4N4GA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
209
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 63
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4gA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4gA02
4UYFA 3KUFA 5I29A 2LRQA 4A9NA 4XUAA 2H60A 3U5JA 5CS8A 5IN1A 4FU6A 2F6JA 5H1VA 5D3PA 5IG6A 3ZYUA 5FE2A 3MP8A 4B9XA 5EICA 4RVRA 5DYCA 5CIUA 5F60A 4O7EA 4NYXA 5EI4A 5ENBA 1WUMA 5CTLA 5FE1A 2YEKA 4GPJA 4TU6A 5KHMA 4CUPA 4MEOA 5I7XA 4Q0OA 5L99A 3OB9A 3P8DA 3OYIA 5FFVA 4N3WA 2E7OA 5A5RA 5A5NA 4A9LA 4O7FA 4UYEA 4WHWA 2X4WA 2G4AA 3FEOA 4CL9A 3G0JA 3AADA 4A9HA 4J0SA 5E3DA 4YYJA 2RHZA 2L89A 5LKUA 4YATA 4QR5A 4C66A 5L8UA 5JI8A 5F61A 2I8NA 5D26A 5ENGA 4QEWA 3E9FA 5FG6A 2RJEA 4NUCA 3P1DA 5EV9A 5FG4A 5CQAA 5KE2A 2CKKA 4LZ2A 4OUFA 5M9OA 3O37A 5HRVA 5EPSA 5ACYA 4UIWA 4N4IA 5HRXA 2RNYA 5FDZA 3UVXA 5KTXA 4MR6A 4TT4A 2L84A 5F63A 5C8GA 3Q1JA 4BE2A 3JVMA 5E9VA 5D3LA 5FRMA 4QSSA 4CUTA 4LR6A 2BUDA 5IBNA 5HRWA 5KTWA 5C87A 5KCHA 5D0CA 5HEMA 1WJSA 4A4EA 5LJ2A 4YYDA 5HJCA 5AMFA 3U5NA 4YBTA 1XNIA 5AMEA 2EQUA 2EQKA 3LGLA 4LD6A 3SD4A 4E96A 3O33A 1X0JA 5CY9A 3SVGA 3OYHA 4O76A 4X34A 5ENFA 5LKXA 4TZ8A 4QW2A 5C0MA 3OYMA 4NR9A 2YQDA 3PMIA 5EWDA 5CFWA 3IU6A 4Q5WA 4QC3A 4UIUA 3UW9A 5D6WA 4BE1A 5I88A 5EGUA 3HMHA 5CP5A 2EQMA 4TT6A 5EA1A 5DYXA 4BW1A 2RI2A 4ZQLA 3MP6A 3O35A 3UV4A 5L8TA 5D3SA 3FC3A 5CQ6A 4O71A 2IG0A 5A83A 2RFJA 3ONIA 4UIXA 5E7DA 5EP7A 4NRBA 2NLUA 2QQSA 4J3IA 4O7AA 4QNSA 4YYMA 3LQIA 5G4RA 3NTIA 2OO1A 3MXFA 2R5AA 3ASKA 2MWPA 3OS0A 4N4FA 3MEWA 3S3NA 5H1TA 5CZGA 4HBVA 4CRIA 4FL6A 4IOQA 3LH0A 4NQMA 4LDFA 4QSWA 2WACA 2B8AA 3LLRA 2RNWA 5L97A 4HBWA 1OZ3A 5D7XA 4A9MA 5A81A 3OYEA 3OQ5A 5EVAA 3P5OA 4RG2A 5IAYA 4YAXA 4A9FA 4E7IA 4PLIA 4NYVA 5CU8A 4HBYA 4UC4A 5DW2A 4FLPA 4IUQA 4NRCA 2RHIA 3ZEHA 4AKNA 3JVLA 4BDZA 2YYNA 3O34A 4QY4A 5CPEA 4Z93A 3LQHA 3L2QA 5KH6A 5C4QA 1EQFA 3LXJA 2EFIA 2EKOA 5H85A 5I80A 2M16A 3HMEA 5LKZA 3QZVA 4XUBA 4E7JA 4LZSA 3OS1A 5DFBA 3L2RA 3FKMX 5FB0A 4ZC9A 3UV5A 4HXMA 5DY7A 5AD3A 4QEUA 5HQ5A 4QSQA 3LQJA 2R5MA 4QQ6A 5DX4A 3L2WA 4J1PA 5IGKA 4C67A 5E3GA 2D82A 4NS5A 4GY5A 4QVZA 4HXRA 5DKHA 2DIGA 3U5LA 4PKLA 5ENEA 2RO1A 4MR5A 4CUUA 1JM4B 3OYNA 5EWVA 5I83A 2RS9B 4ALGA 2RJDA 4QUTA 3DB4A 5HFQA 3UVYA 4A9JA 5LUUA 4NRAA 4BW4A 4UIVA 5CRZA 3D7CA 4OGIA 4QSTA 4NR8A 3UV2A 2RI7A 4A9IA 5EK9A 2DIQA 1G5VA 4LYIA 2R0SA 4LC2A 1E6IA 1N72A 5CUAA 5F62A 4NR6A 2GF7A 4O78A 4O77A 3P1CA 1WJRA 2RJFA 3OYDA 5EPBA 5A82A 4IR6A 5EU1A 5HLSA 2QQRA 3Q2FA 5LVRA 2G3RA 5D3TA 4A4HA 4IR5A 5FRNA 1N27A 3L2VA 5TCMA 4QSRA 2D9EA 5CUDA 4J0RA 2R58A 5DKCA 4QBMA 2WP1A 3QJ6A 3OYJA 4YYGA 3LX7A 3C4SA 3JVKA 4EDUA 4HXSA 4YY4A 3OYKA 5FB1A 5DW1A 5FFYA 5HENA 1JSPB 3MP1A 5COIA 5CUCA 3S92A 3H8ZA 4B9WA 4TQNA 5CUEA 4Q0NA 5J0DA 3F70A 4CFLA 5F5ZA 5D3RA 5CQTA 5A7CA 3S6WA 5LKTA 5C85A 5LJ1A 4Z1SA 4A4GA 5FE4A 3M9QA 5IGLA 4YK0A 3MQMA 5HFRA 4UYFB 4CLBA 4II1A 2RJCA 4YYKA 5FE0A 2HQXA 3PNWC 5ENJA 5C7NA 2YEMA 4XY9A 4CUSA 5KTUA 5A5QA 4QQDA 4LRGA 2F5KA 3Q2EA 4XY8A 4BDYA 3FLGA 4UYDA 2E7NA 3ME9A 4UYHA 5CUGA 2EQJA 4WHUA 5CQ5A 5FH8A 3SVHA 5DFDA 4NR5A 4YYHA 5F2PA 5EWWA 5F1LA 4X2IA 3MO8A 4UIZA 4YABA 4LZRA 5AD2A 3IU5A 4ZTFA 5KU3A 4TTEA 2LDMA 4L59A 4O75A 4TT2A 5F36A 3HMFA 2R57A 2X35A 5FH6A 3P8HA 2NXBA 4BHWA 2PQWA 2BKDN 5E9LA 5I7YA 5EWHA 3UT1A 1WUGA 5BT3A 3UWNA 1H3ZA 4A9OA 4HBXA 3U5MA 2DVVA 3OYFA 5D25A 3OYAA 4HXPA 4MEPA 4PL6A 5IGMA 2LCCA 2GRCA 2X4XA 5F25A 4IR3A 4BD3A 3S91A 5FE7A 3L42A 5KE3A 4C5EA 4BW2A 3NXBA 4NR7A 3O8VA 3PMTA 2LTOA 4PCEA 2GFAA 3EAEA 2M1HA 3PFSA 4O70A 2RO0A 3H6ZA 4YBMA 2YELA 3RCWA 4QEVA 5I40A 4QQGA 4YBSA 2RI3A 2GFUA 5C89A 2DKWA 2F6NA 5IGNA 2E6NA 5G4SA 4E7HA 3S3OA 2FHDA 4TU4A 4BJXA 5E73A 5HQ7A 4A9EA 3NTKA 5EWCA 3OMGA 4ALHA 2N9GA 2HQEA 3UVDA 4YADA 4KCXA 1KHCA 1OZ2A 2RHXA 2O4XB 4HXNA 5FE3A 2JTFA 2DWWA 5TB6A 3K2JA 3S3MA 2L85A 3TLPA 5BT4A 3QBYA 4MENA 4HXLA 2I7KA 4IR4A 4E7LA 2LSPB 4O74A 3AQAA 4QSPA 5D3HA 5CRMA 5FFWA 4QYDA 3MB4A 4LYWA 3P1FA 4QC1A 4QZSA 1WGSA 4PLLA 2RHUA 4QB3A 5FE8A 5F3AA 3O36A 2RHYA 4MR4A 3OS2A 4Z1QA 3META 5EM3A 5DFCA 3I3JA 4PY6A 3E9GA 5D24A 2K3XA 2L3RA 5A5SA 5HQ6A 1ZS5A 4YYIA 5L96A 5FE5A 5HCLA 3OYBA 4O72A 4QSUA 2FSAA 2E5QA 2YDWA 5CGPA 4QSVA 4KV4A 4N4HA 4HXOA 4Z6IA 1WJQA 4NYWA 2L5EA 5ENCA 5II2A 5DLZA 4IUPA 2R0YA 3LGFA 4NUDA 4WIVA 5D3JA 4YY6A 3U5KA 2VYTA 3BDLA 1OYXA 3OYLA 5LJ0A 3NTHA 4QR3A 5I1QA 3OY9A 2M0OA 4BACA 4UYGA 3U5OA 5HELA 4HXKA 5CQ4A 4QYLA 5DKDA 4CURA 5A5PA 4BE0A 4TZ2A 2YRVA 5K29A 5LVQA 5IIDA 5CUBA 2LVMA 3DLMA 4PS5A 4BW3A 4UIYA 2RNXA 4OGJA 3MUKA 4MR3A 4NUEA 4QSXA 2XK0A 4TYLA 4ZTJA 3DWYA 3UVWA 1MHNA 4IURA 5FROA 3OYCA 2JZ2A 2YW5A 2MWOA 3DB3A 3OYGA 4YC9A 5JWMA 4IOOA 5D3NA 5ETDA 5KCOA 3QIIA 5ENHA 5J26A 5CQ3A 3MULA 4YH3A 2WP2A 5EPRA 2R10A 2MJVB 5E9YA 2O4XA 5H1UA 3MEAA 5E74A 5D6YA 4QR4A 4YYNA 5CQ8A 5HM0A 4QUUA 2OUOA 3MEVA 3P1EA 2DVQA 4NR4A 5FH7A 5E9IA 5II1A 5FBXA 4N4GA 2KTBB 5CQ7A 4ZW1A 5BT5A 4IUTA 3G0LA 5E9MA 4C5GA 4CUQA 4E7KA 3CEYA 5DLXA 5FG5A 4IUUA 3LYIA 5EISA 2P0KA 2X4YA 3QZSA 5FE9A 3SVFA 5J39A 4NQNA 3DAIA 5ENIA 4Z6HA 3GOXA 4HCZA 3L2UA 5DYAA 4A4FA 4PTBA 3MEUA 2OSSA 2R0VA 4MEQA 1RI0A 5C6SA 3OA6A 2E3KA 2XDPA 3OMCA 4O7CA 3GG3A 5F1HA 1OI1A 2K3YA 4TS8A 2DATA 4C5IA 4IKFA 2D9TA 5EQ1A 2BIVA 4LYSA 3QKJA 4XYAA 4OVAA 4A9KA 4Y03A 3FDRA 4KV1A 3JVJA 5L98A 4DONA 4C5HA 5FE6A 2DVSA 3U5PA 1F68A 5D6XA 2DVRA 4CFKA 4PCIA 1SSFA 4YH4A 4NXJA 4IORA 4UITA 3QZTA 5I89A 2DAQA 3LJWA 5ETBA 5E9KA 3MB3A 5I86A 5A85A 5KO4A 4F3IA 5DBMA 2L8DA 4O7BA 2RI5A 4Z02A 5E0RA 5DYUA 5A5OA 4IUVA
chains in the Genus database with same CATH superfamily
