCVA 1YITT 1VQKT 2EFIA 4M7AC 4C92B 3G4SA 4QEVA 3FJPA 4FM4B 5FG5A 2DK3A 2RJEA 1VQNT 2EWNA 3CPFA 4N4GA 1B34A 3MEAA 1YIJT 2D6FA 3FC3A 5COIA 4P5NA 4F7UG 2F6NA 4O71A 3UVXA 3E1SA 4CUPA 2YQDA 3FEOA 4F7UB 2VXEA 4NL2A 2DWWA 3G6ET 3E19A 2MWOA 4MR4A 1M4ZA 4BY6B 4QBMA 5FFVA 4QSTA 2DD5A 5GAN7
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E7D A;  4N4H A;  4LDF A;  5EI4 A;  5KO4 A;  5EWH A;  4E96 A;  5AD3 A;  3DLM A;  5CTL A;  2OSS A;  3SVF A;  5ENB A;  2M0O A;  5DFC A;  5ETD A;  2M1H A;  2NLU A;  5D6X A;  4UYG A;  5F61 A;  4II1 A;  4NR8 A;  4NUD A;  5CQ3 A;  2GFU A;  3RCW A;  3FKM X;  2EQK A;  3P8D A;  4ZQL A;  4O72 A;  3MXF A;  5EWC A;  5ENI A;  2FHD A;  2RO1 A;  5A85 A;  2LSP B;  4C67 A;  4LZS A;  5EGU A;  2JTF A;  3OYC A;  5CUA A;  3OYK A;  2YEK A;  3O36 A;  5D25 A;  3MUK A;  4YYM A;  2HQE A;  4BD3 A;  5CFW A;  4YH4 A;  2X4Y A;  5IAY A;  2M16 A;  4WHU A;  4CUQ A;  4CRI A;  5H1T A;  4UIZ A;  5FH6 A;  4YAT A;  4Z93 A;  3P1E A;  3JVK A;  4B9X A;  2YYN A;  4N3W A;  4Q0N A;  5D3T A;  3HMF A;  4OGJ A;  4A4F A;  4WHW A;  4PKL A;  5A7C A;  3QZS A;  4BW4 A;  5FFW A;  4BW2 A;  3OA6 A;  3MUL A;  5D3R A;  4YYJ A;  5ETB A;  4ZW1 A;  5H1V A;  3UV4 A;  4LYI A;  5CIU A;  1RI0 A;  2MJV B;  4J3I A;  2F6J A;  5FE7 A;  2EKO A;  3UT1 A;  5II2 A;  3O8V A;  4LRG A;  4Z6H A;  3U5N A;  5I29 A;  2K3Y A;  3OYH A;  2RHI A;  4UIY A;  4QR3 A;  4WIV A;  5DLX A;  4C66 A;  5IGM A;  5FB1 A;  2DIG A;  5A5P A;  3OYG A;  5D3H A;  5LKZ A;  5G4R A;  3SVG A;  2R0Y A;  3L2Q A;  3K2J A;  2RNW A;  5FRM A;  2JZ2 A;  4IOR A;  5ENG A;  4Q0O A;  3L2R A;  5I7Y A;  4PCE A;  5HCL A;  4BDZ A;  4BJX A;  4BDY A;  4QYD A;  4IUT A;  3LH0 A;  1JM4 B;  4BW3 A;  3P1C A;  1EQF A;  4MR5 A;  4PS5 A;  4CFL A;  2QQR A;  3FDR A;  4N4I A;  4O7C A;  3PMT A;  4IR5 A;  5KU3 A;  2RJD A;  5I89 A;  4TT6 A;  5EPS A;  1OZ2 A;  2E3K A;  2L84 A;  3HMH A;  4J0S A;  2GFA A;  3P5O A;  3UVW A;  2F5K A;  5KE2 A;  4MR3 A;  4NR9 A;  2YEL A;  4GPJ A;  3MET A;  4AKN A;  2DAQ A;  2RNY A;  4QC3 A;  2MWP A;  3MB3 A;  5IID A;  4A9H A;  4IR3 A;  5EA1 A;  5EP7 A;  1WGS A;  3UVY A;  2YDW A;  5F36 A;  3S3M A;  3MP1 A;  5E9V A;  4NQM A;  4O76 A;  3OQ5 A;  5L98 A;  2R58 A;  5I86 A;  3AAD A;  3UV2 A;  1OYX A;  5E9L A;  4MEP A;  5D26 A;  2XK0 A;  5KHM A;  1KHC A;  4TYL A;  5HQ5 A;  3L2U A;  4E7I A;  3QZT A;  2RNX A;  3OS1 A;  5LJ1 A;  4QSU A;  5DBM A;  3UW9 A;  3BDL A;  5FRN A;  4O70 A;  2RJF A;  2WAC A;  3P8H A;  5DFB A;  5LKX A;  2E5Q A;  4PY6 A;  2RHY A;  4HXM A;  5D3N A;  5D24 A;  5DYA A;  5LJ2 A;  5C8G A;  5CQ5 A;  4DON A;  5C0M A;  1G5V A;  5CUG A;  2G4A A;  3S91 A;  4QSW A;  3U5L A;  3LQH A;  4HBY A;  4YY6 A;  3U5K A;  4HXS A;  4UYE A;  5DKH A;  2BIV A;  4X2I A;  5LVR A;  4ZTF A;  3SVH A;  5CRZ A;  3EAE A;  4KCX A;  5FH8 A;  5TCM A;  3O33 A;  5D3J A;  5IGL A;  4NQN A;  5DYC A;  3MP8 A;  4YBT A;  5E9Y A;  5J26 A;  5H1U A;  3OYD A;  5LUU A;  3ZEH A;  5CQ8 A;  5FFY A;  2HQX A;  2I8N A;  2LVM A;  4TTE A;  5ENE A;  4PTB A;  4FLP A;  5CGP A;  4TT2 A;  4LC2 A;  5FBX A;  2LDM A;  2XDP A;  4NR6 A;  5A81 A;  5KCO A;  3LJW A;  5L97 A;  5KTW A;  4CUR A;  4RVR A;  3ASK A;  3GOX A;  4BE2 A;  5FG6 A;  1F68 A;  5KCH A;  3OYM A;  3I3J A;  5EWV A;  3OY9 A;  4QEW A;  2P0K A;  2FSA A;  4NYW A;  4HXP A;  3MEV A;  3NTI A;  2B8A A;  3LQI A;  5E9K A;  3E9F A;  4IUP A;  5FB0 A;  5DFD A;  4FL6 A;  4HXR A;  5TB6 A;  5CZG A;  1WJR A;  4PLL A;  5EPR A;  4OGI A;  5HRX A;  5FDZ A;  2R57 A;  5BT4 A;  2EQM A;  3F70 A;  3L2W A;  2DVR A;  5BT5 A;  4QVZ A;  4QSS A;  4UIX A;  5DX4 A;  5FE0 A;  4YYH A;  4E7K A;  4A9E A;  4UYF A;  3LYI A;  5JWM A;  3H8Z A;  2R0V A;  3SD4 A;  4XYA A;  5IN1 A;  4TZ8 A;  4NRB A;  1N27 A;  3ME9 A;  4UYD A;  5A5Q A;  5HRW A;  5E9I A;  4BAC A;  3L42 A;  4QUT A;  4YK0 A;  1OZ3 A;  4YYD A;  4Z02 A;  3P1F A;  4IUV A;  5KTX A;  5HM0 A;  5ENF A;  5FRO A;  2L5E A;  5E3D A;  4QR4 A;  4TZ2 A;  5I83 A;  2DAT A;  4CLB A;  4QW2 A;  2QQS A;  5E3G A;  4NR5 A;  3JVJ A;  2GF7 A;  2NXB A;  4IR6 A;  5L96 A;  5FE9 A;  5CS8 A;  4BE1 A;  5JI8 A;  3NXB A;  4LR6 A;  5CPE A;  5C85 A;  4O7B A;  2E6N A;  5EWW A;  4O75 A;  5AD2 A;  4J0R A;  3Q2F A;  3DAI A;  4OUF A;  5ENC A;  3P1D A;  4QQG A;  4QB3 A;  2RI3 A;  1WJS A;  3IU6 A;  2IG0 A;  3H6Z A;  4QNS A;  5LVQ A;  4HXK A;  4UIW A;  2R5A A;  2RI2 A;  3QKJ A;  1WJQ A;  4YYN A;  3O37 A;  4QY4 A;  4QYL A;  2RHX A;  4CL9 A;  4NYX A;  1WUG A;  3S6W A;  4IUU A;  4O78 A;  4E7L A;  3DB3 A;  3ZYU A;  3U5J A;  5CQT A;  4KV4 A;  2RHZ A;  2D9E A;  4UYF B;  5CRM A;  4F3I A;  5AME A;  4C5E A;  5I80 A;  5F62 A;  5IGN A;  5KH6 A;  5CQA A;  5EK9 A;  4NR7 A;  5F60 A;  2L89 A;  3FLG A;  5C6S A;  5HEL A;  5FE6 A;  4IOQ A;  3O34 A;  5FE4 A;  4XUB A;  4O77 A;  5FE2 A;  4TQN A;  3JVM A;  5EWD A;  5I40 A;  4UIU A;  3UVD A;  2WP1 A;  5I88 A;  3PNW C;  5HFQ A;  3Q2E A;  1WUM A;  4XY8 A;  5HEM A;  3MEU A;  5EQ1 A;  4X34 A;  5F5Z A;  4PCI A;  4A9I A;  5E73 A;  5A5N A;  4TU4 A;  5D0C A;  4C5H A;  2LTO A;  4HXN A;  5HQ6 A;  4Q5W A;  3OS0 A;  4E7J A;  4YBS A;  2R0S A;  3U5O A;  2O4X B;  4NUE A;  5EVA A;  5CP5 A;  2GRC A;  1ZS5 A;  4NUC A;  4Z6I A;  2DVV A;  4O7F A;  4BW1 A;  5DY7 A;  4TS8 A;  4OVA A;  4QSP A;  2DKW A;  2YEM A;  1H3Z A;  4CFK A;  4IKF A;  5ENH A;  4QQD A;  4YH3 A;  5HLS A;  4RG2 A;  4YY4 A;  2G3R A;  2WP2 A;  5A82 A;  5CQ7 A;  4A9N A;  4UIT A;  5D6W A;  1N72 A;  3JVL A;  4LZ2 A;  4QSQ A;  4MEO A;  3U5P A;  3OS2 A;  5C7N A;  2LRQ A;  2D9T A;  4UC4 A;  5LKU A;  3S92 A;  4YC9 A;  4NYV A;  4IUR A;  2D82 A;  4CUT A;  2X4W A;  5C89 A;  2DVS A;  2RS9 B;  3OB9 A;  5E74 A;  1E6I A;  3TLP A;  5M9O A;  3MQM A;  4MEN A;  3S3N A;  3QII A;  4E7H A;  3NTK A;  4BE0 A;  3OYF A;  4QSX A;  4CUU A;  3E9G A;  2EQJ A;  4IUQ A;  3LGL A;  3PMI A;  5CUD A;  5HEN A;  4QZS A;  4L59 A;  3G0J A;  5ENJ A;  3OMC A;  4HBX A;  4A9M A;  1MHN A;  4YBM A;  3Q1J A;  5E9M A;  5DYX A;  4QEU A;  4MEQ A;  3D7C A;  4BHW A;  3LXJ A;  5I1Q A;  4HBV A;  4QQ6 A;  4XUA A;  3IU5 A;  5F2P A;  5A5O A;  2I7K A;  4TU6 A;  2H60 A;  3ONI A;  5BT3 A;  4NRC A;  3OYE A;  4HXO A;  4Y03 A;  5EPB A;  3AQA A;  4A9F A;  5FH7 A;  4ZC9 A;  4QUU A;  4A9L A;  4YAB A;  3S3O A;  4Z1S A;  3QZV A;  2DVQ A;  4PLI A;  4HXL A;  5L8U A;  2X4X A;  3OYJ A;  2R10 A;  2E7N A;  5FE8 A;  3PFS A;  4C5G A;  2OO1 A;  4PL6 A;  5DW2 A;  5A83 A;  4B9W A;  5C4Q A;  5D7X A;  1JSP B;  5HRV A;  4A9J A;  5FE3 A;  4LYW A;  3QBY A;  3DB4 A;  5CQ6 A;  3NTH A;  4QSV A;  2EQU A;  1SSF A;  3OYA A;  5KTU A;  5IGK A;  4YAD A;  5G4S A;  3GG3 A;  5HFR A;  4ALH A;  4IOO A;  4C5I A;  4ZTJ A;  5II1 A;  5F25 A;  2DIQ A;  5D3P A;  2BKD N;  4NXJ A;  4GY5 A;  4LD6 A;  5I7X A;  4HBW A;  4A9K A;  4ALG A;  5DLZ A;  5J39 A;  4Z1Q A;  2YRV A;  3DWY A;  5ACY A;  3OYN A;  5D3L A;  2PQW A;  2RI5 A;  3M9Q A;  1XNI A;  2K3X A;  5CU8 A;  2O4X A;  3QJ6 A;  2L3R A;  5LJ0 A;  4A4H A;  4NR4 A;  5FE5 A;  5HQ7 A;  4A9O A;  3U5M A;  5K29 A;  2RHU A;  3HME A;  4UYH A;  4YYK A;  4QR5 A;  5CQ4 A;  4O7A A;  3MEW A;  2LCC A;  5EM3 A;  3MB4 A;  4IR4 A;  5CUE A;  3MO8 A;  3OMG A;  3LGF A;  5EIC A;  5EIS A;  3KUF A;  5F1L A;  2N9G A;  4J1P A;  2L8D A;  3C4S A;  3O35 A;  3OYL A;  3UV5 A;  4N4F A;  4A4G A;  4NRA A;  5CY9 A;  5L8T A;  5CUB A;  4A4E A;  4LYS A;  5DKC A;  5D3S A;  1OI1 A;  3OYI A;  4HCZ A;  5DKD A;  4XY9 A;  2RJC A;  5F1H A;  5EU1 A;  4YAX A;  3OYB A;  2EFI A;  4QSR A;  4O74 A;  2VYT A;  4QEV A;  4QC1 A;  2RFJ A;  2CKK A;  5IBN A;  5DW1 A;  5FG4 A;  5FG5 A;  5IG6 A;  5C87 A;  3G0L A;  2RJE A;  5J0D A;  2R5M A;  4UIV A;  4N4G A;  3MEA A;  5FE1 A;  5F3A A;  3FC3 A;  5COI A;  5H85 A;  3LLR A;  4TT4 A;  3LQJ A;  2F6N A;  4O71 A;  2X35 A;  4YYI A;  5CUC A;  2L85 A;  3UVX A;  4MR6 A;  4CUP A;  2YQD A;  5LKT A;  4KV1 A;  3FEO A;  4FU6 A;  2E7O A;  3MP6 A;  2YW5 A;  4O7E A;  5A5R A;  3LX7 A;  2DWW A;  3L2V A;  2BUD A;  2MWO A;  4MR4 A;  3UWN A;  2RO0 A;  4YYG A;  5L99 A;  5KE3 A;  5EV9 A;  4LZR A;  5F63 A;  2OUO A;  5D6Y A;  5E0R A;  2KTB B;  2RI7 A;  4NS5 A;  1X0J A;  4EDU A;  5A5S A;  4QBM A;  5DYU A;  5FFV A;  4CUS A;  4QST A;  5HJC A;  5AMF A;  3CEY A; 
#chains in the Genus database with same CATH topology
 5E7D A;  5EI4 A;  1N9S A;  4E7Z A;  1QVP A;  4LUD A;  5AT1 B;  3CC4 Q;  4E96 A;  1VQ4 A;  1YJ9 T;  4LN2 A;  1Q81 C;  4HCK A;  3SHW A;  3A1P A;  4ELZ C;  5D6X A;  4C8Q G;  3CCE Q;  4NR8 A;  1RAB B;  2GCX A;  4XU3 A;  4A4K A;  2DM1 A;  3I35 A;  3RCW A;  2EQK A;  4O72 A;  4M7A A;  3CPW A;  1R0B G;  3MXF A;  3RMS A;  2FHD A;  2LSP B;  2JOY A;  2I2L A;  5LL6 S;  1OX8 A;  5CVI A;  1PWT A;  3O36 A;  5D25 A;  4J9C A;  3M54 A;  3MUK A;  1AVZ C;  4YH4 A;  2ED0 A;  5H1T A;  4PFO A;  4RG8 A;  3JVK A;  3M4Y A;  1M2V B;  4N3W A;  3HMF A;  1PRL C;  4PK4 A;  5FFW A;  1BB9 A;  2YRC A;  3OA6 A;  4E7S A;  3JCM X;  1YJW A;  3CME T;  1M27 C;  3UA7 A;  5CIU A;  2QQB A;  1YN8 A;  1BCO A;  2NWM A;  5II2 A;  4LRG A;  3CQT A;  1V29 B;  5I29 A;  1BU1 A;  3QO3 A;  2RHI A;  3CXC P;  5GMK l;  2VC8 A;  2K57 A;  3JCM b;  1SSH A;  2DXC A;  3SVG A;  3MKD A;  1BKB A;  1Y96 A;  4IOR A;  2FRW A;  4M4Z A;  2ZCF B;  1K9M U;  2ATC B;  5HCL A;  3CC4 A;  3VKH A;  4BDZ A;  2F5T X;  4BDY A;  4QYD A;  3LH0 A;  4CC3 A;  4AG2 C;  3P1C A;  1EQF A;  4PS5 A;  2QEX Q;  5GAN 8;  2XD0 A;  4C92 F;  3CCE A;  3CCR T;  3JB9 H;  3PIP A;  3CCQ A;  4ESR A;  4Z8A A;  5KYY B;  2L84 A;  3PIO A;  1WA7 A;  1H8K A;  3PVL A;  2JT4 A;  2GFA A;  3M4G A;  4LDV A;  3H0H A;  3CCU T;  2LQK A;  1I4K 1;  2RNY A;  2LQW A;  4QC3 A;  2DL5 A;  3CC7 T;  3CCS A;  4IR3 A;  1AD5 A;  1B7T A;  4F17 A;  3S3M A;  4F7U F;  1Y96 B;  1C1A A;  3MP1 A;  5E9V A;  1KD1 C;  3A8L B;  4NQM A;  1NPP A;  5J3B A;  3AAD A;  3UV2 A;  1FXX A;  2QTX A;  4LNP A;  3CD6 Q;  5D26 A;  1KFZ A;  4E7I A;  1MMA A;  2RNX A;  3UW9 A;  2F2V A;  5FLX E;  2RJF A;  2KEA A;  2RHY A;  2E5Q A;  5D3N A;  4JDS A;  5D24 A;  4DON A;  1R77 A;  2EQI A;  3U5L A;  4DBF A;  2J6K A;  4PJJ A;  1PSF A;  3JCM V;  1VQ6 A;  5LVR A;  5CRZ A;  4XTW A;  1A0N B;  1MMN A;  5DYC A;  4BB7 A;  2HQX A;  2LVM A;  2I8N A;  5IHK A;  1TSF A;  2QAS A;  1QVG P;  4HCB A;  4JZ3 A;  4TT2 A;  1KQS A;  2FPE A;  2QQ9 A;  2CT3 A;  4NR6 A;  1ZHI A;  5GAM f;  2QEX A;  5L97 A;  4BE2 A;  2E3H A;  4EMK B;  3GLX A;  3OYM A;  3CMA A;  2RQV A;  1TOV A;  3KFV A;  1WNL A;  4KUD K;  1VIF A;  4QEW A;  1X6O A;  2EAY A;  2EYX A;  2P0K A;  2VUB A;  2AKL A;  3NTI A;  2ZPF B;  5E9K A;  3E9F A;  1I1J A;  1QCN A;  1D3B A;  4JLG A;  5FB0 A;  1NBE B;  4FL6 A;  1WIE A;  2E41 A;  1WJR A;  4DA4 A;  4OMO A;  2JVV A;  3QWY A;  1PD0 A;  4L6V 5;  4PLL A;  1VQ7 Q;  3I55 A;  4OGI A;  5GAO m;  5FDZ A;  2R57 A;  5BT4 A;  3VS7 A;  3UDC A;  2HZY A;  5FE0 A;  4YYH A;  4FW2 A;  1GRI A;  4X9D A;  3JCM g;  3CCL T;  4E7K A;  1M90 R;  2JN0 A;  3CD6 A;  4XYA A;  1K73 C;  4XK8 E;  1Q82 R;  3ME9 A;  5A5Q A;  4FW1 A;  4BAC A;  1K0X A;  4YK0 A;  1AEY A;  2M51 A;  2OTL Q;  2FPD A;  3NHN A;  4IUV A;  1O75 A;  5KTX A;  2L5E A;  1VIE A;  1YHQ Q;  4QR4 A;  4TZ2 A;  2DAT A;  1EX4 A;  4CLB A;  2K4Y A;  3G71 T;  3A8M B;  3U23 A;  5E3G A;  2W10 A;  5CS8 A;  4LR6 A;  1I5O B;  5C85 A;  4O7B A;  4MZP A;  4O75 A;  2P0Q A;  2GBQ A;  3Q2F A;  3QXE B;  4OUF A;  5L23 A;  2RI3 A;  1ZX6 A;  3H6Z A;  3MHX A;  4HXK A;  2AZV A;  1WJQ A;  2RA2 A;  4CL9 A;  1QKW A;  4C92 E;  2HSE B;  3ZYU A;  1Y57 A;  1VQM T;  4C0G A;  4JS5 A;  2DJQ A;  5EK9 A;  4JRP A;  4J9G A;  5HEL A;  2OAU A;  2PUO B;  3TQ7 P;  4XUB A;  2DEQ A;  5FE2 A;  2XKO C;  3JVM A;  5EWD A;  5I40 A;  3UVD A;  4DEY A;  2WP1 A;  5HFQ A;  1VQO A;  3OSS C;  4LDX A;  1BK2 A;  5I2S A;  4XY8 A;  1PNJ A;  1TG0 A;  3MEU A;  5CQY A;  1SF9 A;  2EGE A;  5F5Z A;  1PCX A;  4HXN A;  1W2B A;  2YXY A;  2O4X B;  2YUQ A;  5EVA A;  1ZS5 A;  4Z6I A;  4J9I A;  4J8O A;  2DVV A;  4BW1 A;  5DY7 A;  4FYW B;  3M0Q A;  2OTL A;  2DKW A;  2YEM A;  2P0P A;  4CFK A;  3JCM h;  5HLS A;  4Z88 A;  2WP2 A;  2DTI A;  2KYM A;  5GAO r;  2EW3 