1JJ2P 2CZ1B 5I29A 1AZGB 4XUAA 3U5JA 4D8DA 1JQQA 3SB2A 1VQ8T 5H1VA 5IG6A 1SF9A 3OW2P 2GNCA 5F60A 4O7EA 2KI7A 1N8RR 5FE1A 3CCST 4TU6A 2QGGA 1R0CB 1G3TA 3G6ET 4N3WA 2E7OA 4OMQA 1VQNQ 4CL9A 3JV3A 4LDUA 3PIOA 1PD1A 4J0SA 4YYJA 3CCLT 2L89A 3JCMJ 5LKUA 4QR5A 4C66A 1YWOA 3UA6A 5JI8A 1WDXA 5F61A 2QAZA 3EGXB 4OB0B 1YJWT 3E1SA 4QEWA 1AWJA 3E9FA 2RJEA 4MDWA 1VYTA 3MKDA 5CQAA 2LCLA 3WVEB 5KE2A 2VKNA 3GPLA 1WHKA 3EH1A 4M75F 1VQ4Q 2SRCA 5KTXA 2K6DA 5LJ3f 4BE2A 2LX9A 3QYGB 3JVMA 2OI3A 1Z9ZA 1VQKT 1KFZA 5FRMA 2KEAA 4OMFB 2EJGA 5IBNA 4NOYA 1PNJA 5HRWA 1QVGP 5KCHA 4KRTA 2HCKA 1FXXA 3C95A 3RESA 1D09B 3CCEQ 1Y7XA 1XNIA 3CMAA 3TSZA 5AMEA 1H641 1VQLT 3SD4A 3CCRQ 1VQ9Q 3CCJA 1UB4A 1SRLA 4J9EA 1T0JA 5LKXA 1G3SA 3N5BB 4TZ8A 5LJ5g 2OTJA 1W2BP 2VC8A 5EWDA 5CFWA 2FPEA 4OMOA 2COYA 4QC3A 4YTLA 1FMKA 4M75D 4E2FB 4F14A 1X2QA 5EA1A 4BW1A 2RI2A 3FC3A 4XU1A 1UGVA 4ME7A 4GLKA 4JRQA 1YWPA 4NRBA 3HHTB 3LQIA 5G4RA 1SHGA 3CCQT 2R5AA 2MWPA 1JJ2S 1NJIU 1M1KU 1VQOT 7AT1B 4BI4A 4IOQA 4LDFA 4QSWA 2DMOA 1UUEA 2LP5A 2B8AA 4HBWA 3OW2S 1OZ3A 3MPUB 2K79A 3OQ5A 3OSVA 4L6V5 3RKYA 2ED0A 2NUZA 5IAYA 4E7IA 4A9FA 4PLIA 5CU8A 2A36A 4HBYA 3M0TA 4UC4A 1UFFA 5DW2A 4FLPA 4NRCA 1EIFA 3ZEHA 3JVLA 1YITQ 5CPEA 3L2QA 1VQPT 4C8QG 4ESRA 4C8QE 2EFIA 5H85A 3VRZA 4AG2C 1UECA 5D7UA 4EMKA 4RCBA 5CQXA 5FB0A 4ZC9A 5DY7A 4C0DB 5HQ5A 1M5Q1 1AWOA 4J1PA 4KGVB 4C67A 4HCKA 4LE9A 4NS5A 4XU3A 2EYZA 2ZPHB 4P5NA 2DRKA 4QVZA 2AHJB 2K5FA 2ED1A 1VQ7T 1JM4B 2SEMA 5EWVA 2RS9B 3UVYA 3CXCA 4EIKA 3ZL7C 2QA4T 1QVGS 4OGIA 4QSTA 2JTEA 4C8QA 2DIQA 1G5VA 2FVUA 4KULA 2KSSA 1G3YA 4PJLA 4OB1B 4LDYA 2CZ6B 2RJFA 1S72A 5EPBA 2DRMA 1M1FA 2E6ZA 4IR5A 1UGRB 5FRNA 3H41A 5TCMA 5KYWB 1W2BS 1M3BA 1D3BB 4YYGA 2DM1A 3C4SA 4YY4A 5FB1A 2JNGA 3QWYA 5DW1A 4FT4A 4DBQA 2DA9A 1RABB 3H8ZA 4XTVA 4FYXB 3HPWA 1CKAA 3ER0A 5GANh 1TUDA 4CFLA 4HVUA 2V26A 1U5SA 5D3RA 5CQTA 5A7CA 5CCAA 1YJNQ 1WHMA 5GAOp 5C85A 1YFNA 5LJ1A 1K0XA 3M9QA 5IGLA 3E2UA 4UYFB 2YLCA 3ZFJA 1YNZA 3M57A 5FE0A 3OSSC 5IHNA 2CP7A 2LZ6B 1PG5B 2W10A 5KYUB 4QQDA 4LRGA 1FWZA 3VS6A 4M7AC 2K2VA 4BY6C 4KGZB 3GP8A 3CC7A 3TREA 4KBMB 2GCXA 4UIZA 2V8IA 4A54A 1GXIE 4TTEA 1K1ZA 2KT1A 3TSWA 5HK3A 2R57A 1XQHA 2CGHA 4BI3A 4Z89A 4CC2A 1QP3A 2CP3A 2DD5A 3G1JA 3M4GA 3RMSA 1A0NB 1Q81R 5LJ3d 3EGXA 2CT3A 4J9DA 3OYFA 2LQKA 5D25A 1U3OA 2LT4A 2OTLA 2CP5A 3HL8A 1RAIB 4C0FA 4EMGA 1KHIA 3S91A 1AHJB 1PSFA 2E70A 4C5EA 4BW2A 4PK4A 3PMTA 1ZBXA 4PCEA 2M02A 5CKFA 2GFAA 3EAEA 4O70A 3H0HA 4RTUA 2YELA 3RCWA 1JXOA 4FYWB 4QQGA 4HA8A 3KFVA 1ZHIA 2RI3A 2DKWA 4OGEA 1WPYA 3RDVA 5EWCA 2LQNA 5GAN5 3OMGA 4PKCC 4JLGA 4YADA 4LNPA 1OZ2A 1QWFA 1GBQA 4HXNA 5FE3A 5TB6A 1NE8A 3UATA 3CXCP 5BT4A 2EJ9A 3A98A 2I7KA 2LSPB 1HXDA 2Y90A 2CH4W 2GQIA 5CRMA 2YUQA 4Z8AA 1Y96A 3CC4Q 2QQ9A 2YXYA 4A4KA 4QZSA 1M90R 4D6WA 1OQKA 2KDSA 1YHQT 1Q7YR 9ATCB 5F3AA 1R0BG 5CQYA 1M90U 4C92B 2RHYA 5GAOm 1D0XA 4MR4A 1ZQ1A 4F7UB 5DFCA 2CSIA 1I0CA 2K3XA 2O9VA 4ZNXA 3X26B 4YYIA 5GAN4 1UE9A 2GBQA 4BI8B 3VU3C 2BZYA 1AZEA 2JS0A 2CSQA 4HXOA 1WJQA 2FZKB 3FB9A 4OF1A 2L5EA 5II2A 4ZN3A 2R0YA 3LGFA 4NUDA 4WIVA 3OBWA 4Y28E 3CCVQ 1WHHA 3JB9I 2JTMA 3OYLA 2JN0A 1YIJT 2JM8A 2L3SA 1VQMT 1VQ6A 2OAWA 2PNIA 3A5ZB 4UYGA 3NMZC 4OB2B 2C0IA 4QYLA 5DKDA 1AOJA 4BE0A 4TZ2A 2YRVA 2KK4A 3HTRA 1K8AR 1I5LA 3DLMA 4WTOB 2RNXA 3MUKA 4MR3A 2XK0A 3UVWA 3JRZA 4PJOF 2JZ2A 1BI1A 1RADB 2MWOA 3OYGA 3JCMf 5KCOA 4JJDA 5J26A 4JZ3A 1Y71A 5GAN3 5EPRA 5E9YA 4QVCA 4HT8A 4J9GA 1HJDA 5E74A 2QEXT 4YYNA 1G8XA 5HM0A 5HKCA 2DVQA 3H9NA 1PHTA 5FBXA 1M30A 4AFZC 1I07A 3G71Q 1NYGA 2EWNA 3TVTA 3QUIA 1I5OB 3JB9J 2X4YA 3SVFA 3DAIA 5CR2A 1YJ9T 3CCMQ 1ZA2B 3AT1B 4JRKA 4JUVA 1KC8U 3M0SA 5DYAA 3L2UA 3MEUA 1ACMB 3TQ7P 4MEQA 2K5LA 1KD1R 2E3KA 2XDPA 4PJOD 1YN8A 3CXCS 1UGPB 4M7DF 2D9TA 2BIVA 2HMAA 1D3BA 2DE0X 4Y03A 5DLOA 3EG9B 4KV1A 5GAMg 5L98A 1K4US 1B07A 4M4ZA 5D6XA 2DVRA 2WSCE 4CFKA 1OEBA 2COWA 2ZPBB 4YH4A 2XDBA 3P8BB 3RUXA 2PUKB 1VQNA 4N0AA 1HSQA 5I86A 2P84A 4DBHA 2E1HA 4AG1C 1BKBA 4Z02A 2I2LA 1AWXA 4E7HA 4UYFA 2HKQB 2LRQA 4A9NA 1MNDA 2H60A 2LNVA 1KC8C 4O6JA 5IN1A 3CC2T 4OP0A 2QDYB 1WZOA 3I55T 4M77B 5KYUA 5D3PA 3ZYUA 3MP8A 2JXBA 4EPCA 1YCSB 1X69A 4M7DD 1VQ4A 4NYXA 1BI0A 1I1JA 4GPJA 2LMJA 1RAEB 3GF5A 4MEOA 1BU1A 4Q0OA 5L99A 2O01E 1KQSA 5A5NA 4A9LA 4O7FA 1KG1A 4UYEA 2KT8A 1MGQA 2G4AA 2LNHB 5HY6A 3G0JA 2CP2A 2LCSA 1KK7A 2AK5A 2RHZA 4KUIA 3QHSA 1FMVA 3CCEA 5ENGA 1FYNA 2DZ9A 5FG6A 4ATOA 2RNAA 3P1DA 5EV9A 1NG2A 2CKKA 3CCRA 3VUBA 4LZ2A 1VQ9A 4VUBA 2WSFE 5EPSA 4UIWA 4N4IA 2PZ1A 5FDZA 4DOWA 2ZAEA 5F63A 4M78B 2MPXC 2FZCB 4FCYA 2EYXA 3HRUA 1M2OA 1TUGB 1I4K1 2E5KA 5C87A 2PTKA 2Z0WA 5HEMA 1WJSA 4X1VA 2CT4A 4C92G 4C92E 3OBYA 1B34B 2DXUA 4YBTA 1G2BA 1YP5A 4AKIA 4E96A 5CY9A 1X0JA 4ZN1A 3OYHA 3EHQA 1PWTA 2JMCA 4QW2A 5C0MA 4NR9A 2YQDA 2RM4A 3PMIA 2VASA 1Q86R 2XD0A 2RN8A 3CD6Q 3HMHA 2FRYA 1LVKA 3O35A 5L8TA 5D3SA 2IG0A 4LDXA 4C92A 3ONIA 1GCPA 4F7UA 1YITA 4QNSA 3MCAB 4XTZA 4ELZC 3J7AF 1ARKA 3MXFA 4N4FA 2BE9B 5LJ3h 5CZGA 4HBVA 4CRIA 3LH0A 1U1TA 3JCMP 5L97A 2RMOA 2IIMA 2J6OA 5GJVB 5AYFA 1YI2Q 1MNEA 1VOMA 3CMAT 2XDDA 3P5OA 4RG2A 5GANg 2MMPA 3CCJT 4IUQA 2DK3A 4FIBA 4AKNA 4HKEA 1D0YA 4DBFA 3I56Q 4IIMA 3O34A 3JCMd 2OTJT 4Z93A 1TXQA 2KYMA 4MMLA 5C4QA 3BE3A 3HMEA 4XUBA 1NM7A 5DFBA 2NWMA 3OS1A 3L2RA 5DLQE 2RQUA 4PJMA 3KBGA 3L2WA 4JZ4A 5IGKA 2RPNA 5HK0A 3GNGA 4HVVA 2DIGA 1X27A 2V8JA 3O5ZA 5I83A 3DB4A 2RJDA 4FW1A 5HFQA 5KYXA 2J05A 5LUUA 4NRAA 4JDSA 4UIVA 5CRZA 2DTHA 1QP2A 2RI7A 1WQWA 5EK9A 2HBWA 2RA2A 4LC2A 2PU9B 1YJNA 5A0LA 4FT2A 2KRMA 2QQBA 1N72A 1UHCA 5I11A 3OYDA 2DL5A 4C8QF 4IR6A 2EBPA 5HLSA 1RUWA 1IHWA 3FIFA 5LVRA 2F1LA 1N27A 3HFNA 2L5QA 3CBOA 2V8KA 2D9EA 4L5GA 4J0RA 1WHJA 2DXTA 3LX7A 1KIKA 3JVKA 4HXSA 4M77G 4M77E 2X3XD 5FFYA 1HD3A 5COIA 1DJ7B 5CUCA 3EG9A 3A1PA 3M0QA 4LD9K 1TOVA 2EIFA 4TQNA 4Q0NA 3F70A 1O75A 2EW3A 2GTOA 5F5ZA 4J9HA 1OU8A 3JSCA 1M2VB 1WXBA 5LKTA 1SEMA 2KR3A 4Z88A 4Z1SA 3MQMA 2RJCA 4YYKA 1HYOA 1EX4A 4LUDA 1X6OA 1N8RC 4Y92A 2DPPB 1UJYA 5C7NA 3QZ5B 4CUSA 1Y96B 3G4SQ 5A5QA 4C8QD 5A0DA 4M77A 4UYDA 2DL3A 3ME9A 3BY7A 4AKHA 4WHUA 5FH8A 5GMKe 3SVHA 4NR5A 2LQ8A 1IGUA 1S72T 4J9IA 4LZRA 2LC4A 3HRTA 2D6FA 2OAUA 4M78G 1M8MA 4M78E 4ZTFA 5I2MA 2LDMA 4L59A 4TT2A 1NJIR 1M1KR 3HMFA 1NPPA 2X9HA 2YWWA 1CSKA 2NXBA 4BHWA 5CKBA 4J7FA 5EWHA 3UWNA 4J7IA 1W6XA 2DLPA 1VQ5Q 2RQRA 1Q82C 3I5RA 1WYXA 3RMQA 2LCCA 4J6YA 1WXTA 5F25A 3R6OA 5LJ3j 4IR3A 4BD3A 5FE7A 3CMEQ 1ZUYA 5KE3A 3RERA 2A3LA 2GTJA 1QW1A 2OJ2A 5CKHA 2C06A 1VYVA 1GL5A 4M78A 3CC4A 3HFOA 1P92A 4QEVA 4JJBA 2KY9A 1PSEA 3D7SB 2E6NA 2LX7A 5G4SA 4HCBA 1F1BB 1QCNA 5HCKA 5E73A 5HQ7A 2EAYA 4WF2A 3NTKA 3CC7T 2N9GA 2HQEA 1B34A 3BDUA 5GAMf 4KCXA 3KXTA 2DWWA 1ZX6A 3QJYA 3VV0A 1AWWA 3QBYA 3A8GB 4MENA 4B6MA 2K9GA 4C0ZA 2DF6A 2JUFA 3CCVA 4KH0B 1NYFA 4ELYC 4QC1A 1TTHB 3ULRB 2OTLT 4QB3A 5FE8A 3HKSA 2MI6A 3JB9G 1RLQC 3QG1A 4F04B 1N9RA 2YRDA 3META 4J5YA 2KNBB 3E9GA 5D24A 2L3RA 5HQ6A 5CVIA 2HQHA 5L96A 2F5TX 2CH4A 2DO3A 1K0SA 1VIEA 2E5QA 4KV4A 4Z6IA 5GMKm 4NYWA 4AKGA 5DLZA 4FM4B 4XK8E 4ZGJB 2VYTA 4LXCA 1W4SA 5ECAA 3CPFA 1OOTA 3OY9A 1M4ZA 2QDLA 5HELA 4CC3A 4HXKA 8AT1B 4CURA 2DILA 1VUBA 1S1NA 5IIDA 5CUBA 1C6VX 2CUBA 1CKBA 1U06A 4UIYA 3G71A 2QG9B 4FSSA 4ZTJA 2J06A 2BZ8A 4TYLA 4DA4A 3DWYA 4PJJA 3PIPA 4IURA 2D0QB 1BIBA 3OYCA 1BCOA 2YW5A 3CCMA 3DB3A 3CCUQ 1LPLA 3V8LA 2EGCA 2AKKA 2RD1A 5ETDA 4Y91A 2FRWA 5IH2A 3X28B 