A;  3UPU A;  1N72 A;  3FJ5 A;  3FIF A;  5I11 A;  4MEO A;  1NLP C;  3CC2 Q;  2D82 A;  4CUT A;  1R8O B;  4QT7 A;  4AKH A;  2X4W A;  1YI2 T;  5C89 A;  2DVE A;  2A7Y A;  1E6I A;  2CP0 A;  3S3N A;  3QII A;  5IHI A;  4E7H A;  1VQP Q;  1OU9 A;  3MCA B;  3QJY A;  3X20 B;  4IUQ A;  4JS4 A;  3LGL A;  2IPO B;  2V1Q A;  3OMC A;  2P4T A;  2ED1 A;  1T3L A;  1FMW A;  3OW2 A;  3VKG A;  4MEQ A;  4BHW A;  2E3I A;  2HDA A;  2QDY B;  2RQR A;  4M77 D;  4OMM A;  3C94 A;  3IU5 A;  2AKK A;  2BTT A;  5BT3 A;  4TU6 A;  3ONI A;  4M77 G;  5KYW B;  4NRC A;  4HXO A;  4N0A C;  3AQA A;  4A9F A;  2KQW A;  4OMN A;  4ZC9 A;  2RK2 A;  4M77 B;  1NG2 A;  4EMH A;  3CXC S;  3HL8 A;  5FE8 A;  1RAA B;  3V8L A;  1WI7 A;  2QDL A;  4PL6 A;  5DW2 A;  2C0T A;  1M8M A;  3VS2 A;  3QBY A;  3DB4 A;  3NTH A;  1Q86 R;  2EQU A;  2JMC A;  4M7A E;  3OYA A;  1KC8 U;  1VYV A;  2OAW A;  5G4S A;  3GG3 A;  1G3W A;  2M0Y A;  3EG1 A;  4MZM A;  2VV5 A;  4C5I A;  1GFC A;  2DIQ A;  2LNH B;  1B3Q A;  4GY5 A;  4HBW A;  4ALG A;  5J39 A;  1WXU A;  4LDW A;  1H92 A;  5D3L A;  3AT1 B;  4Y28 E;  3M9Q A;  3QJ6 A;  4A9O A;  5K29 A;  2EJN A;  2LCS A;  4UYH A;  5CQ4 A;  3MEW A;  1MMD A;  1XJW B;  4IR4 A;  2DX1 A;  1ZSG A;  3MO8 A;  2A37 A;  4M75 D;  1VQP A;  5EIS A;  3OYL A;  2L8D A;  3C4S A;  4M75 G;  2ZZD A;  3UV5 A;  2KVQ G;  4A4G A;  5L8T A;  2COZ A;  4F04 B;  3JB9 D;  4HCZ A;  4M75 B;  5A0G A;  1PKT A;  4YAX A;  3JB9 G;  2HNI A;  1WYX A;  2JS2 A;  3C12 A;  2CKK A;  2RPN A;  5IBN A;  2J6O A;  4ME7 A;  3EGU A;  1GXI E;  3G0L A;  2PTK A;  2R5M A;  4DEX A;  1W1F A;  1TUG B;  2QTV A;  5FE1 A;  3VS4 A;  4IIO A;  4JRI A;  5H85 A;  2FB7 A;  3LLR A;  3LQJ A;  4DBQ A;  5FWB A;  2EYQ A;  1D0Y A;  2XI9 A;  3EH2 A;  1S72 T;  1VQN Q;  1M2O A;  2L2P A;  3M5A A;  1PC0 A;  2YW5 A;  5A5R A;  1YIJ Q;  2DL4 A;  3SB2 A;  4JRQ A;  1KG1 A;  4C0D C;  1QVG S;  4GLM A;  5FWC A;  2D8H A;  2RF0 A;  5KE3 A;  5EV9 A;  5F63 A;  1WQ7 A;  2OUO A;  1NLO C;  2CP3 A;  2RI7 A;  3JCM c;  3EFO A;  2DF6 A;  4RTU A;  4J5Y A;  1OUL A;  4N4H A;  5KO4 A;  1X6G A;  5EWH A;  1KIK A;  4BUG A;  3JCM e;  3A5Z B;  5GJW B;  2OSS A;  2EIF A;  3LW5 E;  5DFC A;  2NLU A;  2X3X D;  1Q81 R;  2QI2 A;  1QVF S;  1ZLM A;  2NYS A;  1K0S A;  2E64 A;  1OPL A;  3PTA A;  5CO7 A;  5CQ3 A;  2KR3 A;  4D8K A;  3FKM X;  1M3C A;  4ZQL A;  4M77 F;  5A85 A;  3VUZ A;  5HY6 A;  3QZ5 B;  2JTF A;  3OYC A;  5CUA A;  2YEK A;  1X75 C;  3BFM A;  4XTV A;  5IAY A;  2M16 A;  4WHU A;  4CUQ A;  4QKU A;  4XU0 A;  4CRI A;  4YAT A;  3FB9 A;  1RAC B;  4Q0N A;  4A4F A;  3KBG A;  3V8J A;  4C8Q C;  4E47 A;  4PKL A;  2W0Z A;  2ZPB B;  4BW4 A;  1W70 A;  5DLQ E;  2D0N A;  2XDB A;  4HVU A;  5D3R A;  5ETB A;  3UV4 A;  2DBK A;  2FPF A;  4LYI A;  3HSB A;  2QXF A;  3V7C A;  1RI0 A;  4J3I A;  2F6J A;  2NUP A;  1YIJ A;  3H41 A;  3M0S A;  5FE7 A;  1QMC A;  5I2M A;  2LQN A;  1KQ2 A;  1E7O A;  1VYT A;  3UT1 A;  2DYI A;  3O8V A;  4ZNX A;  2CZ0 B;  2PNI A;  1N8R C;  4QR3 A;  5DLX A;  3CME Q;  2L3Q A;  1K9M C;  3DKM A;  3URG A;  4FYX B;  4RCC A;  3MPU B;  4PJN A;  2R0Y A;  3K2J A;  3ZFJ A;  2CZ6 B;  2JZ2 A;  2DXU A;  3EGX B;  4F7U A;  3O5Z A;  1TUC A;  1T0J A;  4PCE A;  2A3L A;  4RTT A;  2VGN A;  4XU2 A;  4IUT A;  4MR5 A;  4CFL A;  1WXB A;  4N4I A;  4IR5 A;  1VA7 A;  4DOV A;  1V1C A;  5KU3 A;  5I89 A;  1TH7 A;  3DLL A;  5EPS A;  3REB B;  1G2B A;  3JB9 F;  2MI6 A;  1VUB A;  4AG1 C;  4C0D B;  3P5O A;  5LJ3 j;  2EPD A;  2HBP A;  2YLB A;  5KE2 A;  3MET A;  8AT1 B;  4AKN A;  2DNU A;  2DAQ A;  1BIA A;  1N6A A;  2CYZ B;  4J6W A;  3GIB A;  1NJI U;  3M57 A;  2F1L A;  3V8K A;  5F36 A;  2O9V A;  5CQX A;  1U3O A;  3CCU Q;  2PU9 B;  4C8Q A;  2O88 A;  5L98 A;  2V8K A;  1P92 A;  1KD1 R;  1E6H A;  5GAN 6;  2XK0 A;  4TYL A;  3L2U A;  4GLK A;  3RDV A;  3CC7 Q;  4MDX A;  1WZO A;  2QG9 B;  5FRN A;  4O70 A;  2FL7 A;  2O2O A;  1U06 A;  5CR2 A;  2LT4 A;  4PJO C;  5AYF A;  5DYA A;  5LJ2 A;  3CBO A;  5C0M A;  1G5V A;  2G4A A;  4MDW A;  3S91 A;  5GJV B;  2NUT B;  4HBY A;  1M2V A;  3RES A;  3CME A;  2BIV A;  2OTJ A;  4X2I A;  1BCM A;  1BI3 A;  1VOM A;  4ZTF A;  3EAE A;  2RQU A;  3RKW A;  4KCX A;  5FH8 A;  1XOV A;  4M7D C;  1GCQ C;  3TCJ A;  4C8Q D;  3JCM f;  2AIR B;  3ER0 A;  5E9Y A;  2ZPH B;  4BI4 A;  5J26 A;  2YLC A;  2DO3 A;  3OYD A;  3ZEH A;  1ARK A;  1YJN T;  4TTE A;  2BZX A;  4CC4 B;  4FLP A;  4OMP A;  5LJ5 j;  4C8Q B;  1N5Z A;  2MF2 A;  2YUP A;  5KCO A;  3LJW A;  2EGA A;  4RVR A;  1F68 A;  5KCH A;  4EMG A;  5GAN 3;  3I3J A;  5EWV A;  1YWP A;  2VWF A;  3LWH A;  4ATO A;  4HXP A;  1YCY A;  1K1Z A;  2B8A A;  3LQI A;  1ZUY A;  5DFD A;  4L5G A;  5GMK h;  3INZ A;  4HA8 A;  1MUZ A;  3J7A F;  2DMO A;  2KAF A;  3EGD B;  5KYX A;  1ZUK A;  2KRN A;  1IRE B;  4UIX A;  3HRT A;  5D7U A;  4A9E A;  4EMK C;  5KYY A;  3H8Z A;  1M1G A;  4NRB A;  1N27 A;  4UYD A;  1QP3 A;  1K73 R;  3L42 A;  3TVT A;  3P1F A;  1FMK A;  3CCL Q;  2MMP A;  5ENF A;  4PJO A;  4KGZ B;  4QW2 A;  3VS3 A;  3EG2 A;  1IXD A;  4IR6 A;  1RAD B;  1N8R U;  4JJC A;  4HT9 A;  4HCC A;  1IGU A;  1RAI B;  1ZA1 B;  1FYN A;  4M7D A;  1GCQ A;  1LPL A;  2K7A A;  1VQ4 T;  4CC2 A;  1WJS A;  3IU6 A;  1YP5 A;  5LJ3 h;  3G71 Q;  3EG9 B;  5KYX B;  2RQW A;  4YYN A;  4QY4 A;  4QYL A;  2RHX A;  1OEB A;  5A0L A;  4O78 A;  1UGQ B;  4PFP A;  2KRM A;  4E7L A;  5CQT A;  3BY7 A;  3C95 A;  4KV4 A;  4PJO D;  2QK0 A;  5IGN A;  4PJO G;  1NM7 A;  2LP5 A;  4NR7 A;  5F60 A;  3RNJ A;  3T9N A;  5FE6 A;  2A08 A;  3O34 A;  1F1B B;  5FE4 A;  2XIC A;  4D6W A;  1VQM Q;  2G6F X;  1ZBJ A;  2DEU A;  2E10 A;  4PJO B;  3EFS A;  1Y0M A;  4TQN A;  3M0T A;  4M7D D;  1K76 A;  3E2U A;  1NE8 A;  4M7D G;  5GAN h;  2XHC A;  4X34 A;  3NMZ C;  5L8R E;  4X1V A;  4EMK A;  1M9S A;  4M7D B;  5E73 A;  5A5N A;  1YJW T;  2FYK A;  3OS0 A;  4E7J A;  4YBS A;  1PG5 B;  2KT8 A;  5CP5 A;  4J6X A;  2K6D A;  4J9F A;  3CXC A;  3X25 B;  4MML A;  4TS8 A;  5HK0 A;  3CCL A;  1H3Z A;  1WX6 A;  5LJ5 h;  1NYG A;  1O9S A;  2X9H A;  2CDT A;  1YBY