4JRIA 2MOXA 3MULA 4YH3A 2R10A 1LOJA 4E6RA 4R56A 2XICA 5FU7C 2OUOA 3MEVA 4NR4A 1D1CA 3TCJA 2M9UA 5FH7A 5E9IA 3DLLA 4HXJA 5AT1B 2KTBB 3AHUA 2K7AA 3M5AA 4C5GA 4E7KA 1RAGB 2ATCB 2EJFA 4M7AB 5LJ3e 4BY6B 2L3QA 3LYIA 1KQ2A 4NQNA 4HCZA 3JB9H 4OMMA 1VQ6T 3I35A 4A4FA 4PTBA 2R0VA 3OMCA 3GG3A 4PJOC 2FB7A 5F1HA 1SHFA 3VS2A 4TS8A 4LYSA 1PD0A 3RR6A 1I81A 4OVAA 5GAOl 3EHRA 3NHNA 3X20B 4C5HA 3U5PA 5I21A 1QMCA 4PFZA 2FZGB 2QASA 1VQ8Q 2K57A 3JCMh 2EGAA 5ETBA 3EG3A 3MB3A 5A85A 1M2VA 2RQVA 1PUOA 1UJ0A 4XTXA 3CCSQ 4ZGDB 3G7ZA 2RI5A 3G6EQ 1BI2A 5E0RA 2F2XA 2EJNA 1ABOA 3VS0A 5A5OA 3KUFA 3D1DA 3M4YA 3V7CA 5GANf 5FW9A 2FG0A 4FU6A 3CCLQ 1YCYA 5FE2A 5EICA 4RVRA 2DBKA 1YJWQ 5ENBA 2NUPA 1WUMA 4M7DC 5CTLA 6AT1B 2YEKA 5KHMA 3M55A 2DJZA 3OB9A 4WHWA 2X4WA 3FEOA 4E7ZA 3QZ9B 1K9AA 3AADA 4A9HA 3C94A 1Q81C 5E3DA 2E64A 2JVVA 3EFRA 5D26A 1VQKQ 3PVLA 2CZ7B 2FYKA 4AMCA 3GBQA 3GNFB 4FYVB 4KUDK 5KYNA 4DQ2A 1VQNT 5GAOr 3QSUA 2RNYA 5IT9E 3UVXA 4MR6A 4TT4A 2L84A 1ZUUA 5C8GA 1MMGA 3UA7A 1VQLQ 3J80E 3CD6A 5E9VA 5D3LA 4CUTA 4DOVA 4LR6A 4RG8A 5GAMd 2BUDA 2NUTA 1E6GA 5KTWA 2DJQA 5D0CA 1X6GA 1ZSZC 3EH2A 4A4EA 1QKWA 3U5NA 1VQ4T 4XU0A 5I22A 2AZSA 3UF4A 1C1AA 2EQKA 2EQUA 3LGLA 4LD6A 3NPFA 4GLMA 2H3JA 3LH5A 2CZ0B 4X34A 2RF0A 3M58A 2DYIA 1TS9A 3OYMA 1Q7YC 5KYXB 3CCQQ 4Q5WA 4UIUA 3PTAA 4DEXA 3CCET 1OPKA 1VQOQ 5EGUA 5CP5A 5GMKh 1YI2A 4TT6A 2ZCFB 1KQ1A 3MP6A 3CCRT 5CQ6A 4O71A 2WSEE 5LJ5f 1ZLMA 1VQ9T 1KC8R 2RFJA 1MMNA 5EP7A 3I56A 2MIOA 4J3IA 3RBBB 4YYMA 5DM7R 4DBRA 2V1QA 2OO1A 1NEGA 3ASKA 4C92F 3MEWA 3S3NA 1QVFA 5H1TA 1BI3A 3EGUA 4FL6A 3ERRA 1G3WA 2LJ0A 1VQPQ 2MYSA 3LLRA 4MMKA 5D7XA 2FPFA 3HRSA 2DXBA 3OYEA 2F2VA 1TH7A 1D1BA 2CP6A 1X6BA 2VUBA 1M1GA 2BE7D 2E12A 4DEYA 1LNXA 2RHIA 4BDZA 2YYNA 4QY4A 2DL4A 4QT7A 3BFMA 3LQHA 3BW1A 3QDFA 5KH6A 3PVQA 2EKOA 1VQ7Q 4M7AG 5I80A 4M7AE 4E7JA 4LZSA 1ABQA 3FKMX 1H8KA 1E7OA 1WIEA 4HXMA 4QEUA 2QA4Q 2VGMA 3SFMA 4QSQA 2R5MA 2YSQA 5DX4A 4C92D 1SRMA 3LW5E 5E3GA 2P4RA 1YITT 4HXRA 2FO0A 5GAN6 3U5LA 4PKLA 5ENEA 3OYNA 2KRNA 2A28A 3QYHB 4ALGA 2VB6A 4QUTA 4A9JA 4BW4A 3SWNC 3VS4A 2DYBA 1SPKA 3UV2A 1KD1C 4NR8A 1IXDA 4M7AA 2R0SA 2H8HA 3VUZA 5F62A 5CUAA 1Y07A 1XJWB 2GF7A 2GGRA 4O78A 4O77A 3OW2A 1WJRA 1XOVA 5A82A 5EU1A 2QQRA 3Q2FA 3L1AA 5D3TA 2DNUA 3L2VA 2R58A 2FL7A 2KGTA 4RTYA 3QJ6A 4QBMA 3G4SA 1IO6A 2CDTA 1PRLC 4EDUA 4JS5A 4HT9A 4J6XA 1JSPB 3MP1A 3TEEA 1MMAA 3GLXA 3V8KA 4EMKC 2CREA 2A7YA 5CKDA 3PGGA 5J0DA 2CUDA 4F7UG 4F7UE 1X2KA 2XI9A 2L0AA 4F16A 5GANd 4JS4A 4PJOA 2ROLA 3VKIA 5FE4A 1PC0A 2J7IA 4YK0A 5HFRA 4CLBA 4X9DA 4E47A 4HCCA 2QQAA 4GBQA 2HQXA 1VQ5A 2YUPA 5FU6C 5ENJA 5KTUA 1LJOA 3Q2EA 2A0FB 1IGQA 4C8QC 4BDYA 4M75C 1YJNT 2DVJA 2QXFA 3A8LB 2KBTA 3CMEA 1WHLA 1B3QA 5DFDA 5F1LA 1YBYA 5F2PA 5EWWA 3M59A 3JCMb 4X2IA 3FJPA 2YLBA 4YABA 2DFUA 5AD2A 1KSWA 4M77F 1QVFP 2HNIA 1BYMA 5GMKj 2E4HA 5F36A 2E65A 1X01A 2Y4XA 3U23A 2BKDN 4F17A 1K73C 5E9LA 5I7YA 1C0MA 3UT1A 1WUGA 3LWIA 1JO8A 1W2BA 3MJXA 4A9OA 4M75B 4HBXA 3U5MA 2DVVA 2K5IA 3QO3A 3OYAA 2FPDA 4HXPA 4MEPA 2K4YA 4M7DA 4PL6A 5IGMA 4NR7A 4RMOA 1PKTA 2CP0A 3JCMe 2DBMA 2M1HA 2RO0A 4FSXA 4YBMA 4X9CA 2DD4A 2XIDA 1ZKRA 4FYYB 4YBSA 4J8OA 2BTTA 1K9MU 3FRNA 1Y57A 2D8JA 2F6NA 5IGNA 4M77D 4M78F 4TU4A 3CPWA 1GCQC 5GMKi 1KQSP 1YHQQ 1Q86C 2ZPEB 1QLYA 4J83A 3LWHA 2DEUA 1D0ZA 4RUGA 3S3MA 2L85A 5LJ5e 4WCIA 1BB9A 5LJ5d 4IR4A 2VWFA 4O74A 3AQAA 1ZSZA 1QCFA 5IHKA 3MB4A 4LYWA 1IRXA 2ESWA 4AFUC 3P1FA 1WGSA 2RHUA 1PKSA 1LCKA 3M0UA 3OS2A 4Z1QA 3T9NA 3JCMQ 3VYHB 1MUZA 1N8RU 4ZGEB 5LL6S 3C12A 1YIJQ 1EZZB 4MDXA 1K9MC 1ZS5A 5FE5A 5HCLA 1VQMQ 4M78D 4O72A 2X3WD 3A8OB 4JRPA 1GFCA 2FSAA 3CC4T 2EPDA 4QSVA 1V1CA 3R6NA 1UDLA 2EGEA 3CCUA 2EQIA 4IUPA 3DKMA 3FJ5A 5D3JA 2DEQA 2AT1B 1OYXA 5LJ0A 1N5ZA 3NTHA 4QR3A 3TU4K 1RLPC 1Q82R 4BACA 1QVFS 1Q82U 1WI7A 3JCMg 5GAMh 1T3LA 4AFSC 1PRMC 2HL3A 2L3PA 4BW3A 4NUEA 4QSXA 3MHXA 2QEXQ 5FWCA 3CCVT 3JB9F 3CBPA 2DVEA 1NLOC 1W1FA 3HSBA 4YC9A 2HDAA 1IREB 2KXCA 5JWMA 2NUPB 4IOOA 5D3NA 1M3AA 4HVWA 1JU5C 3QIIA 1YJ9Q 1K76A 2RB6A 2WP2A 2O4XA 2D1XA 5L23A 5H1UA 3MEAA 5D6YA 5CQ8A 3JCMX 2JW4A 4N4GA 2EVRA 5BT5A 3PE0A 5E9MA 4IUTA 1VQ8A 2DX1A 5DLXA 5FG5A 2P0QA 2VXEA 4IUUA 2P0KA 1UGQB 2M0YA 4PNOA 5J39A 4Z6HA 3GOXA 3V7SA 4KH1B 1KQSS 3CCSA 3G6EA 5C6SA 3JB9D 1O9SA 1WX6A 2K3BA 2YT6A 1GRIA 4KT0E 1M8VA 1OI1A 2K3YA 2DATA 4C5IA 4IKFA 4J9CA 3CBMA 2YUOA 3CCLA 5FLXE 3G71T 3SWNA 4A9KA 2DL8A 3OS5A 2ZPFB 2NUTB 3A8HB 3FDRA 3CPWP 3JVJA 1MV0B 1QCOA 4DONA 1D1AA 1NLPC 1YJWA 2DVSA 4OGCA 2W0ZA 3CCMT 1TU0B 2ZPIB 3CC2Q 2HKNA 3VS1A 4PCIA 2KROA 3I55Q 1SSFA 2JOYA 4R0KA 4NXJA 4AFQC 4C0DC 4V2SA 1UG1A 4UITA 2DAQA 5I2SA 3CQTA 3LJWA 1OULA 2MK5A 5E9KA 2O31A 5GMKl 4F3IA 4O7BA 4NL3A 5DYUA 1NBEB 4J9BA 4M75G 1VQKA 1BK2A 4M75E 4J6WA 1V76A 5CS8A 1RACB 4XTYA 3EG1A 1J3TA 2F6JA 2FEIA 4B9XA 4BB7A 5DYCA 1ZSGA 2BZXA 5CIUA 5EI4A 1NJIC 1M1KC 2XMFA 3EGDB 4CUPA 1T3SA 2CYZB 5I7XA 3P8DA 3VS5A 3OYIA 1VQLA 5FFVA 3SDZA 5A5RA 2EYQA 3RKXA 1PM3A 3REAB 4JPBW 2PUOB 4YATA 5L8UA 3VS7A 2I8NA 4M75A 3REBB 2QGFB 4KGXB 3V8JA 1RAAB 4NUCA 4FW2A 1OX9A 5FG4A 1XTDA 4OUFA 1B7TA 2D8HA 5CO7A 5M9OA 3O37A 5HRVA 2VV5A 2P0PA 5ACYA 1ZBJA 1W70A 1UHFA 4N0AC 5HRXA 3JAME 1ZA1B 3VYGA 4O5VA 4OB3B 3CCQA 3Q1JA 5GAN8 2RK1A 1VQOA 1WFWA 4QSSA 2ZPGB 1AVZC 2DL7A 2DERA 3H0FA 1OU9A 2A37A 5LJ2A 4YYDA 5HJCA 5AMFA 1Y0MA 5GAMj 5EG2A 2H3EB 2IPOB 4CI0C 2DTIA 3VRYA 3O33A 1HK9A 3SVGA 2QTXA 4LDWA 4O76A 2B86A 5ENFA 1RAHB 1ZUKA 2QYZA 4JJNK 5GAOq 2DZCA 3INZA 1VQPA 3WVDB 4XQ3A 1M9SA 3EFOB 2KMTA 3IU6A 3I5SA 3CPWS 3UW9A 5D6WA 4BE1A 4NL2A 5I88A 2EQMA 2CS7A 2G6FX 5DYXA 4ZQLA 3UV4A 1GCQA 2RQTA 4A53A 2JM9A 5A83A 1T0HA 1UEBA 4UIXA 5E7DA 5IXBA 2NLUA 4OMNA 2J6FA 2QQSA 2ZZDA 4O7AA 2OX7A 3WXMB 5FU7B 3NTIA 3CMAQ 2RQWA 1VQ7A 3CCJQ 3OS0A 3CD6T 3URGA 1IHVA 4NQMA 2OTJQ 3A8MB 2QA4A 2WACA 3X24B 1VYUA 2ZGWA 2RNWA 2COZA 3HP9A 1Q81U 1MV3A 4A9MA 4RTVA 1QQJA 5CKEA 4PJNA 5A81A 1WLPB 5GAN7 2QI2A 4OMLA 5EVAA 2F69A 1WNLA 4YAXA 4NYVA 3E19A 2HZYA 4A63B 4PJOB 2HD0A 5GAN2 2LT1A 1WXUA 3SHWA 1EQFA 3LXJA 3M56A 2M16A 3QDRB 2C0TA 1Z9QA 5KYYB 5LKZA 3QZVA 1YI2T 3UDCA 3NFCA 3JCMV 3UV5A 5AD3A 1AEYA 3LQJA 2QK0A 4QQ6A 2ENMA 3IQLA 4C92C 3I56T 2D82A 4GY5A 1NEBA 5LJ5h 2JMAA 5DKHA 2KRSA 4XTUA 5GJWB 1GFDA 2RO1A 4MR5A 4CUUA 1R8OB 2PVOB 2XG8D 1JB0E 1N6AA 2X4JA 2HSPA 3ZBDA 3D7CA 2GQVA 2YRCA 2VGNA 4A9IA 5LJ3g 4LYIA 4R55A 4M7DB 1E6IA 2I0NA 1QKXA 4CC7A 1Q7YU 4MZPA 4NR6A 1RAFB 3P1CA 1RI9A 1GBRA 2EYWA 4M7AF 2G3RA 1PCXA 3NGPA 3D1BA 4A4HA 2X51A 4QSRA 2AZVA 