A;  2CGH A;  5CQ7 A;  1JB0 E;  2GQV A;  3HFO A;  1TWB A;  3U5P A;  3QDR B;  3CC4 T;  5LKU A;  3S92 A;  4YC9 A;  4C8Q F;  3D1B A;  2L0A A;  3G71 A;  2V1R A;  2K2V A;  3HRU A;  3CCE T;  2COW A;  5E74 A;  4KBM B;  3MQM A;  3CCQ T;  4BE0 A;  2QQA A;  1XQH A;  2RK1 A;  3OYF A;  4CUU A;  5IXB A;  1ABO A;  3VS6 A;  2KY9 A;  5CUD A;  4FSX A;  1WDX A;  2EYY A;  5DM7 R;  1YI2 Q;  5CKH A;  5GAO l;  3RIR A;  4FYV B;  1MHN A;  3Q1J A;  5I1Q A;  3LXJ A;  1WHL A;  1JRI A;  4QQ6 A;  3CCS T;  1QW1 A;  1M30 A;  3OYE A;  1QVF P;  4NOY A;  5EPB A;  1ZQ1 A;  2Y90 A;  1HD3 A;  3VS0 A;  4JRK A;  1UGV A;  4JJB A;  3QZV A;  4PLI A;  1BIB A;  2R10 A;  3PFS A;  1M1K U;  1KC8 C;  5C4Q A;  5D7X A;  1JJ2 P;  3I5R A;  4A9J A;  3ZBD A;  2DER A;  2CS7 A;  5CQ6 A;  3V7S A;  5KTU A;  2FZC B;  5IGK A;  3EHR A;  4YAD A;  1EZZ B;  3D1D A;  4ALH A;  2XMF A;  4OF1 A;  4ZTJ A;  2BE7 D;  5II1 A;  1VQ6 T;  5D3P A;  4HVW A;  1VQ9 T;  4FT4 A;  4M77 C;  4A9K A;  3N5B B;  3R6N A;  4AFU C;  3DWY A;  3OYN A;  2F69 A;  1BI0 A;  5CU8 A;  2O4X A;  2L3R A;  2C0O A;  4NR4 A;  2ECZ A;  1QVG A;  5HQ7 A;  4YYK A;  1WHG A;  3GNF B;  2A36 A;  4QR5 A;  2FRY A;  2QEX T;  3MB4 A;  1IO6 A;  2KBT A;  1K4U S;  3CMA T;  1SG5 A;  3LGF A;  4C0Z A;  1K8A C;  5GAN 2;  3KUF A;  3IQL A;  1SHG A;  2D8J A;  5FU7 C;  4PJO F;  4A4E A;  2KSS A;  4KT0 E;  2ROL A;  2DKG A;  5D3S A;  4HXJ A;  5DKD A;  3UAT A;  4XY9 A;  5F1H A;  3OYB A;  3I55 T;  4IIM A;  3G1J A;  1VQ7 A;  1JO8 A;  2E5K A;  4F7U E;  4O74 A;  4XQ3 A;  4QC1 A;  4TVR A;  1KK7 A;  1J3T A;  4M7D F;  2FO0 A;  4OGC A;  5IG6 A;  2B86 A;  1LCK A;  3JAM E;  1D1B A;  3LH5 A;  2DRM A;  1ZA2 B;  2HD0 A;  4TT4 A;  4R56 A;  2X35 A;  5CUC A;  2L85 A;  4M75 C;  4MR6 A;  2F2W A;  1Q7Y U;  5LKT A;  4KV1 A;  1AZG B;  2K5L A;  1K9A A;  1XTD A;  2CZ7 B;  2GGR A;  3H9N A;  4FU6 A;  3MP6 A;  1YHQ A;  4AT1 B;  4O7E A;  5KYW A;  1UEB A;  2VXF A;  4Y92 A;  3UWN A;  1CKA A;  2HSP A;  2EKH A;  2RO0 A;  2SRC A;  4YYG A;  4LD9 K;  4M77 A;  1KJW A;  5L99 A;  1X2K A;  2KTB B;  2KXD A;  2RN8 A;  4NS5 A;  1M8V A;  1X0J A;  4EDU A;  1W6X A;  2JNG A;  1RLQ C;  2H3J A;  4C8Q E;  5DYU A;  2JJ9 A;  4CUS A;  5CKB A;  5HJC A;  3VKI A;  4OB2 B;  3CEY A;  2M9U A;  1QCF A;  4RTZ A;  4PKC C;  4FYY B;  3VV0 A;  2CP6 A;  5CTL A;  3M53 A;  3SVF A;  1WLP B;  1Y71 A;  4RKU E;  2M0O A;  4HT8 A;  3JCM P;  2M1H A;  1PD1 A;  4II1 A;  2HEQ A;  3CCJ Q;  4HKE A;  4NUD A;  2QAZ A;  2GFU A;  2Y4Y A;  3P8D A;  2CP5 A;  4LE9 A;  1VQO T;  4J7F A;  2MOX A;  1RL2 A;  3JCM d;  1AWW A;  2RO1 A;  1UB4 A;  4LZS A;  5GAM j;  3GP8 A;  2FEI A;  1IRX A;  4BD3 A;  5CFW A;  1MNE A;  1X6B A;  4UIZ A;  4Z93 A;  3QYH B;  3RBB B;  2LC4 A;  3OS5 A;  1OOT A;  2ZPG B;  4OGJ A;  4M75 A;  3JSC A;  5A7C A;  1AOJ A;  3RER A;  4WCI A;  1PHT A;  4XTU A;  3MUL A;  3EHQ A;  4ZW1 A;  5H1V A;  1I5L A;  4RMO A;  2MJV B;  3THK A;  1X27 A;  1Y7X A;  5FU7 B;  2EKO A;  1LVK A;  4JPB W;  4RTY A;  4ELY C;  3U5N A;  3OYH A;  4UIY A;  4GBQ A;  3REA B;  4WIV A;  4C66 A;  5IGM A;  2DIG A;  1N8R R;  3OYG A;  3CC2 A;  5LKZ A;  2CP2 A;  2LCL A;  1K9M R;  5FRM A;  1ZUU A;  2XU8 A;  5ENG A;  4Q0O A;  1IZ6 A;  1VQ5 Q;  5I7Y A;  4XTZ A;  3TU4 K;  2P4R A;  3OSV A;  4BJX A;  2EGC A;  1TS9 A;  1JM4 B;  4BW3 A;  1G3Y A;  4ZN3 A;  3CCM Q;  4PJO E;  2LZ6 B;  2QQR A;  3FDR A;  4O7C A;  3PMT A;  1K8A U;  1QWF A;  3CCJ A;  1M1F A;  1T3S A;  4FSS A;  1C0M A;  1W4S A;  1IB8 A;  2LJ0 A;  3HMH A;  2PVG B;  1SRL A;  4M7D E;  1NJI C;  4LXC A;  5IXF A;  3M55 A;  2GTO A;  3TSZ A;  1YIT Q;  1I81 A;  1VQK Q;  2F5K A;  4GPJ A;  3MB3 A;  2DIL A;  4FCY A;  2QGG A;  2WSE E;  1QP2 A;  1C6V X;  2JXB A;  4XAX B;  2DPP B;  3BE3 A;  5I86 A;  4MEP A;  1JQQ A;  1QQJ A;  4Z89 A;  5KHM A;  1KHC A;  1V76 A;  4MZT A;  3VYG A;  5HQ5 A;  4D8D A;  3G7Z A;  5LJ1 A;  4QSU A;  2EBP A;  1UUE A;  4DQ2 A;  3EG3 A;  2E12 A;  1SKU B;  3ULR B;  3P8H A;  5DFB A;  5LKX A;  1UDL A;  2JM9 A;  4KGV B;  2KDS A;  3GPL A;  5C8G A;  3G6E Q;  4X9C A;  4DOW A;  1G8X A;  1MGQ A;  2BZ8 A;  3LQH A;  4YY6 A;  3U5K A;  4HXS A;  4UYE A;  3BDU A;  3SVH A;  3M58 A;  4M78 A;  4JJD A;  3O33 A;  2LJ3 A;  4Y91 A;  1UTI A;  1VQ8 T;  1OQK A;  2OX7 A;  3RKY A;  3H0F A;  4YBT A;  1VQ5 A;  5H1U A;  4XU1 A;  3AHU A;  5LUU A;  5KYU B;  5CQ8 A;  5GAM h;  1KSW A;  4RCB A;  5FU6 C;  5ENE A;  4PTB A;  3CCM A;  4LC2 A;  1G3T A;  1RAH B;  2VKN A;  3UA6 A;  2E70 A;  2XDP A;  4ANJ A;  5KTW A;  4JZ4 A;  1YJ9 Q;  5FG6 A;  2HL5 C;  1YFN A;  2YRD A;  3OY9 A;  1JJ2 S;  1HK9 A;  3QYG B;  2DD4 A;  1WHK A;  1MND A;  4OB3 B;  3EGX A;  2FSA A;  3JCM J;  4IUP A;  4OP0 A;  2DBM A;  2XID A;  1YIT A;  4M78 D;  1VQK A;  1PKS A;  2KK4 A;  5CK9 A;  2EJ9 A;  2EYW A;  5HRX A;  4M78 G;  1W2B S;  2EQM A;  5A0D A;  3F70 A;  2DVR A;  4QVZ A;  4M78 B;  2MK5 A;  1VQN A;  4EIK A;  4UYF A;  3LYI A;  1TTH B;  1LJO A;  5GMK j;  2RQT A;  5IN1 A;  1BBZ A;  4PNO A;  1M90 U;  2AT1 B;  2WSC E;  4QUT A;  2Z0W A;  2RMO A;  1Q82 U;  3QDF A;  5HM0 A;  5E3D A;  1M3A A;  4KH0 B;  5I83 A;  1Y07 A;  3V7R A;  2QQS A;  4KUL A;  3G6E A;  4NR5 A;  3JVJ A;  2L3P A;  2NXB A;  5L96 A;  4BE1 A;  3NXB A;  2KI7 A;  1AHJ B;  2E6N A;  5EWW A;  2OJ2 A;  3I56 T;  2QA4 T;  3DAI A;  4QQG A;  4QB3 A;  1SEM A;  5LVQ A;  2R5A A;  4UIW A;  2RI2 A;  4M75 F;  1RLP C;  1NYF A;  3OBW A;  3NPF A;  4O6J A;  2K79 A;  5HK3 A;  2RHZ A;  2LNV A;  4UYF B;  4F3I A;  5AME A;  2KRO A;  3SFM A;  1VQ4 Q;  4C5E A;  2NUT A;  3TRE A;  1YJ9 A;  5F62 A;  1OX9 A;  1WHM A;  2HCK A;  5C6S A;  2ESW A;  4C92 D;  3QWX X;  3CCR Q;  4C92 G;  2MAM A;  2JS0 A;  3M0P A;  3QG1 A;  3VU3 C;  4ZGD B;  2DTH A;  3PNW C;  2J06 A;  3Q2E A;  1WUM A;  3CPW P;  4PJL A;  3GNG A;  4LUE A;  2VVK A;  4ZGE B;  2K9G A;  2E4H A;  4ZGJ B;  1WXT A;  8ATC B;  2CSI A;  4TU4 A;  5D0C A;  4C5H A;  2LTO A;  1G3S A;  2KNB B;  5HQ6 A;  5IHN A;  1I0C A;  2KT1 A;  4K11 A;  2R0S A;  2LMJ A;  2E1H A;  2JUF A;  4NUE A;  5FU6 B;  2DZC A;  