5CUDA 5DKCA 3VKHA 2WP1A 3RKWA 3OYJA 4LN2A 2E41A 2VXFA 4K11A 1H92A 2E3IA 3OYKA 4JLIA 5IXFA 2EYYA 5GAMe 1I8FA 5HENA 1JXMA 2HSEB 2KE9A 3S92A 2MF2A 2HL5C 4B9WA 4AT1B 5CUEA 5A0GA 1OPLA 4XU2A 5IHIA 2YUNA 3S6WA 1OX8A 2HBPA 3PT9A 5FWBA 3M54A 4A4GA 1S72Q 1X43A 2IVWA 3QXEB 4II1A 1R77A 2O2OA 1VIFA 1M90C 5GANj 1K8AU 3PNWC 2YEMA 4XY9A 1ZSZB 2L2PA 5CAIA 2F5KA 4XY8A 4M7AD 2LJ1A 3FLGA 1U8RA 2E7NA 4UYHA 5CUGA 2EQJA 4JJCA 5CQ5A 2XKOC 4AI6A 4YYHA 5A2QE 2DTOA 3MO8A 3JCMc 3EGDA 3IU5A 3EG2A 2XU8A 5KU3A 1VA7A 4XTWA 4OMPA 4O75A 3G4ST 1SSHA 2X35A 5FH6A 3P8HA 2KYBA 2PQWA 1TUCA 2DXCA 4F7UF 1X75C 5BT3A 1H3ZA 2DKGA 2NYSA 1AD5A 3RIRA 2O88A 1JEGA 1U1SA 4ANJA 3QPHA 2O9SA 1YHQA 3QWXX 2Y4YA 4PFOA 4TVRA 2PVGB 2K2MA 2D0NA 2X4XA 2GRCA 1K8AC 2JT4A 2M51A 4RTXA 4CC4B 3L42A 3GIBA 3CC7Q 3NXBA 3O8VA 1KD1U 4RKUE 2LTOA 1JRIA 2ECZA 3PFSA 1WQ7A 5KYWA 3M53A 3H6ZA 1VQ5T 5I40A 3THKA 2KXDA 3C0CA 2GFUA 5C89A 1N9SA 4MZTA 4QVDA 3S3OA 1IZ6A 2FHDA 2E3HA 1QWEA 4M77C 4BJXA 3CMET 4A9EA 1YIJA 4ALHA 1NPRA 3UVDA 1M27C 1VQMA 2OTLQ 1TSFA 2A08A 1KHCA 2RHXA 2O4XB 1MMDA 2JTFA 1WA7A 3K2JA 2DETA 3TLPA 3EFSA 5EC7A 2MCNA 4HXLA 1H3HA 2RH2A 4E7LA 1M3CA 4QSPA 5D3HA 5FFWA 3EFOA 4QYDA 2PVDB 2HAXA 1JJ2A 5LJ5j 2MAMA 2VVKA 4MZMA 4E7SA 4PLLA 4RTTA 1QVPA 1BIAA 1NZ9A 3O36A 1JBMA 4PJOG 4PJOE 5EM3A 1FMWA 3I3JA 4PY6A 5A5SA 1AT1B 3RNJA 3OYBA 8ATCB 2QEXA 3H0IA 4QSUA 1UGSB 4M78C 3X25B 2YDWA 5CGPA 3SWNB 4N4HA 4BUGA 5ENCA 5GAOn 1IB8A 4LUEA 2LQWA 1WHGA 1V29B 2KVQG 4YY6A 3M0RA 3U5KA 3VS3A 3BDLA 1SG5A 1K73R 2KQWA 1EFNA 4IIOA 1YJ9A 1K73U 2F2WA 5I1QA 2M0OA 2LJ3A 5GANe 3SEMA 3U5OA 4QKUA 5CQ4A 1BBZA 5A5PA 5L8RE 5K29A 5LVQA 2LVMA 2ROTA 4PS5A 4OGJA 1FX7A 1SKUB 4EMKB 5KYYA 1MHNA 4ORZA 4M7DG 5FROA 4RCCA 4M7DE 2JJ9A 2XHCA 1G83A 1QVGA 2J6KA 1UTIA 4RTWA 5ENHA 2ABLA 4J9FA 4XAXB 3VJPA 5CQ3A 2MJVB 1VQ6Q 4QR4A 4QUUA 3P1EA 5FU6B 5II1A 4ZW1A 5CQ7A 3CCUT 1Q86U 3G0LA 4C8QB 2YDLA 4CUQA 3CC2A 3I55A 3CEYA 5DY9A 4C0GA 5EISA 3J81E 2V1RA 2KAFA 3QZSA 5FE9A 2EKHA 3V7RA 5ENIA 2C0OA 3UPUA 4PFPA 1KJWA 1Q95G 2OSSA 4EMHA 3OA6A 1RI0A 3JCMW 3OYYA 4O7CA 2P4TA 4RTZA 5EQ1A 5J3BA 2HEQA 3QKJA 4XYAA 1K9MR 1TG0A 1E6HA 3L2ZA 2QTVA 2YHTA 4LDVA 5FE6A 4D8KA 1F68A 1OV3A 3M0PA 5CK9A 1RL2A 2E10A 4IORA 3QZTA 5I89A 1TWBA 5KO4A 2RK2A 2AIRB 5DBMA 2L8DA 3I9QA 2AKLA 2JS2A 3VKGA 3EG0A 1BCMA 4IUVA
chains in the Genus database with same CATH topology
2CZ1B 5I29A 4XUAA 3U5JA 3SB2A 1VQ8T 5H1VA 5IG6A 5F60A 4O7EA 5FE1A 3CCST 4TU6A 1G3TA 3G6ET 4N3WA 2E7OA 4CL9A 4LDUA 3PIOA 4J0SA 4YYJA 3CCLT 2L89A 3JCMJ 5LKUA 4QR5A 4C66A 5JI8A 5F61A 4OB0B 1YJWT 3E1SA 4QEWA 3E9FA 2RJEA 4MDWA 5CQAA 2LCLA 3WVEB 5KE2A 3GPLA 4M75F 5KTXA 5LJ3f 4BE2A 2LX9A 3QYGB 3JVMA 1VQKT 5FRMA 4OMFB 2EJGA 5IBNA 4NOYA 5HRWA 5KCHA 1FXXA 3C95A 3RESA 1Y7XA 1XNIA 3CMAA 5AMEA 1H641 1VQLT 3SD4A 3CCJA 1UB4A 5LKXA 1G3SA 3N5BB 4TZ8A 5LJ5g 2OTJA 2VC8A 5EWDA 5CFWA 4QC3A 4YTLA 4M75D 5EA1A 4BW1A 2RI2A 3FC3A 4XU1A 4ME7A 4GLKA 4JRQA 4NRBA 3HHTB 3LQIA 5G4RA 3CCQT 2R5AA 2MWPA 1JJ2S 1NJIU 1M1KU 1VQOT 4BI4A 4IOQA 4LDFA 4QSWA 2B8AA 4HBWA 3OW2S 1OZ3A 3OQ5A 3OSVA 4L6V5 3RKYA 5IAYA 4E7IA 4A9FA 4PLIA 5CU8A 4HBYA 4UC4A 5DW2A 4FLPA 4NRCA 1EIFA 3ZEHA 3JVLA 5CPEA 3L2QA 1VQPT 4C8QG 4C8QE 2EFIA 5H85A 4EMKA 4RCBA 5CQXA 5FB0A 4ZC9A 5DY7A 4C0DB 5HQ5A 1M5Q1 4J1PA 4C67A 4NS5A 4XU3A 2ZPHB 4P5NA 4QVZA 2AHJB 2K5FA 1VQ7T 1JM4B 5EWVA 2RS9B 3UVYA 3CXCA 2QA4T 1QVGS 4OGIA 4QSTA 4C8QA 2DIQA 1G5VA 2FVUA 4KULA 2KSSA 1G3YA 4OB1B 4LDYA 2CZ6B 2RJFA 1S72A 5EPBA 1M1FA 2E6ZA 4IR5A 1UGRB 5FRNA 5TCMA 1W2BS 1D3BB 4YYGA 3C4SA 4YY4A 5FB1A 2JNGA 5DW1A 4FT4A 3H8ZA 4XTVA 3HPWA 3ER0A 5GANh 4CFLA 5D3RA 5CQTA 5A7CA 5CCAA 5GAOp 5C85A 5LJ1A 3M9QA 5IGLA 4UYFB 2YLCA 3ZFJA 3M57A 5FE0A 3OSSC 4QQDA 4LRGA 1FWZA 4M7AC 2K2VA 4BY6C 3GP8A 3CC7A 3TREA 4KBMB 2GCXA 4UIZA 2V8IA 4A54A 1GXIE 4TTEA 5HK3A 2R57A 1XQHA 2CGHA 4BI3A 1QP3A 2DD5A 3M4GA 3RMSA 5LJ3d 3OYFA 2LQKA 5D25A 2OTLA 2LT4A 3HL8A 4C0FA 4EMGA 1KHIA 3S91A 1AHJB 1PSFA 2E70A 4C5EA 4BW2A 3PMTA 1ZBXA 4PCEA 5CKFA 2GFAA 3EAEA 4O70A 2YELA 3RCWA 4QQGA 4HA8A 1ZHIA 2RI3A 2DKWA 4OGEA 1WPYA 5EWCA 5GAN5 3OMGA 4PKCC 4JLGA 4YADA 1OZ2A 4HXNA 5FE3A 5TB6A 1NE8A 5BT4A 2EJ9A 2I7KA 2LSPB 1HXDA 2Y90A 5CRMA 1Y96A 2QQ9A 4A4KA 4QZSA 4D6WA 2KDSA 1YHQT 5F3AA 5CQYA 1M90U 4C92B 2RHYA 5GAOm 4MR4A 1ZQ1A 4F7UB 5DFCA 2K3XA 3X26B 4YYIA 5GAN4 4BI8B 3VU3C 4HXOA 1WJQA 3FB9A 4OF1A 2L5EA 5II2A 4ZN3A 2R0YA 3LGFA 4NUDA 4WIVA 3OBWA 4Y28E 3JB9I 2JTMA 3OYLA 2JN0A 1YIJT 1VQMT 1VQ6A 3A5ZB 4UYGA 4OB2B 4QYLA 5DKDA 4BE0A 4TZ2A 2YRVA 2KK4A 1I5LA 3DLMA 2RNXA 3MUKA 4MR3A 2XK0A 3UVWA 3JRZA 4PJOF 2JZ2A 1BI1A 2MWOA 3OYGA 3JCMf 5KCOA 5J26A 1Y71A 5GAN3 5EPRA 5E9YA 4QVCA 4HT8A 5E74A 2QEXT 4YYNA 5HM0A 5HKCA 2DVQA 5FBXA 2EWNA 3QUIA 3JB9J 2X4YA 3SVFA 3DAIA 5CR2A 1YJ9T 4JRKA 4JUVA 1KC8U 3L2UA 5DYAA 3MEUA 4MEQA 2K5LA 2E3KA 2XDPA 4PJOD 3CXCS 1UGPB 4M7DF 2D9TA 2BIVA 1D3BA 4Y03A 5DLOA 4KV1A 5GAMg 5L98A 5D6XA 2DVRA 2WSCE 4CFKA 2ZPBB 2XDBA 4YH4A 3P8BB 3RUXA 2PUKB 1VQNA 4N0AA 5I86A 2E1HA 1BKBA 4Z02A 2I2LA 4E7HA 4UYFA 2LRQA 4A9NA 2H60A 2LNVA 1KC8C 4O6JA 5IN1A 3CC2T 4OP0A 2QDYB 3I55T 4M77B 5D3PA 3ZYUA 3MP8A 4EPCA 4M7DD 1VQ4A 4NYXA 1BI0A 4GPJA 3GF5A 4MEOA 4Q0OA 5L99A 2O01E 1KQSA 5A5NA 4A9LA 4O7FA 1KG1A 4UYEA 1MGQA 2G4AA 5HY6A 3G0JA 2RHZA 4KUIA 3QHSA 3CCEA 5ENGA 2DZ9A 5FG6A 4ATOA 3P1DA 5EV9A 2CKKA 3CCRA 3VUBA 4LZ2A 1VQ9A 4VUBA 2WSFE 5EPSA 4UIWA 4N4IA 5FDZA 4DOWA 5F63A 4M78B 3HRUA 1I4K1 5C87A 5HEMA 1WJSA 4C92G 4C92E 3OBYA 1B34B 2DXUA 4YBTA 4E96A 5CY9A 1X0JA 4ZN1A 3OYHA 4QW2A 5C0MA 4NR9A 2YQDA 2RM4A 3PMIA 2XD0A 3HMHA 3O35A 5L8TA 5D3SA 2IG0A 4LDXA 4C92A 3ONIA 4F7UA 1YITA 4QNSA 3MCAB 4XTZA 4ELZC 3J7AF 3MXFA 4N4FA 5LJ3h 5CZGA 4HBVA 4CRIA 3LH0A 1U1TA 3JCMP 5L97A 5AYFA 3CMAT 2XDDA 3P5OA 4RG2A 5GANg 2MMPA 3CCJT 4IUQA 2DK3A 4FIBA 4AKNA 4HKEA 3O34A 3JCMd 2OTJT 4Z93A 4MMLA 5C4QA 3HMEA 4XUBA 3OS1A 5DFBA 3L2RA 5DLQE 3KBGA 3L2WA 5IGKA 5HK0A 3GNGA 2DIGA 2V8JA 5I83A 3DB4A 2RJDA 5HFQA 5LUUA 4NRAA 4JDSA 4UIVA 5CRZA 2DTHA 1QP2A 2RI7A 1WQWA 5EK9A 2RA2A 4LC2A 2PU9B 1YJNA 5A0LA 4FT2A 2QQBA 1N72A 3OYDA 4C8QF 4IR6A 5HLSA 3FIFA 5LVRA 1N27A 3HFNA 2L5QA 3CBOA 2V8KA 2D9EA 4L5GA 4J0RA 2DXTA 3LX7A 3JVKA 4HXSA 4M77G 4M77E 5FFYA 5COIA 1DJ7B 5CUCA 4LD9K 2EIFA 4TQNA 4Q0NA 3F70A 1O75A 5F5ZA 3JSCA 5LKTA 4Z1SA 3MQMA 2RJCA 4YYKA 1X6OA 1N8RC 2DPPB 5C7NA 3QZ5B 4CUSA 1Y96B 5A5QA 4C8QD 5A0DA 4M77A 4UYDA 3ME9A 3BY7A 4WHUA 5FH8A 5GMKe 3SVHA 4NR5A 2LQ8A 1S72T 2D6FA 4LZRA 2LC4A 3HRTA 2OAUA 4M78G 4M78E 4ZTFA 5I2MA 2LDMA 4L59A 4TT2A 3HMFA 1NPPA 2NXBA 4BHWA 5CKBA 4J7FA 5EWHA 3UWNA 4J7IA 1Q82C 3RMQA 2LCCA 4J6YA 5F25A 3R6OA 5LJ3j 4IR3A 4BD3A 5FE7A 5KE3A 3RERA 2A3LA 5CKHA 1QW1A 2C06A 4M78A 3CC4A 3HFOA 1P92A 4QEVA 2KY9A 1PSEA 2E6NA 5G4SA 4HCBA 5E73A 5HQ7A 2EAYA 4WF2A 3NTKA 3CC7T 2N9GA 2HQEA 1B34A 3BDUA 5GAMf 4KCXA 3KXTA 2DWWA 3QJYA 3VV0A 3QBYA 3A8GB 4MENA 4C0ZA 2JUFA 3CCVA 4ELYC 4QC1A 2OTLT 4QB3A 5FE8A 3HKSA 2MI6A 3JB9G 3QG1A 1N9RA 3META 4J5YA 3E9GA 5D24A 2L3RA 5HQ6A 5CVIA 5L96A 2F5TX 2DO3A 1VIEA 2E5QA 4KV4A 4Z6IA 5GMKm 4NYWA 5DLZA 4FM4B 4XK8E 4ZGJB 2VYTA 1W4SA 3CPFA 3OY9A 1M4ZA 5HELA 4HXKA 4CURA 1VUBA 5IIDA 5CUBA 4UIYA 3G71A 4ZTJA 4TYLA 4DA4A 3DWYA 3PIPA 4IURA 2D0QB 1BIBA 3OYCA 2YW5A 3CCMA 3DB3A 3V8LA 2RD1A 5ETDA 4Y91A 3X28B 4JRIA 3MULA 4YH3A 2R10A 1LOJA 4R56A 2XICA 5FU7C 2OUOA 3MEVA 4NR4A 3TCJA 2M9UA 5FH7A 5E9IA 3DLLA 2KTBB 3AHUA 3M5AA 4C5GA 4E7KA 2EJFA 4M7AB 5LJ3e 4BY6B 3LYIA 1KQ2A 4NQNA 4HCZA 3JB9H 1VQ6T 4A4FA 4PTBA 2R0VA 3OMCA 3GG3A 4PJOC 2FB7A 5F1HA 4TS8A 4LYSA 1I81A 4OVAA 5GAOl 3X20B 4C5HA 3U5PA 5I21A 2K57A 3JCMh 5ETBA 3MB3A 5A85A 4XTXA 4ZGDB 3G7ZA 2RI5A 1BI2A 5E0RA 5A5OA 3KUFA 3M4YA 3V7CA 5GANf 4FU6A 1YCYA 5FE2A 5EICA 4RVRA 5ENBA 1WUMA 4M7DC 5CTLA 2YEKA 5KHMA 3M55A 2DJZA 3OB9A 4WHWA 2X4WA 3FEOA 3QZ9B 3C94A 3AADA 4A9HA 1Q81C 5E3DA 2E64A 2JVVA 3EFRA 5D26A 2CZ7B 2FYKA 3GNFB 4KUDK 4DQ2A 1VQNT 5GAOr 3QSUA 2RNYA 5IT9E 3UVXA 4MR6A 4TT4A 2L84A 5C8GA 3J80E 3CD6A 5E9VA 5D3LA 4CUTA 4DOVA 4LR6A 4RG8A 5GAMd 2BUDA 5KTWA 5D0CA 4A4EA 3U5NA 1VQ4T 4XU0A 2EQKA 2EQUA 3LGLA 4LD6A 2H3JA 2CZ0B 4X34A 3M58A 3OYMA 1Q7YC 4Q5WA 4UIUA 3PTAA 3CCET 5EGUA 5CP5A 5GMKh 1YI2A 4TT6A 2ZCFB 1KQ1A 3MP6A 3CCRT 5CQ6A 4O71A 2WSEE 5LJ5f 1VQ9T 2RFJA 5EP7A 3I56A 4J3IA 4YYMA 5DM7R 2OO1A 3ASKA 4C92F 3MEWA 3S3NA 1QVFA 5H1TA 1BI3A 4FL6A 1G3WA 3LLRA 4MMKA 5D7XA 3HRSA 2DXBA 3OYEA 1TH7A 2VUBA 1M1GA 2E12A 1LNXA 2RHIA 4BDZA 2YYNA 4QY4A 3BFMA 3LQHA 3BW1A 5KH6A 2EKOA 4M7AG 5I80A 4M7AE 4E7JA 4LZSA 3FKMX 4HXMA 4QEUA 2VGMA 3SFMA 4QSQA 2R5MA 4C92D 5DX4A 3LW5E 5E3GA 1YITT 4HXRA 5GAN6 3U5LA 4PKLA 5ENEA 3OYNA 3QYHB 4ALGA 4QUTA 4A9JA 4BW4A 3SWNC 3UV2A 1KD1C 4NR8A 4M7AA 2R0SA 3VUZA 5F62A 5CUAA 1Y07A 2GF7A 3OW2A 4O78A 4O77A 1WJRA 1XOVA 5A82A 5EU1A 2QQRA 3Q2FA 3L1AA 5D3TA 3L2VA 2R58A 2FL7A 3G4SA 3QJ6A 4QBMA 4EDUA 4JS5A 4HT9A 4J6XA 1JSPB 3MP1A 3TEEA 3GLXA 3V8KA 4EMKC 2A7YA 5CKDA 3PGGA 5J0DA 4F7UG 4F7UE 2XI9A 5GANd 4JS4A 4PJOA 3VKIA 5FE4A 4YK0A 5HFRA 4CLBA 4X9DA 4E47A 4HCCA 2QQAA 2HQXA 1VQ5A 5FU6C 5ENJA 5KTUA 1LJOA 3Q2EA 4C8QC 4BDYA 4M75C 1YJNT 2QXFA 3A8LB 3CMEA 5DFDA 5F1LA 1YBYA 3M59A 5F2PA 5EWWA 3JCMb 4X2IA 3FJPA 2YLBA 4YABA 5AD2A 4M77F 2HNIA 1BYMA 5GMKj 5F36A 2E65A 1X01A 2Y4XA 2BKDN 1K73C 5E9LA 5I7YA 3UT1A 1WUGA 3LWIA 1W2BA 4M75B 4A9OA 4HBXA 3U5MA 2DVVA 2K5IA 3QO3A 3OYAA 4HXPA 4MEPA 2K4YA 4M7DA 4PL6A 5IGMA 4NR7A 4RMOA 3JCMe 2M1HA 2RO0A 4FSXA 4YBMA 4X9CA 2DD4A 2XIDA 4YBSA 4J8OA 1K9MU 3FRNA 2F6NA 5IGNA 4M77D 4M78F 4TU4A 3CPWA 5GMKi 1Q86C 2ZPEB 4J83A 3LWHA 3S3MA 2L85A 5LJ5e 5LJ5d 4IR4A 4O74A 3AQAA 3MB4A 4LYWA 3P1FA 1WGSA 2RHUA 3OS2A 4Z1QA 3T9NA 3JCMQ 3VYHB 1N8RU 4ZGEB 5LL6S 3C12A 4MDXA 1K9MC 1ZS5A 5FE5A 5HCLA 4M78D 4O72A 3A8OB 4JRPA 2FSAA 3CC4T 4QSVA 3CCUA 4IUPA 3DKMA 5D3JA 2DEQA 1OYXA 5LJ0A 3NTHA 4QR3A 3TU4K 4BACA 1QVFS 1Q82U 3JCMg 5GAMh 4BW3A 4NUEA 4QSXA 3MHXA 3CCVT 3JB9F 3CBPA 2DVEA 3HSBA 4YC9A 1IREB 5JWMA 4IOOA 5D3NA 3QIIA 2RB6A 2WP2A 2O4XA 5H1UA 3MEAA 5D6YA 5CQ8A 3JCMX 4N4GA 5BT5A 4IUTA 5E9MA 1VQ8A 5DLXA 5FG5A 2P0QA 2VXEA 4IUUA 2P0KA 1UGQB 4PNOA 5J39A 4Z6HA 3GOXA 3V7SA 1KQSS 3CCSA 3G6EA 5C6SA 3JB9D 1O9SA 4KT0E 1M8VA 1OI1A 2K3YA 2DATA 4C5IA 4IKFA 3CBMA 3CCLA 5FLXE 3G71T 3SWNA 4A9KA 3OS5A 2ZPFB 3A8HB 3FDRA 3JVJA 4DONA 1YJWA 2DVSA 4OGCA 3CCMT 2ZPIB 4PCIA 4V2SA 1SSFA 2JOYA 4NXJA 4C0DC 4UITA 2DAQA 5I2SA 3LJWA 5E9KA 5GMKl 4F3IA 4O7BA 4NL3A 5DYUA 4M75G 1VQKA 4M75E 4J6WA 5CS8A 4XTYA 2F6JA 4B9XA 4BB7A 5DYCA 5CIUA 5EI4A 1NJIC 1M1KC 4CUPA 2CYZB 5I7XA 3P8DA 1VQLA 3OYIA 5FFVA 3SDZA 5A5RA 2EYQA 3RKXA 2PUOB 4YATA 5L8UA 2I8NA 4M75A 3V8JA 4NUCA 5FG4A 1XTDA 4OUFA 5CO7A 5M9OA 3O37A 5HRVA 2VV5A 2P0PA 5ACYA 4N0AC 5HRXA 3JAME 3VYGA 4O5VA 4OB3B 3CCQA 3Q1JA 5GAN8 2RK1A 1VQOA 4QSSA 2ZPGB 5LJ2A 4YYDA 5HJCA 5AMFA 5GAMj 5EG2A 4CI0C 2DTIA 3O33A 1HK9A 3SVGA 2QTXA 4LDWA 4O76A 5ENFA 4JJNK 5GAOq 2DZCA 3INZA 1VQPA 3WVDB 4XQ3A 1M9SA 2KMTA 3IU6A 3CPWS 3UW9A 5D6WA 4BE1A 4NL2A 5I88A 2EQMA 2CS7A 5DYXA 4ZQLA 3UV4A 4A53A 5A83A 1UEBA 4UIXA 5E7DA 2NLUA 2QQSA 2ZZDA 4O7AA 3WXMB 5FU7B 3NTIA 1VQ7A 3OS0A 3CD6T 3URGA 4NQMA 3A8MB 2QA4A 2WACA 3X24B 2ZGWA 2RNWA 3HP9A 1Q81U 4A9MA 5CKEA 5A81A 5GAN7 2QI2A 5EVAA 1WNLA 2F69A 4YAXA 4NYVA 3E19A 4PJOB 2HD0A 5GAN2 2LT1A 1EQFA 3LXJA 3M56A 2M16A 3QDRB 5LKZA 3QZVA 1YI2T 3UDCA 3NFCA 3JCMV 3UV5A 5AD3A 3LQJA 4QQ6A 4C92C 3I56T 2D82A 4GY5A 5LJ5h 5DKHA 4XTUA 2RO1A 4MR5A 4CUUA 1R8OB 2PVOB 2XG8D 1JB0E 1N6AA 2X4JA 3ZBDA 3D7CA 2GQVA 2VGNA 4A9IA 5LJ3g 4LYIA 4R55A 4M7DB 1E6IA 1Q7YU 4MZPA 4NR6A 3P1CA 4M7AF 2G3RA 4A4HA 4QSRA 5CUDA 5DKCA 3RKWA 2WP1A 3OYJA 2E41A 2VXFA 3OYKA 4JLIA 5GAMe 1I8FA 5HENA 3S92A 2MF2A 4B9WA 5CUEA 5A0GA 4XU2A 3S6WA 2HBPA 3PT9A 3M54A 4A4GA 2IVWA 3QXEB 4II1A 1VIFA 1M90C 5GANj 1K8AU 3PNWC 2YEMA 4XY9A 5CAIA 2F5KA 4XY8A 4M7AD 3FLGA 1U8RA 2E7NA 4UYHA 5CUGA 2EQJA 5CQ5A 2XKOC 4YYHA 5A2QE 2DTOA 3MO8A 3JCMc 3IU5A 2XU8A 5KU3A 4XTWA 4O75A 3G4ST 2X35A 5FH6A 3P8HA 2PQWA 2DXCA 4F7UF 1X75C 5BT3A 1H3ZA 2DKGA 3RIRA 1U1SA 3QPHA 1YHQA 2Y4YA 4TVRA 2PVGB 2X4XA 2GRCA 1K8AC 3L42A 3GIBA 3NXBA 3O8VA 1KD1U 4RKUE 2LTOA 1JRIA 3PFSA 1WQ7A 3M53A 3H6ZA 1VQ5T 5I40A 2GFUA 5C89A 1N9SA 4MZTA 4QVDA 3S3OA 1IZ6A 2FHDA 4M77C 4BJXA 3CMET 4A9EA 1YIJA 4ALHA 1NPRA 3UVDA 1VQMA 1KHCA 2RHXA 2O4XB 2JTFA 3K2JA 3TLPA 3EFSA 4HXLA 2RH2A 4E7LA 4QSPA 5D3HA 5FFWA 4QYDA 2PVDB 2HAXA 1JJ2A 5LJ5j 2MAMA 4MZMA 4PLLA 1QVPA 1BIAA 1NZ9A 3O36A 1JBMA 4PJOG 4PJOE 5EM3A 3I3JA 4PY6A 5A5SA 3OYBA 2QEXA 4QSUA 1UGSB 4M78C 3X25B 2YDWA 5CGPA 3SWNB 4N4HA 4BUGA 5ENCA 5GAOn 1V29B 2KVQG 4YY6A 3U5KA 3BDLA 2KQWA 1YJ9A 1K73U 5I1QA 2M0OA 5GANe 3U5OA 5CQ4A 5A5PA 5L8RE 5K29A 5LVQA 2LVMA 4PS5A 4OGJA 1FX7A 4EMKB 1MHNA 4M7DG 5FROA 4RCCA 4M7DE 2XHCA 1QVGA 5ENHA 4XAXB 3VJPA 5CQ3A 2MJVB 4QR4A 4QUUA 3P1EA 5FU6B 5II1A 4ZW1A 5CQ7A 3CCUT 1Q86U 3G0LA 4C8QB 3CC2A 4CUQA 3I55A 3CEYA 5DY9A 4C0GA 5EISA 3J81E 2KAFA 3QZSA 5FE9A 3V7RA 5ENIA 3UPUA 2OSSA 4EMHA 3OA6A 1RI0A 3JCMW 3OYYA 4O7CA 2P4TA 5EQ1A 5J3BA 3QKJA 4XYAA 3L2ZA 2YHTA 4LDVA 5FE6A 1F68A 