2KXC A;  5LJ3 g;  2GRC A;  5A2Q E;  5GAN j;  1VQL T;  4QSP A;  1X69 A;  2DXB A;  4R55 A;  3EGD A;  1YJW Q;  1RUW A;  4IKF A;  5ENH A;  1HYO A;  1QKX A;  4QQD A;  4RG2 A;  1MV3 A;  2G3R A;  1E6G A;  4ORZ A;  4WF2 A;  2LX9 A;  4A9N A;  2K3B A;  5D6W A;  4XTY A;  4CC7 A;  3JVL A;  3HPW A;  3OS2 A;  1CSK A;  1UHF A;  4V2S A;  1R0C B;  4IUR A;  2CH4 W;  2V8I A;  5GAN 5;  1JXM A;  1ACM B;  3CCV T;  2XDD A;  2RS9 B;  3SDZ A;  2IVW A;  5GAN g;  4MEN A;  3G4S T;  3NTK A;  3VS1 A;  4M77 E;  1B34 B;  3E9G A;  2EQJ A;  2MPX C;  3EG0 A;  1IGQ A;  3PMI A;  4QZS A;  3HTR A;  5ENJ A;  3NFC A;  2GNC A;  4HBX A;  4A9M A;  1WFW A;  4YBM A;  5DYX A;  4QEU A;  3D7C A;  3CCQ Q;  3CCR A;  2V26 A;  4OMQ A;  5GAM e;  3EG9 A;  4XUA A;  5A5O A;  2I7K A;  4M78 F;  2H60 A;  1M1K C;  1TXQ A;  5LJ5 g;  2E65 A;  3CCU A;  4A9L A;  4QUU A;  4JUV A;  2DVQ A;  4LDY A;  5IH2 A;  5L8U A;  2X4X A;  1ZSZ B;  3OYJ A;  2E7N A;  4C5G A;  1TUD A;  4KH1 B;  3CCS Q;  5A83 A;  3CC7 A;  1YWO A;  1KC8 R;  1AZE A;  2O31 A;  2LX7 A;  4LYW A;  4QSV A;  2A28 A;  2L5Q A;  2DYB A;  4F16 A;  1Q86 U;  1D09 B;  4IOO A;  5F25 A;  2OTJ T;  1RI9 A;  2BKD N;  5I7X A;  1H3H A;  4M7A D;  5CKF A;  2X3W D;  5DLZ A;  2CT4 A;  4Z1Q A;  1UGS B;  4M7A G;  2YRV A;  1HXD A;  2PQW A;  2RI5 A;  4ZN1 A;  5CCA A;  2K3X A;  4M75 E;  4A4H A;  4M7A B;  1VQ6 Q;  1U5S A;  2RHU A;  3VUB A;  5GMK m;  1VQ9 Q;  3EH1 A;  7AT1 B;  4O7A A;  3A8G B;  4J6Y A;  2DXT A;  4AFS C;  5CUE A;  1KHI A;  5EIC A;  5F1L A;  2N9G A;  1GBQ A;  2KYB A;  1D0X A;  3O35 A;  2WSF E;  3I9Q A;  4N4F A;  1K8A R;  5CY9 A;  5CUB A;  5GAN 4;  4LYS A;  5DKC A;  3OYI A;  1KQS P;  2RJC A;  3J81 E;  4J9D A;  5EU1 A;  2YDL A;  1ABQ A;  2RH2 A;  2ZPI B;  3CMA Q;  4QSR A;  2VYT A;  1BI2 A;  2RFJ A;  3CBM A;  2ZPE B;  5DW1 A;  2PVD B;  5FG4 A;  5C87 A;  4OML A;  5J0D A;  4UIV A;  1Q7Y C;  3I55 Q;  5F3A A;  4FIB A;  2VAS A;  5LJ3 d;  4YYI A;  3HRS A;  2E7O A;  4QVD A;  1Z9Z A;  3LX7 A;  2D1X A;  5CKE A;  3RKX A;  4J9E A;  3L2V A;  2BUD A;  2H8H A;  3J80 E;  5CAI A;  3A8H B;  4LZR A;  4XTX A;  5D6Y A;  5E0R A;  3WXM B;  3HP9 A;  5A5S A;  1T0H A;  2CH4 A;  1IHV A;  1NEB A;  5AMF A;  4BI3 A;  5GAN d;  4LDF A;  1VQ9 A;  5GAO q;  2A0F B;  5AD3 A;  2HL3 A;  3DLM A;  3P8B B;  4A53 A;  4WTO B;  5ENB A;  5ETD A;  2HAX A;  4UYG A;  5F61 A;  1BYM A;  2DJZ A;  1AWO A;  2MCN A;  4JJN K;  1VQM A;  1Q81 U;  2COY A;  2F2X A;  2FVU A;  1UHC A;  4M78 E;  1B07 A;  5LJ5 d;  5EWC A;  5ENI A;  3M0U A;  2DET A;  4C67 A;  5EGU A;  1PSE A;  3OYK A;  1WPY A;  3NGP A;  1QLY A;  1UEC A;  2HQE A;  4YYM A;  2P84 A;  2X4Y A;  1VQO Q;  4OB1 B;  5FH6 A;  3P1E A;  2NUZ A;  5GMK e;  4J83 A;  4KUI A;  4B9X A;  2YYN A;  5D3T A;  2HQH A;  4WHW A;  5ECA A;  3QZS A;  1PRM C;  4JLI A;  4BW2 A;  2CZ1 B;  5DY9 A;  2FG0 A;  2HKN A;  1AWX A;  4YYJ A;  1EFN A;  2H3E B;  2RM4 A;  4PJM A;  1W2B P;  2CRE A;  3WVD B;  4C0F A;  3WVE B;  3L1A A;  2HMA A;  2DVJ A;  4Z6H A;  2K3Y A;  3C0C A;  4M7A F;  4VUB A;  3QZ9 B;  5FB1 A;  2Y4X A;  3SWN C;  5A5P A;  3GF5 A;  5D3H A;  1JU5 C;  5G4R A;  1IHW A;  2LQ8 A;  3L2Q A;  2MYS A;  4J9H A;  2RNW A;  2YUN A;  2FZG B;  1SRM A;  3L2R A;  1D3B B;  2YT6 A;  3PE0 A;  2PVO B;  1OU8 A;  2KGT A;  3RUX A;  1JXO A;  3CPW S;  3JCM W;  1I07 A;  4O5V A;  1LOJ A;  4A54 A;  2EYZ A;  1YI2 A;  5LJ3 e;  1GCP A;  2RJD A;  2RD1 A;  4TT6 A;  5EC7 A;  1OZ2 A;  2E3K A;  1QVF A;  3HHT B;  1OV3 A;  4J0S A;  3QPH A;  1I8F A;  3A8O B;  4OGE A;  2K2M A;  1NEG A;  2KRS A;  3UVW A;  2DL8 A;  1ZKR A;  1RAF B;  2ABL A;  1NJI R;  4MR3 A;  4NR9 A;  2YEL A;  4AKG A;  3I5S A;  3OW2 P;  3CD6 T;  6AT1 B;  2QGF B;  5GMK i;  2MWP A;  1JJ2 A;  5IID A;  4A9H A;  5EA1 A;  5EP7 A;  1WGS A;  3UVY A;  3JV3 A;  2GTJ A;  2YDW A;  2MIO A;  1X2Q A;  3OQ5 A;  4O76 A;  3VS5 A;  2E6Z A;  2R58 A;  1Z9Q A;  5KYN A;  1OYX A;  5E9L A;  2JW4 A;  5GAN e;  2X4J A;  3A98 A;  1BI1 A;  1KD1 U;  3QZT A;  4B6M A;  1D0Z A;  3OS1 A;  2OI3 A;  5DBM A;  3BDL A;  1S72 Q;  2WAC A;  2X51 A;  4BI8 B;  4PY6 A;  4HXM A;  4AFQ C;  1ZBX A;  1AT1 B;  3VJP A;  4LDU A;  5CQ5 A;  2EJF A;  1WHJ A;  5CUG A;  3X26 B;  3SWN A;  1JEG A;  4QSW A;  4QVC A;  3D7S B;  5DKH A;  4HVV A;  5TCM A;  5LJ5 e;  5D3J A;  1Q95 G;  5IGL A;  4NQN A;  2CSQ A;  3MP8 A;  3JCM Q;  3M59 A;  1JBM A;  5FFY A;  1RAG B;  5CGP A;  3TSW A;  5FBX A;  2LDM A;  2CUB A;  5A81 A;  1VQ8 Q;  3GOX A;  4CUR A;  5EG2 A;  3ASK A;  3JB9 I;  1VQ7 T;  1QWE A;  2YUO A;  3JRZ A;  4OMF B;  3OYY A;  2EVR A;  1CKB A;  4NYW A;  2O01 E;  3MEV A;  1UJY A;  4A63 B;  1M5Q 1;  4HXR A;  5TB6 A;  5CZG A;  2JM8 A;  5EPR A;  3LWI A;  3SWN B;  5GAO n;  1MV0 B;  1SHF A;  4R0K A;  2ZGW A;  2DA9 A;  2RB6 A;  3R6O A;  3L2W A;  5BT5 A;  1M90 C;  4QSS A;  5DX4 A;  2OTL T;  2HBW A;  4AKI A;  4J7I A;  3VYH B;  2DL7 A;  1YHQ T;  1N9R A;  5JWM A;  2AZS A;  1UG1 A;  1Q82 C;  2R0V A;  1H64 1;  2LJ1 A;  3SD4 A;  3BW1 A;  4TZ8 A;  5HRW A;  5E9I A;  4NL3 A;  1X01 A;  5IT9 E;  2HKQ B;  1OZ3 A;  2DZ9 A;  5GAM g;  1PUO A;  4YYD A;  5GAO p;  2JMA A;  4Z02 A;  1U8R A;  1S72 A;  5FRO A;  1K73 U;  5CKD A;  4CI0 C;  1G83 A;  2GF7 A;  1AWJ A;  5FE9 A;  3L2Z A;  4M78 C;  5JI8 A;  3H0I A;  5CPE A;  4RTX A;  3FRN A;  1KQS S;  5AD2 A;  1UGP B;  4KGX B;  4J0R A;  5ENC A;  2CP7 A;  3P1D A;  2K5I A;  2IG0 A;  4QNS A;  4RUG A;  3QKJ A;  3TEE A;  3O37 A;  3S6W A;  4NYX A;  1WUG A;  2ZAE A;  4YTL A;  4IUU A;  3RMQ A;  3DB3 A;  3U5J A;  2K5F A;  5LJ3 f;  2V8J A;  3EFR A;  2DRK A;  2D9E A;  3I56 Q;  5CRM A;  2QA4 Q;  2ENM A;  1VQ8 A;  2DE0 X;  5I80 A;  2PZ1 A;  3M0R A;  3QUI A;  5KH6 A;  5CQA A;  2L89 A;  1QCO A;  5I21 A;  3FLG A;  3OBY A;  4IOQ A;  1GFD A;  3PGG A;  4O77 A;  5KYU A;  2FZK B;  1U1T A;  2D0Q B;  4UIU A;  5I88 A;  1U1S A;  1VYU A;  1TU0 B;  5HEM A;  3VRY A;  4MMK A;  2KMT A;  5EQ1 A;  2DFU A;  4RTV A;  1WQW A;  4N0A A;  4PCI A;  4PFZ A;  3M56 A;  4A9I A;  5DLO A;  5GAN f;  2EJG A;  2BZY A;  2L3S A;  4Q5W A;  1KQ1 A;  1WHH A;  3KXT A;  3U5O A;  1FX7 A;  3CBP A;  1EIF A;  4E2F B;  4NUC A;  4O7F A;  4OVA A;  3QSU A;  1YCS B;  2CUD A;  4C92 C;  1UJ0 A;  1UGR B;  2GQI A;  3CC2 T;  2I0N A;  2QYZ A;  3X24 B;  4YH3 A;  4YY4 A;  4DBH A;  5A82 A;  1M3B A;  4AMC A;  5LJ5 f;  4UIT A;  4LZ2 A;  4QSQ A;  1VQL Q;  1VQP T;  2XG8 D;  5C7N A;  2LRQ A;  5HKC A;  2D9T A;  2DL3 A;  4UC4 A;  2LT1 A;  1HSQ A;  4NYV A;  4KRT A;  2DVS A;  3OB9 A;  3CCJ T;  3TLP A;  5M9O A;  3JB9 J;  4QSX A;  3I56 A;  2QA4 A;  1YJN Q;  4OB0 B;  1DJ7 B;  4AFZ C;  5HEN A;  4L59 A;  1NZ9 A;  3G0J A;  2VGM A;  3HFN A;  3CCV Q;  4BY6 C;  2C06 A;  5E9M A;  3G4S Q;  1OPK A;  1S1N A;  4HBV A;  1D1C A;  2J7I A;  4AI6 A;  5F2P A;  2ROT A;  3QHS A;  1HJD A;  4Y03 A;  2KE9 A;  1PM3 A;  1NPR A;  5FH7 A;  4YAB A;  1M1K R;  3S3O A;  4Z1S A;  4HXL A;  4EPC A;  2OO1 A;  4B9W A;  1YNZ A;  1JSP B;  5GAM d;  5HRV A;  1Q86 C;  5FE3 A;  3PT9 A;  2IIM A;  3X28 B;  3EFO B;  1SSF A;  2YWW A;  2M02 A;  5HFR A;  4C92 A;  2YSQ A;  2JTM A;  4NXJ A;  2PUK B;  4LD6 A;  2AHJ B;  1ZSZ C;  1FMV A;  4J9B A;  2C0I A;  1VQ5 T;  5ACY A;  2YHT A;  1VQL A;  1XNI A;  3SEM A;  2DLP A;  5LJ0 A;  5FE5 A;  2DTO A;  3U5M A;  2OTJ Q;  3HKS A;  3CCM T;  3HME A;  3RR6 A;  1FWZ A;  2LCC A;  5EM3 A;  3OW2 S;  1GL5 A;  4FT2 A;  5HCK A;  3OMG A;  9ATC B;  1LNX A;  1SPK A;  4J1P A;  1YJN A;  4NRA A;  4DBR A;  3VRZ A;  1OI1 A;  2JTE A;  3PVQ A;  3CCV A;  1YIT T;  1VQK T;  2AK5 A;  2EFI A;  3UF4 A;  4C92 B;  4M7A C;  3G4S A;  4QEV A;  1MMG A;  3FJP A;  4FM4 B;  5FW9 A;  2NUP B;  1UE9 A;  5FG5 A;  2DK3 A;  4F14 A;  2RJE A;  1VQN T;  2EWN A;  3CPF A;  4N4G A;  1B34 A;  3MEA A;  2BE9 B;  3ZL7 C;  1YIJ T;  2D6F A;  2J6F A;  3FC3 A;  2VB6 A;  5COI A;  4P5N A;  4F7U G;  1Q7Y R;  2F6N A;  4O71 A;  3UVX A;  3E1S A;  3MJX A;  4CUP A;  2YQD A;  3FEO A;  4F7U B;  2VXE A;  4NL2 A;  2DWW A;  3G6E T;  3E19 A;  2MWO A;  4MR4 A;  1RAE B;  4E6R A;  1D1A A;  1M4Z A;  1UFF A;  4BY6 B;  3GBQ A;  3ERR A;  1ZSZ A;  2J05 A;  5I22 A;  1X43 A;  4QBM A;  2SEM A;  5FFV A;  4QST A;  2O9S A;  2RNA A;  2DD5 A;  4RTW A;  1GBR A;  5GAN 7; 
#chains in the Genus database with same CATH homology
 5E7D A;  5EI4 A;  1N9S A;  1QVP A;  4E96 A;  1VQ4 A;  1YJ9 T;  1Q81 C;  4ELZ C;  5D6X A;  4C8Q G;  4NR8 A;  2GCX A;  4XU3 A;  4A4K A;  3RCW A;  2EQK A;  4O72 A;  4M7A A;  3CPW A;  3MXF A;  3RMS A;  2FHD A;  2LSP B;  2JOY A;  2I2L A;  5LL6 S;  5CVI A;  3O36 A;  5D25 A;  3M54 A;  3MUK A;  4YH4 A;  5H1T A;  4RG8 A;  3JVK A;  3M4Y A;  4N3W A;  3HMF A;  5FFW A;  3OA6 A;  3JCM X;  1YJW A;  3CME T;  5CIU A;  2QQB A;  5II2 A;  4LRG A;  1V29 B;  5I29 A;  3QO3 A;  2RHI A;  5GMK l;  2VC8 A;  2K57 A;  3JCM b;  2DXC A;  3SVG A;  1BKB A;  1Y96 A;  4IOR A;  2ZCF B;  1K9M U;  5HCL A;  3CC4 A;  4BDZ A;  2F5T X;  4BDY A;  4QYD A;  3LH0 A;  3P1C A;  1EQF A;  4PS5 A;  5GAN 8;  2XD0 A;  4C92 F;  3CCE A;  3CCR T;  3JB9 H;  3PIP A;  3CCQ A;  2L84 A;  3PIO A;  2GFA A;  3M4G A;  4LDV A;  3CCU T;  2LQK A;  1I4K 1;  2RNY A;  4QC3 A;  3CC7 T;  3CCS A;  4IR3 A;  3S3M A;  4F7U F;  1Y96 B;  3MP1 A;  5E9V A;  1KD1 C;  3A8L B;  4NQM A;  1NPP A;  5J3B A;  3AAD A;  3UV2 A;  1FXX A;  2QTX A;  5D26 A;  4E7I A;  2RNX A;  3UW9 A;  5FLX E;  2RJF A;  2RHY A;  2E5Q A;  5D3N A;  4JDS A;  5D24 A;  4DON A;  3U5L A;  3JCM V;  1VQ6 A;  1PSF A;  5LVR A;  5CRZ A;  4XTW A;  5DYC A;  4BB7 A;  2HQX A;  2LVM A;  2I8N A;  4HCB A;  1KQS A;  4TT2 A;  2QQ9 A;  4NR6 A;  1ZHI A;  5GAM f;  2QEX A;  5L97 A;  4BE2 A;  4EMK B;  3GLX A;  3OYM A;  3CMA A;  4KUD K;  1WNL A;  1VIF A;  4QEW A;  1X6O A;  2EAY A;  2VUB A;  2P0K A;  3NTI A;  2ZPF B;  5E9K A;  3E9F A;  4JLG A;  1D3B A;  5FB0 A;  4FL6 A;  2E41 A;  1WJR A;  4DA4 A;  2JVV A;  4L6V 5;  4PLL A;  3I55 A;  4OGI A;  5GAO m;  5FDZ A;  2R57 A;  5BT4 A;  3UDC A;  5FE0 A;  4YYH A;  4X9D A;  4E7K A;  3JCM g;  3CCL T;  2JN0 A;  3CD6 A;  4XYA A;  1K73 C;  4XK8 E;  3ME9 A;  5A5Q A;  4BAC A;  4YK0 A;  4IUV A;  1O75 A;  5KTX A;  2L5E A;  1VIE A;  4QR4 A;  4TZ2 A;  2DAT A;  4CLB A;  2K4Y A;  3G71 T;  3A8M B;  5E3G A;  5CS8 A;  4LR6 A;  5C85 A;  4O7B A;  4MZP A;  4O75 A;  2P0Q A;  3Q2F A;  3QXE B;  4OUF A;  2RI3 A;  3H6Z A;  3MHX A;  4HXK A;  1WJQ A;  2RA2 A;  4CL9 A;  4C92 E;  3ZYU A;  1VQM T;  4C0G A;  4JS5 A;  5EK9 A;  4JRP A;  5HEL A;  2OAU A;  2PUO B;  4XUB A;  2DEQ A;  5FE2 A;  2XKO C;  3JVM A;  5EWD A;  5I40 A;  3UVD A;  2WP1 A;  5HFQ A;  1VQO A;  3OSS C;  4LDX A;  5I2S A;  4XY8 A;  5CQY A;  3MEU A;  5F5Z A;  4HXN A;  1W2B A;  2O4X B;  5EVA A;  1ZS5 A;  4Z6I A;  4J8O A;  2DVV A;  4BW1 A;  5DY7 A;  2OTL A;  2DKW A;  2YEM A;  2P0P A;  4CFK A;  3JCM h;  5HLS A;  2WP2 A;  2DTI A;  5GAO r;  3UPU A;  1N72 A;  3FIF A;  4MEO A;  2D82 A;  4CUT A;  1R8O B;  2X4W A;  1YI2 T;  5C89 A;  2DVE A;  2A7Y A;  1E6I A;  3S3N A;  3QII A;  4E7H A;  3MCA B;  3QJY A;  3X20 B;  4IUQ A;  4JS4 A;  3LGL A;  3OMC A;  2P4T A;  3OW2 A;  4MEQ A;  4BHW A;  2QDY B;  4M77 D;  3C94 A;  3IU5 A;  5BT3 A;  4TU6 A;  3ONI A;  4M77 G;  4NRC A;  4HXO A;  4N0A C;  3AQA A;  4A9F A;  2KQW A;  4ZC9 A;  2RK2 A;  4M77 B;  4EMH A;  3CXC S;  3HL8 A;  5FE8 A;  3V8L A;  4PL6 A;  5DW2 A;  3QBY A;  3DB4 A;  3NTH A;  2EQU A;  4M7A E;  3OYA A;  1KC8 U;  5G4S A;  3GG3 A;  1G3W A;  4MZM A;  2VV5 A;  4C5I A;  2DIQ A;  4GY5 A;  4HBW A;  4ALG A;  5J39 A;  4LDW A;  5D3L A;  4Y28 E;  3M9Q A;  3QJ6 A;  4A9O A;  5K29 A;  4UYH A;  5CQ4 A;  3MEW A;  4IR4 A;  3MO8 A;  4M75 D;  1VQP A;  5EIS A;  3OYL A;  2L8D A;  3C4S A;  4M75 G;  2ZZD A;  3UV5 A;  2KVQ G;  4A4G A;  5L8T A;  3JB9 D;  4HCZ A;  4M75 B;  5A0G A;  4YAX A;  3JB9 G;  2HNI A;  3C12 A;  2CKK A;  5IBN A;  4ME7 A;  1GXI E;  3G0L A;  2R5M A;  5FE1 A;  4JRI A;  5H85 A;  2FB7 A;  3LLR A;  3LQJ A;  2EYQ A;  2XI9 A;  1S72 T;  3M5A A;  2YW5 A;  5A5R A;  3SB2 A;  4JRQ A;  1KG1 A;  4C0D C;  1QVG S;  5KE3 A;  5EV9 A;  5F63 A;  1WQ7 A;  2OUO A;  2RI7 A;  3JCM c;  4J5Y A;  4N4H A;  5KO4 A;  5EWH A;  4BUG A;  3JCM e;  3A5Z B;  2OSS A;  2EIF A;  3LW5 E;  5DFC A;  2NLU A;  2QI2 A;  1QVF S;  2E64 A;  3PTA A;  5CO7 A;  5CQ3 A;  3FKM X;  4ZQL A;  4M77 F;  5A85 A;  3VUZ A;  5HY6 A;  3QZ5 B;  2JTF A;  3OYC A;  5CUA A;  2YEK A;  1X75 C;  3BFM A;  4XTV A;  5IAY A;  2M16 A;  4WHU A;  4CUQ A;  4XU0 A;  4CRI A;  4YAT A;  3FB9 A;  4Q0N A;  4A4F A;  3KBG A;  3V8J A;  4C8Q C;  4E47 A;  4PKL A;  2ZPB B;  4BW4 A;  5DLQ E;  2XDB A;  5D3R A;  5ETB A;  3UV4 A;  4LYI A;  3HSB A;  2QXF A;  3V7C A;  1RI0 A;  4J3I A;  2F6J A;  1YIJ A;  5FE7 A;  5I2M A;  1KQ2 A;  3UT1 A;  3O8V A;  2CZ0 B;  1N8R C;  4QR3 A;  5DLX A;  1K9M C;  3DKM A;  3URG A;  4RCC A;  2R0Y A;  3K2J A;  3ZFJ A;  2CZ6 B;  2JZ2 A;  2DXU A;  4F7U A;  4PCE A;  2A3L A;  2VGN A;  4XU2 A;  4IUT A;  4MR5 A;  4CFL A;  4N4I A;  4IR5 A;  4DOV A;  5KU3 A;  5I89 A;  1TH7 A;  3DLL A;  5EPS A;  3JB9 F;  2MI6 A;  1VUB A;  4C0D B;  3P5O A;  5LJ3 j;  2HBP A;  2YLB A;  5KE2 A;  3MET A;  4AKN A;  2DAQ A;  1BIA A;  1N6A A;  2CYZ B;  4J6W A;  3GIB A;  1NJI U;  3M57 A;  3V8K A;  5F36 A;  5CQX A;  2PU9 B;  4C8Q A;  5L98 A;  2V8K A;  1P92 A;  5GAN 6;  2XK0 A;  4TYL A;  3L2U A;  4GLK A;  4MDX A;  5FRN A;  4O70 A;  2FL7 A;  5CR2 A;  2LT4 A;  4PJO C;  5AYF A;  5DYA A;  5LJ2 A;  3CBO A;  5C0M A;  1G5V A;  2G4A A;  4MDW A;  3S91 A;  4HBY A;  3RES A;  3CME A;  2BIV A;  2OTJ A;  4X2I A;  1BI3 A;  4ZTF A;  3EAE A;  3RKW A;  4KCX A;  5FH8 A;  1XOV A;  4M7D C;  3TCJ A;  4C8Q D;  3JCM f;  3ER0 A;  4BI4 A;  5E9Y A;  2ZPH B;  5J26 A;  2YLC A;  2DO3 A;  3OYD A;  3ZEH A;  1YJN T;  4TTE A;  4FLP A;  5LJ5 j;  4C8Q B;  2MF2 A;  5KCO A;  3LJW A;  4RVR A;  1F68 A;  5KCH A;  4EMG A;  5GAN 3;  3I3J A;  5EWV A;  3LWH A;  4ATO A;  4HXP A;  1YCY A;  2B8A A;  3LQI A;  5DFD A;  4L5G A;  5GMK h;  3INZ A;  4HA8 A;  3J7A F;  2KAF A;  1IRE B;  4UIX A;  3HRT A;  4EMK C;  4A9E A;  3H8Z A;  1M1G A;  4NRB A;  1N27 A;  4UYD A;  1QP3 A;  3L42 A;  3P1F A;  4PJO A;  2MMP A;  5ENF A;  4QW2 A;  4IR6 A;  1N8R U;  4HT9 A;  4HCC A;  4M7D A;  1VQ4 T;  1WJS A;  3IU6 A;  5LJ3 h;  4YYN A;  4QY4 A;  4QYL A;  2RHX A;  5A0L A;  4O78 A;  1UGQ B;  4E7L A;  5CQT A;  3BY7 A;  3C95 A;  4KV4 A;  4PJO D;  5IGN A;  4PJO G;  4NR7 A;  5F60 A;  3T9N A;  5FE6 A;  3O34 A;  4D6W A;  5FE4 A;  2XIC A;  4PJO B;  2E10 A;  3EFS A;  4TQN A;  4M7D D;  1NE8 A;  4M7D G;  5GAN h;  2XHC A;  4X34 A;  5L8R E;  4EMK A;  1M9S A;  4M7D B;  5E73 A;  5A5N A;  1YJW T;  2FYK A;  3OS0 A;  4E7J A;  4YBS A;  5CP5 A;  4J6X A;  3CXC A;  3X25 B;  4MML A;  4TS8 A;  5HK0 A;  3CCL A;  1H3Z A;  5LJ5 h;  1O9S A;  1YBY A;  2CGH A;  5CQ7 A;  1JB0 E;  2GQV A;  3HFO A;  3U5P A;  3QDR B;  3CC4 T;  5LKU A;  3S92 A;  4YC9 A;  4C8Q F;  3G71 A;  2K2V A;  3HRU A;  3CCE T;  5E74 A;  4KBM B;  3MQM A;  3CCQ T;  4BE0 A;  2QQA A;  1XQH A;  2RK1 A;  3OYF A;  4CUU A;  2KY9 A;  5CUD A;  4FSX A;  5DM7 R;  5CKH A;  5GAO l;  3RIR A;  1MHN A;  3Q1J A;  5I1Q A;  3LXJ A;  1JRI A;  4QQ6 A;  3CCS T;  1QW1 A;  3OYE A;  4NOY A;  5EPB A;  1ZQ1 A;  2Y90 A;  4JRK A;  3QZV A;  4PLI A;  1BIB A;  2R10 A;  3PFS A;  1M1K U;  1KC8 C;  5C4Q A;  5D7X A;  3ZBD A;  4A9J A;  2CS7 A;  5CQ6 A;  3V7S A;  5KTU A;  5IGK A;  4YAD A;  4ALH A;  4OF1 A;  4ZTJ A;  5II1 A;  1VQ6 T;  5D3P A;  1VQ9 T;  4FT4 A;  4M77 C;  4A9K A;  3N5B B;  3DWY A;  3OYN A;  2F69 A;  1BI0 A;  5CU8 A;  2O4X A;  2L3R A;  4NR4 A;  1QVG A;  5HQ7 A;  4YYK A;  3GNF B;  4QR5 A;  2QEX T;  3MB4 A;  3CMA T;  3LGF A;  4C0Z A;  1K8A C;  5GAN 2;  3KUF A;  5FU7 C;  4PJO F;  4A4E A;  2KSS A;  4KT0 E;  2DKG A;  5D3S A;  5DKD A;  4XY9 A;  5F1H A;  3OYB A;  3I55 T;  1VQ7 A;  4F7U E;  4O74 A;  4XQ3 A;  4QC1 A;  4TVR A;  4M7D F;  4OGC A;  5IG6 A;  3JAM E;  2HD0 A;  4TT4 A;  4R56 A;  2X35 A;  5CUC A;  2L85 A;  4M75 C;  4MR6 A;  1Q7Y U;  5LKT A;  4KV1 A;  2K5L A;  4FU6 A;  2CZ7 B;  1XTD A;  3MP6 A;  1YHQ A;  4O7E A;  1UEB A;  2VXF A;  3UWN A;  2RO0 A;  4YYG A;  4LD9 K;  4M77 A;  5L99 A;  2KTB B;  4NS5 A;  1M8V A;  1X0J A;  4EDU A;  2JNG A;  4C8Q E;  2H3J A;  5DYU A;  4CUS A;  5CKB A;  5HJC A;  3VKI A;  4OB2 B;  3CEY A;  2M9U A;  4PKC C;  3VV0 A;  5CTL A;  3M53 A;  3SVF A;  1Y71 A;  4RKU E;  2M0O A;  4HT8 A;  3JCM P;  2M1H A;  4II1 A;  4HKE A;  4NUD A;  2GFU A;  2Y4Y A;  3P8D A;  1VQO T;  4J7F A;  1RL2 A;  3JCM d;  2RO1 A;  1UB4 A;  4LZS A;  5GAM j;  3GP8 A;  4BD3 A;  5CFW A;  4UIZ A;  4Z93 A;  3QYH B;  2LC4 A;  3OS5 A;  2ZPG B;  4OGJ A;  4M75 A;  3JSC A;  5A7C A;  3RER A;  4XTU A;  3MUL A;  4ZW1 A;  5H1V A;  1I5L A;  4RMO A;  2MJV B;  1Y7X A;  5FU7 B;  2EKO A;  4ELY C;  3U5N A;  3OYH A;  4UIY A;  4WIV A;  4C66 A;  5IGM A;  2DIG A;  3OYG A;  3CC2 A;  5LKZ A;  2LCL A;  5FRM A;  2XU8 A;  5ENG A;  4Q0O A;  1IZ6 A;  5I7Y A;  4XTZ A;  3TU4 K;  3OSV A;  4BJX A;  1JM4 B;  4BW3 A;  1G3Y A;  4ZN3 A;  4PJO E;  2QQR A;  3FDR A;  4O7C A;  3PMT A;  1K8A U;  3CCJ A;  1M1F A;  1W4S A;  3HMH A;  2PVG B;  4M7D E;  1NJI C;  3M55 A;  1I81 A;  2F5K A;  4GPJ A;  3MB3 A;  2WSE E;  1QP2 A;  4XAX B;  2DPP B;  5I86 A;  4MEP A;  5KHM A;  1KHC A;  4MZT A;  3VYG A;  5HQ5 A;  3G7Z A;  5LJ1 A;  4QSU A;  4DQ2 A;  2E12 A;  3P8H A;  5DFB A;  5LKX A;  2KDS A;  3GPL A;  5C8G A;  4X9C A;  4DOW A;  1MGQ A;  3LQH A;  4YY6 A;  3U5K A;  4HXS A;  4UYE A;  3BDU A;  3SVH A;  3M58 A;  4M78 A;  3O33 A;  4Y91 A;  1VQ8 T;  3RKY A;  4YBT A;  1VQ5 A;  5H1U A;  4XU1 A;  3AHU A;  5LUU A;  5CQ8 A;  5GAM h;  4RCB A;  5FU6 C;  5ENE A;  4PTB A;  3CCM A;  4LC2 A;  1G3T A;  2XDP A;  2E70 A;  5KTW A;  5FG6 A;  3OY9 A;  1JJ2 S;  1HK9 A;  3QYG B;  2DD4 A;  4OB3 B;  2FSA A;  3JCM J;  4IUP A;  4OP0 A;  2XID A;  1YIT A;  4M78 D;  1VQK A;  2KK4 A;  5CK9 A;  2EJ9 A;  5HRX A;  4M78 G;  1W2B S;  2EQM A;  5A0D A;  3F70 A;  2DVR A;  4QVZ A;  4M78 B;  1VQN A;  4UYF A;  3LYI A;  1LJO A;  5GMK j;  5IN1 A;  1M90 U;  4PNO A;  2WSC E;  4QUT A;  1Q82 U;  5HM0 A;  5E3D A;  5I83 A;  1Y07 A;  3V7R A;  2QQS A;  4KUL A;  3G6E A;  4NR5 A;  3JVJ A;  4BE1 A;  2NXB A;  5L96 A;  3NXB A;  1AHJ B;  2E6N A;  5EWW A;  3I56 T;  2QA4 T;  3DAI A;  4QQG A;  4QB3 A;  5LVQ A;  2R5A A;  4UIW A;  2RI2 A;  4M75 F;  3OBW A;  4O6J A;  5HK3 A;  2RHZ A;  2LNV A;  4UYF B;  4F3I A;  5AME A;  3SFM A;  4C5E A;  3TRE A;  1YJ9 A;  5F62 A;  5C6S A;  4C92 D;  4C92 G;  2MAM A;  3VU3 C;  3QG1 A;  4ZGD B;  2DTH A;  3PNW C;  3Q2E A;  1WUM A;  3GNG A;  4ZGE B;  4ZGJ B;  4TU4 A;  5D0C A;  4C5H A;  2LTO A;  1G3S A;  5HQ6 A;  2R0S A;  2E1H A;  2JUF A;  4NUE A;  5FU6 B;  2DZC A;  5LJ3 g;  2GRC A;  5A2Q E;  5GAN j;  1VQL T;  4QSP A;  2DXB A;  4R55 A;  4IKF A;  5ENH A;  4QQD A;  4RG2 A;  2G3R A;  4WF2 A;  2LX9 A;  4A9N A;  5D6W A;  4XTY A;  3JVL A;  3HPW A;  3OS2 A;  4V2S A;  4IUR A;  2V8I A;  5GAN 5;  3CCV T;  2XDD A;  2RS9 B;  3SDZ A;  2IVW A;  5GAN g;  4MEN A;  3G4S T;  3NTK A;  4M77 E;  1B34 B;  3E9G A;  2EQJ A;  3PMI A;  4QZS A;  3NFC A;  5ENJ A;  4HBX A;  4A9M A;  4YBM A;  5DYX A;  4QEU A;  3D7C A;  3CCR A;  5GAM e;  4XUA A;  5A5O A;  2I7K A;  4M78 F;  2H60 A;  1M1K C;  5LJ5 g;  2E65 A;  3CCU A;  4A9L A;  4QUU A;  4JUV A;  2DVQ A;  4LDY A;  5L8U A;  2X4X A;  3OYJ A;  2E7N A;  4C5G A;  5A83 A;  3CC7 A;  4LYW A;  4QSV A;  2L5Q A;  1Q86 U;  4IOO A;  5F25 A;  2OTJ T;  2BKD N;  5I7X A;  4M7A D;  5CKF A;  5DLZ A;  4Z1Q A;  1UGS B;  4M7A G;  2YRV A;  1HXD A;  2PQW A;  2RI5 A;  4ZN1 A;  5CCA A;  2K3X A;  4M75 E;  4A4H A;  4M7A B;  2RHU A;  3VUB A;  5GMK m;  4O7A A;  3A8G B;  4J6Y A;  2DXT A;  5CUE A;  1KHI A;  5EIC A;  5F1L A;  2N9G A;  3O35 A;  2WSF E;  4N4F A;  5CY9 A;  5CUB A;  5GAN 4;  4LYS A;  5DKC A;  3OYI A;  2RJC A;  3J81 E;  5EU1 A;  2RH2 A;  2ZPI B;  4QSR A;  2VYT A;  1BI2 A;  2RFJ A;  3CBM A;  2ZPE B;  5DW1 A;  2PVD B;  5FG4 A;  5C87 A;  5J0D A;  4UIV A;  1Q7Y C;  5F3A A;  4FIB A;  5LJ3 d;  4YYI A;  3HRS A;  2E7O A;  4QVD A;  5CKE A;  3LX7 A;  3RKX A;  3L2V A;  2BUD A;  3J80 E;  5CAI A;  3A8H B;  4LZR A;  4XTX A;  5D6Y A;  5E0R A;  3WXM B;  3HP9 A;  5A5S A;  5AMF A;  4BI3 A;  5GAN d;  4LDF A;  1VQ9 A;  5GAO q;  5AD3 A;  3DLM A;  3P8B B;  4A53 A;  5ENB A;  5ETD A;  2HAX A;  4UYG A;  5F61 A;  1BYM A;  2DJZ A;  4JJN K;  1VQM A;  1Q81 U;  2FVU A;  4M78 E;  5LJ5 d;  5EWC A;  5ENI A;  4C67 A;  5EGU A;  1PSE A;  3OYK A;  1WPY A;  2HQE A;  4YYM A;  2X4Y A;  4OB1 B;  5FH6 A;  3P1E A;  5GMK e;  4J83 A;  4KUI A;  4B9X A;  2YYN A;  5D3T A;  4WHW A;  3QZS A;  4JLI A;  4BW2 A;  2CZ1 B;  5DY9 A;  4YYJ A;  2RM4 A;  3WVD B;  4C0F A;  3WVE B;  3L1A A;  4Z6H A;  2K3Y A;  4M7A F;  4VUB A;  3QZ9 B;  5FB1 A;  2Y4X A;  3SWN C;  5A5P A;  3GF5 A;  5D3H A;  5G4R A;  2LQ8 A;  3L2Q A;  2RNW A;  3L2R A;  1D3B B;  2PVO B;  3RUX A;  3CPW S;  3JCM W;  4O5V A;  1LOJ A;  4A54 A;  1YI2 A;  5LJ3 e;  2RJD A;  2RD1 A;  4TT6 A;  1OZ2 A;  2E3K A;  1QVF A;  3HHT B;  4J0S A;  3QPH A;  1I8F A;  3A8O B;  4OGE A;  3UVW A;  4MR3 A;  4NR9 A;  2YEL A;  3CD6 T;  5GMK i;  2MWP A;  1JJ2 A;  5IID A;  4A9H A;  5EA1 A;  5EP7 A;  1WGS A;  3UVY A;  2YDW A;  3OQ5 A;  4O76 A;  2E6Z A;  2R58 A;  1OYX A;  5E9L A;  5GAN e;  2X4J A;  1BI1 A;  1KD1 U;  3QZT A;  3OS1 A;  5DBM A;  3BDL A;  2WAC A;  4BI8 B;  4PY6 A;  4HXM A;  1ZBX A;  3VJP A;  4LDU A;  5CQ5 A;  2EJF A;  5CUG A;  3X26 B;  3SWN A;  4QSW A;  4QVC A;  5DKH A;  5TCM A;  5LJ5 e;  5D3J A;  5IGL A;  4NQN A;  3MP8 A;  3JCM Q;  3M59 A;  1JBM A;  5FFY A;  5CGP A;  5FBX A;  2LDM A;  5A81 A;  3GOX A;  4CUR A;  5EG2 A;  3ASK A;  3JB9 I;  1VQ7 T;  3JRZ A;  4OMF B;  3OYY A;  4NYW A;  2O01 E;  3MEV A;  1M5Q 1;  4HXR A;  5TB6 A;  5CZG A;  5EPR A;  3LWI A;  3SWN B;  5GAO n;  2ZGW A;  2RB6 A;  3R6O A;  3L2W A;  5BT5 A;  1M90 C;  4QSS A;  5DX4 A;  2OTL T;  4J7I A;  3VYH B;  1YHQ T;  1N9R A;  5JWM A;  1Q82 C;  2R0V A;  1H64 1;  3SD4 A;  3BW1 A;  4TZ8 A;  5HRW A;  5E9I A;  4NL3 A;  1X01 A;  5IT9 E;  1OZ3 A;  2DZ9 A;  5GAM g;  4YYD A;  5GAO p;  4Z02 A;  1U8R A;  1S72 A;  5FRO A;  1K73 U;  5CKD A;  4CI0 C;  2GF7 A;  5FE9 A;  3L2Z A;  4M78 C;  5JI8 A;  5CPE A;  3FRN A;  1KQS S;  5AD2 A;  1UGP B;  4J0R A;  5ENC A;  3P1D A;  2K5I A;  2IG0 A;  4QNS A;  3QKJ A;  3TEE A;  3O37 A;  3S6W A;  4NYX A;  1WUG A;  4YTL A;  3RMQ A;  4IUU A;  3DB3 A;  3U5J A;  2K5F A;  5LJ3 f;  2V8J A;  3EFR A;  2D9E A;  5CRM A;  1VQ8 A;  5I80 A;  3QUI A;  5KH6 A;  5CQA A;  2L89 A;  5I21 A;  3FLG A;  3OBY A;  4IOQ A;  3PGG A;  4O77 A;  1U1T A;  4UIU A;  5I88 A;  1U1S A;  2D0Q B;  5HEM A;  4MMK A;  2KMT A;  5EQ1 A;  1WQW A;  4N0A A;  4PCI A;  3M56 A;  4A9I A;  5DLO A;  5GAN f;  2EJG A;  4Q5W A;  1KQ1 A;  3KXT A;  3U5O A;  1FX7 A;  3CBP A;  1EIF A;  4NUC A;  4O7F A;  4OVA A;  3QSU A;  4C92 C;  1UGR B;  3CC2 T;  3X24 B;  4YH3 A;  4YY4 A;  5A82 A;  5LJ5 f;  4UIT A;  4LZ2 A;  4QSQ A;  1VQP T;  2XG8 D;  5C7N A;  2LRQ A;  5HKC A;  2D9T A;  4UC4 A;  2LT1 A;  4NYV A;  2DVS A;  3OB9 A;  3CCJ T;  3TLP A;  5M9O A;  3JB9 J;  4QSX A;  3I56 A;  2QA4 A;  4OB0 B;  1DJ7 B;  5HEN A;  4L59 A;  1NZ9 A;  3G0J A;  2VGM A;  3HFN A;  4BY6 C;  2C06 A;  5E9M A;  4HBV A;  5F2P A;  3QHS A;  4Y03 A;  1NPR A;  5FH7 A;  4YAB A;  3S3O A;  4Z1S A;  4HXL A;  4EPC A;  2OO1 A;  4B9W A;  1JSP B;  5GAM d;  5HRV A;  1Q86 C;  5FE3 A;  3PT9 A;  3X28 B;  1SSF A;  5HFR A;  4C92 A;  2JTM A;  4NXJ A;  2PUK B;  4LD6 A;  2AHJ B;  1VQ5 T;  5ACY A;  2YHT A;  1VQL A;  1XNI A;  5LJ0 A;  5FE5 A;  2DTO A;  3U5M A;  3HKS A;  3CCM T;  3HME A;  1FWZ A;  2LCC A;  5EM3 A;  3OW2 S;  4FT2 A;  3OMG A;  1LNX A;  4J1P A;  1YJN A;  4NRA A;  1OI1 A;  3CCV A;  1YIT T;  1VQK T;  2EFI A;  4M7A C;  4C92 B;  3G4S A;  4QEV A;  3FJP A;  4FM4 B;  5FG5 A;  2DK3 A;  2RJE A;  1VQN T;  2EWN A;  3CPF A;  4N4G A;  1B34 A;  3MEA A;  1YIJ T;  2D6F A;  3FC3 A;  5COI A;  4P5N A;  4F7U G;  2F6N A;  4O71 A;  3UVX A;  3E1S A;  4CUP A;  2YQD A;  3FEO A;  4F7U B;  2VXE A;  4NL2 A;  2DWW A;  3G6E T;  3E19 A;  2MWO A;  4MR4 A;  1M4Z A;  4BY6 B;  4QBM A;  5FFV A;  4QST A;  2DD5 A;  5GAN 7; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...