5CK9A 1RL2A 2E10A 4IORA 3QZTA 5I89A 5KO4A 2RK2A 2L8DA 5DBMA 4IUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYF A;  3KUF A;  5I29 A;  2LRQ A;  4A9N A;  4XUA A;  2H60 A;  3U5J A;  5CS8 A;  5IN1 A;  4FU6 A;  2F6J A;  5H1V A;  5D3P A;  5IG6 A;  3ZYU A;  5FE2 A;  3MP8 A;  4B9X A;  5EIC A;  4RVR A;  5DYC A;  5CIU A;  5F60 A;  4O7E A;  4NYX A;  5EI4 A;  5ENB A;  1WUM A;  5CTL A;  5FE1 A;  2YEK A;  4GPJ A;  4TU6 A;  5KHM A;  4CUP A;  4MEO A;  5I7X A;  4Q0O A;  5L99 A;  3OB9 A;  3P8D A;  3OYI A;  5FFV A;  4N3W A;  2E7O A;  5A5R A;  5A5N A;  4A9L A;  4O7F A;  4UYE A;  4WHW A;  2X4W A;  2G4A A;  3FEO A;  4CL9 A;  3G0J A;  3AAD A;  4A9H A;  4J0S A;  5E3D A;  4YYJ A;  2RHZ A;  2L89 A;  5LKU A;  4YAT A;  4QR5 A;  4C66 A;  5L8U A;  5JI8 A;  5F61 A;  2I8N A;  5D26 A;  5ENG A;  4QEW A;  3E9F A;  5FG6 A;  2RJE A;  4NUC A;  3P1D A;  5EV9 A;  5FG4 A;  5CQA A;  5KE2 A;  2CKK A;  4LZ2 A;  4OUF A;  5M9O A;  3O37 A;  5HRV A;  5EPS A;  5ACY A;  4UIW A;  4N4I A;  5HRX A;  2RNY A;  5FDZ A;  3UVX A;  5KTX A;  4MR6 A;  4TT4 A;  2L84 A;  5F63 A;  5C8G A;  3Q1J A;  4BE2 A;  3JVM A;  5E9V A;  5D3L A;  5FRM A;  4QSS A;  4CUT A;  4LR6 A;  2BUD A;  5IBN A;  5HRW A;  5KTW A;  5C87 A;  5KCH A;  5D0C A;  5HEM A;  1WJS A;  4A4E A;  5LJ2 A;  4YYD A;  5HJC A;  5AMF A;  3U5N A;  4YBT A;  1XNI A;  5AME A;  2EQU A;  2EQK A;  3LGL A;  4LD6 A;  3SD4 A;  4E96 A;  3O33 A;  1X0J A;  5CY9 A;  3SVG A;  3OYH A;  4O76 A;  4X34 A;  5ENF A;  5LKX A;  4TZ8 A;  4QW2 A;  5C0M A;  3OYM A;  4NR9 A;  2YQD A;  3PMI A;  5EWD A;  5CFW A;  3IU6 A;  4Q5W A;  4QC3 A;  4UIU A;  3UW9 A;  5D6W A;  4BE1 A;  5I88 A;  5EGU A;  3HMH A;  5CP5 A;  2EQM A;  4TT6 A;  5EA1 A;  5DYX A;  4BW1 A;  2RI2 A;  4ZQL A;  3MP6 A;  3O35 A;  3UV4 A;  5L8T A;  5D3S A;  3FC3 A;  5CQ6 A;  4O71 A;  2IG0 A;  5A83 A;  2RFJ A;  3ONI A;  4UIX A;  5E7D A;  5EP7 A;  4NRB A;  2NLU A;  2QQS A;  4J3I A;  4O7A A;  4QNS A;  4YYM A;  3LQI A;  5G4R A;  3NTI A;  2OO1 A;  3MXF A;  2R5A A;  3ASK A;  2MWP A;  3OS0 A;  4N4F A;  3MEW A;  3S3N A;  5H1T A;  5CZG A;  4HBV A;  4CRI A;  4FL6 A;  4IOQ A;  3LH0 A;  4NQM A;  4LDF A;  4QSW A;  2WAC A;  2B8A A;  3LLR A;  2RNW A;  5L97 A;  4HBW A;  1OZ3 A;  5D7X A;  4A9M A;  5A81 A;  3OYE A;  3OQ5 A;  5EVA A;  3P5O A;  4RG2 A;  5IAY A;  4YAX A;  4A9F A;  4E7I A;  4PLI A;  4NYV A;  5CU8 A;  4HBY A;  4UC4 A;  5DW2 A;  4FLP A;  4IUQ A;  4NRC A;  2RHI A;  3ZEH A;  4AKN A;  3JVL A;  4BDZ A;  2YYN A;  3O34 A;  4QY4 A;  5CPE A;  4Z93 A;  3LQH A;  3L2Q A;  5KH6 A;  5C4Q A;  1EQF A;  3LXJ A;  2EFI A;  2EKO A;  5H85 A;  5I80 A;  2M16 A;  3HME A;  5LKZ A;  3QZV A;  4XUB A;  4E7J A;  4LZS A;  3OS1 A;  5DFB A;  3L2R A;  3FKM X;  5FB0 A;  4ZC9 A;  3UV5 A;  4HXM A;  5DY7 A;  5AD3 A;  4QEU A;  5HQ5 A;  4QSQ A;  3LQJ A;  2R5M A;  4QQ6 A;  5DX4 A;  3L2W A;  4J1P A;  5IGK A;  4C67 A;  5E3G A;  2D82 A;  4NS5 A;  4GY5 A;  4QVZ A;  4HXR A;  5DKH A;  2DIG A;  3U5L A;  4PKL A;  5ENE A;  2RO1 A;  4MR5 A;  4CUU A;  1JM4 B;  3OYN A;  5EWV A;  5I83 A;  2RS9 B;  4ALG A;  2RJD A;  4QUT A;  3DB4 A;  5HFQ A;  3UVY A;  4A9J A;  5LUU A;  4NRA A;  4BW4 A;  4UIV A;  5CRZ A;  3D7C A;  4OGI A;  4QST A;  4NR8 A;  3UV2 A;  2RI7 A;  4A9I A;  5EK9 A;  2DIQ A;  1G5V A;  4LYI A;  2R0S A;  4LC2 A;  1E6I A;  1N72 A;  5CUA A;  5F62 A;  4NR6 A;  2GF7 A;  4O78 A;  4O77 A;  3P1C A;  1WJR A;  2RJF A;  3OYD A;  5EPB A;  5A82 A;  4IR6 A;  5EU1 A;  5HLS A;  2QQR A;  3Q2F A;  5LVR A;  2G3R A;  5D3T A;  4A4H A;  4IR5 A;  5FRN A;  1N27 A;  3L2V A;  5TCM A;  4QSR A;  2D9E A;  5CUD A;  4J0R A;  2R58 A;  5DKC A;  4QBM A;  2WP1 A;  3QJ6 A;  3OYJ A;  4YYG A;  3LX7 A;  3C4S A;  3JVK A;  4EDU A;  4HXS A;  4YY4 A;  3OYK A;  5FB1 A;  5DW1 A;  5FFY A;  5HEN A;  1JSP B;  3MP1 A;  5COI A;  5CUC A;  3S92 A;  3H8Z A;  4B9W A;  4TQN A;  5CUE A;  4Q0N A;  5J0D A;  3F70 A;  4CFL A;  5F5Z A;  5D3R A;  5CQT A;  5A7C A;  3S6W A;  5LKT A;  5C85 A;  5LJ1 A;  4Z1S A;  4A4G A;  5FE4 A;  3M9Q A;  5IGL A;  4YK0 A;  3MQM A;  5HFR A;  4UYF B;  4CLB A;  4II1 A;  2RJC A;  4YYK A;  5FE0 A;  2HQX A;  3PNW C;  5ENJ A;  5C7N A;  2YEM A;  4XY9 A;  4CUS A;  5KTU A;  5A5Q A;  4QQD A;  4LRG A;  2F5K A;  3Q2E A;  4XY8 A;  4BDY A;  3FLG A;  4UYD A;  2E7N A;  3ME9 A;  4UYH A;  5CUG A;  2EQJ A;  4WHU A;  5CQ5 A;  5FH8 A;  3SVH A;  5DFD A;  4NR5 A;  4YYH A;  5F2P A;  5EWW A;  5F1L A;  4X2I A;  3MO8 A;  4UIZ A;  4YAB A;  4LZR A;  5AD2 A;  3IU5 A;  4ZTF A;  5KU3 A;  4TTE A;  2LDM A;  4L59 A;  4O75 A;  4TT2 A;  5F36 A;  3HMF A;  2R57 A;  2X35 A;  5FH6 A;  3P8H A;  2NXB A;  4BHW A;  2PQW A;  2BKD N;  5E9L A;  5I7Y A;  5EWH A;  3UT1 A;  1WUG A;  5BT3 A;  3UWN A;  1H3Z A;  4A9O A;  4HBX A;  3U5M A;  2DVV A;  3OYF A;  5D25 A;  3OYA A;  4HXP A;  4MEP A;  4PL6 A;  5IGM A;  2LCC A;  2GRC A;  2X4X A;  5F25 A;  4IR3 A;  4BD3 A;  3S91 A;  5FE7 A;  3L42 A;  5KE3 A;  4C5E A;  4BW2 A;  3NXB A;  4NR7 A;  3O8V A;  3PMT A;  2LTO A;  4PCE A;  2GFA A;  3EAE A;  2M1H A;  3PFS A;  4O70 A;  2RO0 A;  3H6Z A;  4YBM A;  2YEL A;  3RCW A;  4QEV A;  5I40 A;  4QQG A;  4YBS A;  2RI3 A;  2GFU A;  5C89 A;  2DKW A;  2F6N A;  5IGN A;  2E6N A;  5G4S A;  4E7H A;  3S3O A;  2FHD A;  4TU4 A;  4BJX A;  5E73 A;  5HQ7 A;  4A9E A;  3NTK A;  5EWC A;  3OMG A;  4ALH A;  2N9G A;  2HQE A;  3UVD A;  4YAD A;  4KCX A;  1KHC A;  1OZ2 A;  2RHX A;  2O4X B;  4HXN A;  5FE3 A;  2JTF A;  2DWW A;  5TB6 A;  3K2J A;  3S3M A;  2L85 A;  3TLP A;  5BT4 A;  3QBY A;  4MEN A;  4HXL A;  2I7K A;  4IR4 A;  4E7L A;  2LSP B;  4O74 A;  3AQA A;  4QSP A;  5D3H A;  5CRM A;  5FFW A;  4QYD A;  3MB4 A;  4LYW A;  3P1F A;  4QC1 A;  4QZS A;  1WGS A;  4PLL A;  2RHU A;  4QB3 A;  5FE8 A;  5F3A A;  3O36 A;  2RHY A;  4MR4 A;  3OS2 A;  4Z1Q A;  3MET A;  5EM3 A;  5DFC A;  3I3J A;  4PY6 A;  3E9G A;  5D24 A;  2K3X A;  2L3R A;  5A5S A;  5HQ6 A;  1ZS5 A;  4YYI A;  5L96 A;  5FE5 A;  5HCL A;  3OYB A;  4O72 A;  4QSU A;  2FSA A;  2E5Q A;  2YDW A;  5CGP A;  4QSV A;  4KV4 A;  4N4H A;  4HXO A;  4Z6I A;  1WJQ A;  4NYW A;  2L5E A;  5ENC A;  5II2 A;  5DLZ A;  4IUP A;  2R0Y A;  3LGF A;  4NUD A;  4WIV A;  5D3J A;  4YY6 A;  3U5K A;  2VYT A;  3BDL A;  1OYX A;  3OYL A;  5LJ0 A;  3NTH A;  4QR3 A;  5I1Q A;  3OY9 A;  2M0O A;  4BAC A;  4UYG A;  3U5O A;  5HEL A;  4HXK A;  5CQ4 A;  4QYL A;  5DKD A;  4CUR A;  5A5P A;  4BE0 A;  4TZ2 A;  2YRV A;  5K29 A;  5LVQ A;  5IID A;  5CUB A;  2LVM A;  3DLM A;  4PS5 A;  4BW3 A;  4UIY A;  2RNX A;  4OGJ A;  3MUK A;  4MR3 A;  4NUE A;  4QSX A;  2XK0 A;  4TYL A;  4ZTJ A;  3DWY A;  3UVW A;  1MHN A;  4IUR A;  5FRO A;  3OYC A;  2JZ2 A;  2YW5 A;  2MWO A;  3DB3 A;  3OYG A;  4YC9 A;  5JWM A;  4IOO A;  5D3N A;  5ETD A;  5KCO A;  3QII A;  5ENH A;  5J26 A;  5CQ3 A;  3MUL A;  4YH3 A;  2WP2 A;  5EPR A;  2R10 A;  2MJV B;  5E9Y A;  2O4X A;  5H1U A;  3MEA A;  5E74 A;  5D6Y A;  4QR4 A;  4YYN A;  5CQ8 A;  5HM0 A;  4QUU A;  2OUO A;  3MEV A;  3P1E A;  2DVQ A;  4NR4 A;  5FH7 A;  5E9I A;  5II1 A;  5FBX A;  4N4G A;  2KTB B;  5CQ7 A;  4ZW1 A;  5BT5 A;  4IUT A;  3G0L A;  5E9M A;  4C5G A;  4CUQ A;  4E7K A;  3CEY A;  5DLX A;  5FG5 A;  4IUU A;  3LYI A;  5EIS A;  2P0K A;  2X4Y A;  3QZS A;  5FE9 A;  3SVF A;  5J39 A;  4NQN A;  3DAI A;  5ENI A;  4Z6H A;  3GOX A;  4HCZ A;  3L2U A;  5DYA A;  4A4F A;  4PTB A;  3MEU A;  2OSS A;  2R0V A;  4MEQ A;  1RI0 A;  5C6S A;  3OA6 A;  2E3K A;  2XDP A;  3OMC A;  4O7C A;  3GG3 A;  5F1H A;  1OI1 A;  2K3Y A;  4TS8 A;  2DAT A;  4C5I A;  4IKF A;  2D9T A;  5EQ1 A;  2BIV A;  4LYS A;  3QKJ A;  4XYA A;  4OVA A;  4A9K A;  4Y03 A;  3FDR A;  4KV1 A;  3JVJ A;  5L98 A;  4DON A;  4C5H A;  5FE6 A;  2DVS A;  3U5P A;  1F68 A;  5D6X A;  2DVR A;  4CFK A;  4PCI A;  1SSF A;  4YH4 A;  4NXJ A;  4IOR A;  4UIT A;  3QZT A;  5I89 A;  2DAQ A;  3LJW A;  5ETB A;  5E9K A;  3MB3 A;  5I86 A;  5A85 A;  5KO4 A;  4F3I A;  5DBM A;  2L8D A;  4O7B A;  2RI5 A;  4Z02 A;  5E0R A;  5DYU A;  5A5O A;  4IUV A; 
#chains in the Genus database with same CATH topology
 1JJ2 P;  2CZ1 B;  5I29 A;  1AZG B;  4XUA A;  3U5J A;  4D8D A;  1JQQ A;  3SB2 A;  1VQ8 T;  5H1V A;  5IG6 A;  1SF9 A;  3OW2 P;  2GNC A;  5F60 A;  4O7E A;  2KI7 A;  1N8R R;  5FE1 A;  3CCS T;  4TU6 A;  2QGG A;  1R0C B;  1G3T A;  3G6E T;  4N3W A;  2E7O A;  4OMQ A;  1VQN Q;  4CL9 A;  3JV3 A;  4LDU A;  3PIO A;  1PD1 A;  4J0S A;  4YYJ A;  3CCL T;  2L89 A;  3JCM J;  5LKU A;  4QR5 A;  4C66 A;  1YWO A;  3UA6 A;  5JI8 A;  1WDX A;  5F61 A;  2QAZ A;  3EGX B;  4OB0 B;  1YJW T;  3E1S A;  4QEW A;  1AWJ A;  3E9F A;  2RJE A;  4MDW A;  1VYT A;  3MKD A;  5CQA A;  2LCL A;  3WVE B;  5KE2 A;  2VKN A;  3GPL A;  1WHK A;  3EH1 A;  4M75 F;  1VQ4 Q;  2SRC A;  5KTX A;  2K6D A;  5LJ3 f;  4BE2 A;  2LX9 A;  3QYG B;  3JVM A;  2OI3 A;  1Z9Z A;  1VQK T;  1KFZ A;  5FRM A;  2KEA A;  4OMF B;  2EJG A;  5IBN A;  4NOY A;  1PNJ A;  5HRW A;  1QVG P;  5KCH A;  4KRT A;  2HCK A;  1FXX A;  3C95 A;  3RES A;  1D09 B;  3CCE Q;  1Y7X A;  1XNI A;  3CMA A;  3TSZ A;  5AME A;  1H64 1;  1VQL T;  3SD4 A;  3CCR Q;  1VQ9 Q;  3CCJ A;  1UB4 A;  1SRL A;  4J9E A;  1T0J A;  5LKX A;  1G3S A;  3N5B B;  4TZ8 A;  5LJ5 g;  2OTJ A;  1W2B P;  2VC8 A;  5EWD A;  5CFW A;  2FPE A;  4OMO A;  2COY A;  4QC3 A;  4YTL A;  1FMK A;  4M75 D;  4E2F B;  4F14 A;  1X2Q A;  5EA1 A;  4BW1 A;  2RI2 A;  3FC3 A;  4XU1 A;  1UGV A;  4ME7 A;  4GLK A;  4JRQ A;  1YWP A;  4NRB A;  3HHT B;  3LQI A;  5G4R A;  1SHG A;  3CCQ T;  2R5A A;  2MWP A;  1JJ2 S;  1NJI U;  1M1K U;  1VQO T;  7AT1 B;  4BI4 A;  4IOQ A;  4LDF A;  4QSW A;  2DMO A;  1UUE A;  2LP5 A;  2B8A A;  4HBW A;  3OW2 S;  1OZ3 A;  3MPU B;  2K79 A;  3OQ5 A;  3OSV A;  4L6V 5;  3RKY A;  2ED0 A;  2NUZ A;  5IAY A;  4E7I A;  4A9F A;  4PLI A;  5CU8 A;  2A36 A;  4HBY A;  3M0T A;  4UC4 A;  1UFF A;  5DW2 A;  4FLP A;  4NRC A;  1EIF A;  3ZEH A;  3JVL A;  1YIT Q;  5CPE A;  3L2Q A;  1VQP T;  4C8Q G;  4ESR A;  4C8Q E;  2EFI A;  5H85 A;  3VRZ A;  4AG2 C;  1UEC A;  5D7U A;  4EMK A;  4RCB A;  5CQX A;  5FB0 A;  4ZC9 A;  5DY7 A;  4C0D B;  5HQ5 A;  1M5Q 1;  1AWO A;  4J1P A;  4KGV B;  4C67 A;  4HCK A;  4LE9 A;  4NS5 A;  4XU3 A;  2EYZ A;  2ZPH B;  4P5N A;  2DRK A;  4QVZ A;  2AHJ B;  2K5F A;  2ED1 A;  1VQ7 T;  1JM4 B;  2SEM A;  5EWV A;  2RS9 B;  3UVY A;  3CXC A;  4EIK A;  3ZL7 C;  2QA4 T;  1QVG S;  4OGI A;  4QST A;  2JTE A;  4C8Q A;  2DIQ A;  1G5V A;  2FVU A;  4KUL A;  2KSS A;  1G3Y A;  4PJL A;  4OB1 B;  4LDY A;  2CZ6 B;  2RJF A;  1S72 A;  5EPB A;  2DRM A;  1M1F A;  2E6Z A;  4IR5 A;  1UGR B;  5FRN A;  3H41 A;  5TCM A;  5KYW B;  1W2B S;  1M3B A;  1D3B B;  4YYG A;  2DM1 A;  3C4S A;  4YY4 A;  5FB1 A;  2JNG A;  3QWY A;  5DW1 A;  4FT4 A;  4DBQ A;  2DA9 A;  1RAB B;  3H8Z A;  4XTV A;  4FYX B;  3HPW A;  1CKA A;  3ER0 A;  5GAN h;  1TUD A;  4CFL A;  4HVU A;  2V26 A;  1U5S A;  5D3R A;  5CQT A;  5A7C A;  5CCA A;  1YJN Q;  1WHM A;  5GAO p;  5C85 A;  1YFN A;  5LJ1 A;  1K0X A;  3M9Q A;  5IGL A;  3E2U A;  4UYF B;  2YLC A;  3ZFJ A;  1YNZ A;  3M57 A;  5FE0 A;  3OSS C;  5IHN A;  2CP7 A;  2LZ6 B;  1PG5 B;  2W10 A;  5KYU B;  4QQD A;  4LRG A;  1FWZ A;  3VS6 A;  4M7A C;  2K2V A;  4BY6 C;  4KGZ B;  3GP8 A;  3CC7 A;  3TRE A;  4KBM B;  2GCX A;  4UIZ A;  2V8I A;  4A54 A;  1GXI E;  4TTE A;  1K1Z A;  2KT1 A;  3TSW A;  5HK3 A;  2R57 A;  1XQH A;  2CGH A;  4BI3 A;  4Z89 A;  4CC2 A;  1QP3 A;  2CP3 A;  2DD5 A;  3G1J A;  3M4G A;  3RMS A;  1A0N B;  1Q81 R;  5LJ3 d;  3EGX A;  2CT3 A;  4J9D A;  3OYF A;  2LQK A;  5D25 A;  1U3O A;  2LT4 A;  2OTL A;  2CP5 A;  3HL8 A;  1RAI B;  4C0F A;  4EMG A;  1KHI A;  3S91 A;  1AHJ B;  1PSF A;  2E70 A;  4C5E A;  4BW2 A;  4PK4 A;  3PMT A;  1ZBX A;  4PCE A;  2M02 A;  5CKF A;  2GFA A;  3EAE A;  4O70 A;  3H0H A;  4RTU A;  2YEL A;  3RCW A;  1JXO A;  4FYW B;  4QQG A;  4HA8 A;  3KFV A;  1ZHI A;  2RI3 A;  2DKW A;  4OGE A;  1WPY A;  3RDV A;  5EWC A;  2LQN A;  5GAN 5;  3OMG A;  4PKC C;  4JLG A;  4YAD A;  4LNP A;  1OZ2 A;  1QWF A;  1GBQ A;  4HXN A;  5FE3 A;  5TB6 A;  1NE8 A;  3UAT A;  3CXC P;  5BT4 A;  2EJ9 A;  3A98 A;  2I7K A;  2LSP B;  1HXD A;  2Y90 A;  2CH4 W;  2GQI A;  5CRM A;  2YUQ A;  4Z8A A;  1Y96 A;  3CC4 Q;  2QQ9 A;  2YXY A;  4A4K A;  4QZS A;  1M90 R;  4D6W A;  1OQK A;  2KDS A;  1YHQ T;  1Q7Y R;  9ATC B;  5F3A A;  1R0B G;  5CQY A;  1M90 U;  4C92 B;  2RHY A;  5GAO m;  1D0X A;  4MR4 A;  1ZQ1 A;  4F7U B;  5DFC A;  2CSI A;  1I0C A;  2K3X A;  2O9V A;  4ZNX A;  3X26 B;  4YYI A;  5GAN 4;  1UE9 A;  2GBQ A;  4BI8 B;  3VU3 C;  2BZY A;  1AZE A;  2JS0 A;  2CSQ A;  4HXO A;  1WJQ A;  2FZK B;  3FB9 A;  4OF1 A;  2L5E A;  5II2 A;  4ZN3 A;  2R0Y A;  3LGF A;  4NUD A;  4WIV A;  3OBW A;  4Y28 E;  3CCV Q;  1WHH A;  3JB9 I;  2JTM A;  3OYL A;  2JN0 A;  1YIJ T;  2JM8 A;  2L3S A;  1VQM T;  1VQ6 A;  2OAW A;  2PNI A;  3A5Z B;  4UYG A;  3NMZ C;  4OB2 B;  2C0I A;  4QYL A;  5DKD A;  1AOJ A;  4BE0 A;  4TZ2 A;  2YRV A;  2KK4 A;  3HTR A;  1K8A R;  1I5L A;  3DLM A;  4WTO B;  2RNX A;  3MUK A;  4MR3 A;  2XK0 A;  3UVW A;  3JRZ A;  4PJO F;  2JZ2 A;  1BI1 A;  1RAD B;  2MWO A;  3OYG A;  3JCM f;  5KCO A;  4JJD A;  5J26 A;  4JZ3 A;  1Y71 A;  5GAN 3;  5EPR A;  5E9Y A;  4QVC A;  4HT8 A;  4J9G A;  1HJD A;  5E74 A;  2QEX T;  4YYN A;  1G8X A;  5HM0 A;  5HKC A;  2DVQ A;  3H9N A;  1PHT A;  5FBX A;  1M30 A;  4AFZ C;  1I07 A;  3G71 Q;  1NYG A;  2EWN A;  3TVT A;  3QUI A;  1I5O B;  3JB9 J;  2X4Y A;  3SVF A;  3DAI A;  5CR2 A;  1YJ9 T;  3CCM Q;  1ZA2 B;  3AT1 B;  4JRK A;  4JUV A;  1KC8 U;  3M0S A;  5DYA A;  3L2U A;  3MEU A;  1ACM B;  3TQ7 P;  4MEQ A;  2K5L A;  1KD1 R;  2E3K A;  2XDP A;  4PJO D;  1YN8 A;  3CXC S;  1UGP B;  4M7D F;  2D9T A;  2BIV A;  2HMA A;  1D3B A;  2DE0 X;  4Y03 A;  5DLO A;  3EG9 B;  4KV1 A;  5GAM g;  5L98 A;  1K4U S;  1B07 A;  4M4Z A;  5D6X A;  2DVR A;  2WSC E;  4CFK A;  1OEB A;  2COW A;  2ZPB B;  4YH4 A;  2XDB A;  3P8B B;  3RUX A;  2PUK B;  1VQN A;  4N0A A;  1HSQ A;  5I86 A;  2P84 A;  4DBH A;  2E1H A;  4AG1 C;  1BKB A;  4Z02 A;  2I2L A;  1AWX A;  4E7H A;  4UYF A;  2HKQ B;  2LRQ A;  4A9N A;  1MND A;  2H60 A;  2LNV A;  1KC8 C;  4O6J A;  5IN1 A;  3CC2 T;  4OP0 A;  2QDY B;  1WZO A;  3I55 T;  4M77 B;  5KYU A;  5D3P A;  3ZYU A;  3MP8 A;  2JXB A;  4EPC A;  1YCS B;  1X69 A;  4M7D D;  1VQ4 A;  4NYX A;  1BI0 A;  1I1J A;  4GPJ A;  2LMJ A;  1RAE B;  3GF5 A;  4MEO A;  1BU1 A;  4Q0O A;  5L99 A;  2O01 E;  1KQS A;  5A5N A;  4A9L A;  4O7F A;  1KG1 A;  4UYE A;  2KT8 A;  1MGQ A;  2G4A A;  2LNH B;  5HY6 A;  3G0J A;  2CP2 A;  2LCS A;  1KK7 A;  2AK5 A;  2RHZ A;  4KUI A;  3QHS A;  1FMV A;  3CCE A;  5ENG A;  1FYN A;  2DZ9 A;  5FG6 A;  4ATO A;  2RNA A;  3P1D A;  5EV9 A;  1NG2 A;  2CKK A;  3CCR A;  3VUB A;  4LZ2 A;  1VQ9 A;  4VUB A;  2WSF E;  5EPS A;  4UIW A;  4N4I A;  2PZ1 A;  5FDZ A;  4DOW A;  2ZAE A;  5F63 A;  4M78 B;  2MPX C;  2FZC B;  4FCY A;  2EYX A;  3HRU A;  1M2O A;  1TUG B;  1I4K 1;  2E5K A;  5C87 A;  2PTK A;  2Z0W A;  5HEM A;  1WJS A;  4X1V A;  2CT4 A;  4C92 G;  4C92 E;  3OBY A;  1B34 B;  2DXU A;  4YBT A;  1G2B A;  1YP5 A;  4AKI A;  4E96 A;  5CY9 A;  1X0J A;  4ZN1 A;  3OYH A;  3EHQ A;  1PWT A;  2JMC A;  4QW2 A;  5C0M A;  4NR9 A;  2YQD A;  2RM4 A;  3PMI A;  2VAS A;  1Q86 R;  2XD0 A;  2RN8 A;  3CD6 Q;  3HMH A;  2FRY A;  1LVK A;  3O35 A;  5L8T A;  5D3S A;  2IG0 A;  4LDX A;  4C92 A;  3ONI A;  1GCP A;  4F7U A;  1YIT A;  4QNS A;  3MCA B;  4XTZ A;  4ELZ C;  3J7A F;  1ARK A;  3MXF A;  4N4F A;  2BE9 B;  5LJ3 h;  5CZG A;  4HBV A;  4CRI A;  3LH0 A;  1U1T A;  3JCM P;  5L97 A;  2RMO A;  2IIM A;  2J6O A;  5GJV B;  5AYF A;  1YI2 Q;  1MNE A;  1VOM A;  3CMA T;  2XDD A;  3P5O A;  4RG2 A;  5GAN g;  2MMP A;  3CCJ T;  4IUQ A;  2DK3 A;  4FIB A;  4AKN A;  4HKE A;  1D0Y A;  4DBF A;  3I56 Q;  4IIM A;  3O34 A;  3JCM d;  2OTJ T;  4Z93 A;  1TXQ A;  2KYM A;  4MML A;  5C4Q A;  3BE3 A;  3HME A;  4XUB A;  1NM7 A;  5DFB A;  2NWM A;  3OS1 A;  3L2R A;  5DLQ E;  2RQU A;  4PJM A;  3KBG A;  3L2W A;  4JZ4 A;  5IGK A;  2RPN A;  5HK0 A;  3GNG A;  4HVV A;  2DIG A;  1X27 A;  2V8J A;  3O5Z A;  5I83 A;  3DB4 A;  2RJD A;  4FW1 A;  5HFQ A;  5KYX A;  2J05 A;  5LUU A;  4NRA A;  4JDS A;  4UIV A;  5CRZ A;  2DTH A;  1QP2 A;  2RI7 A;  1WQW A;  5EK9 A;  2HBW A;  2RA2 A;  4LC2 A;  2PU9 B;  1YJN A;  5A0L A;  4FT2 A;  2KRM A;  2QQB A;  1N72 A;  1UHC A;  5I11 A;  3OYD A;  2DL5 A;  4C8Q F;  4IR6 A;  2EBP A;  5HLS A;  1RUW A;  1IHW A;  3FIF A;  5LVR A;  2F1L A;  1N27 A;  3HFN A;  2L5Q A;  3CBO A;  2V8K A;  2D9E A;  4L5G A;  4J0R A;  1WHJ A;  2DXT A;  3LX7 A;  1KIK A;  3JVK A;  4HXS A;  4M77 G;  4M77 E;  2X3X D;  5FFY A;  1HD3 A;  5COI A;  1DJ7 B;  5CUC A;  3EG9 A;  3A1P A;  3M0Q A;  4LD9 K;  1TOV A;  2EIF A;  4TQN A;  4Q0N A;  3F70 A;  1O75 A;  2EW3 A;  2GTO A;  5F5Z A;  4J9H A;  1OU8 A;  3JSC A;  1M2V B;  1WXB A;  5LKT A;  1SEM A;  2KR3 A;  4Z88 A;  4Z1S A;  3MQM A;  2RJC A;  4YYK A;  1HYO A;  1EX4 A;  4LUD A;  1X6O A;  1N8R C;  4Y92 A;  2DPP B;  1UJY A;  5C7N A;  3QZ5 B;  4CUS A;  1Y96 B;  3G4S Q;  5A5Q A;  4C8Q D;  5A0D A;  4M77 A;  4UYD A;  2DL3 A;  3ME9 A;  3BY7 A;  4AKH A;  4WHU A;  5FH8 A;  5GMK e;  3SVH A;  4NR5 A;  2LQ8 A;  1IGU A;  1S72 T;  4J9I A;  4LZR A;  2LC4 A;  3HRT A;  2D6F A;  2OAU A;  4M78 G;  1M8M A;  4M78 E;  4ZTF A;  5I2M A;  2LDM A;  4L59 A;  4TT2 A;  1NJI R;  1M1K R;  3HMF A;  1NPP A;  2X9H A;  2YWW A;  1CSK A;  2NXB A;  4BHW A;  5CKB A;  4J7F A;  5EWH A;  3UWN A;  4J7I A;  1W6X A;  2DLP A;  1VQ5 Q;  2RQR A;  1Q82 C;  3I5R A;  1WYX A;  3RMQ A;  2LCC A;  4J6Y A;  1WXT A;  5F25 A;  3R6O A;  5LJ3 j;  4IR3 A;  4BD3 A;  5FE7 A;  3CME Q;  1ZUY A;  5KE3 A;  3RER A;  2A3L A;  2GTJ A;  1QW1 A;  2OJ2 A;  5CKH A;  2C06 A;  1VYV A;  1GL5 A;  4M78 A;  3CC4 A;  3HFO A;  1P92 A;  4QEV A;  4JJB A;  2KY9 A;  1PSE A;  3D7S B;  2E6N A;  2LX7 A;  5G4S A;  4HCB A;  1F1B B;  1QCN A;  5HCK A;  5E73 A;  5HQ7 A;  2EAY A;  4WF2 A;  3NTK A;  3CC7 T;  2N9G A;  2HQE A;  1B34 A;  3BDU A;  5GAM f;  4KCX A;  3KXT A;  2DWW A;  1ZX6 A;  3QJY A;  3VV0 A;  1AWW A;  3QBY A;  3A8G B;  4MEN A;  4B6M A;  2K9G A;  4C0Z A;  2DF6 A;  2JUF A;  3CCV A;  4KH0 B;  1NYF A;  4ELY C;  4QC1 A;  1TTH B;  3ULR B;  2OTL T;  4QB3 A;  5FE8 A;  3HKS A;  2MI6 A;  3JB9 G;  1RLQ C;  3QG1 A;  4F04 B;  1N9R A;  2YRD A;  3MET A;  4J5Y A;  2KNB B;  3E9G A;  5D24 A;  2L3R A;  5HQ6 A;  5CVI A;  2HQH A;  5L96 A;  2F5T X;  2CH4 A;  2DO3 A;  1K0S A;  1VIE A;  2E5Q A;  4KV4 A;  4Z6I A;  5GMK m;  4NYW A;  4AKG A;  5DLZ A;  4FM4 B;  4XK8 E;  4ZGJ B;  2VYT A;  4LXC A;  1W4S A;  5ECA A;  3CPF A;  1OOT A;  3OY9 A;  1M4Z A;  2QDL A;  5HEL A;  4CC3 A;  4HXK A;  8AT1 B;  4CUR A;  2DIL A;  1VUB A;  1S1N A;  5IID A;  5CUB A;  1C6V X;  2CUB A;  1CKB A;  1U06 A;  4UIY A;  3G71 A;  2QG9 B;  4FSS A;  4ZTJ A;  2J06 A;  2BZ8 A;  4TYL A;  4DA4 A;  3DWY A;  4PJJ A;  3PIP A;  4IUR A;  2D0Q B;  1BIB A;  3OYC A;  1BCO A;  2YW5 A;  3CCM A;  3DB3 A;  3CCU Q;  1LPL A;  3V8L A;  2EGC A;  2AKK A;  2RD1 A;  5ETD A;  4Y91 A;  2FRW A;  5IH2 A;  3X28 B;  4JRI A;  2MOX A;  3MUL A;  4YH3 A;  2R10 A;  1LOJ A;  4E6R A;  4R56 A;  2XIC A;  5FU7 C;  2OUO A;  3MEV A;  4NR4 A;  1D1C A;  3TCJ A;  2M9U A;  5FH7 A;  5E9I A;  3DLL A;  4HXJ A;  5AT1 B;  2KTB B;  3AHU A;  2K7A A;  3M5A A;  4C5G A;  4E7K A;  1RAG B;  2ATC B;  2EJF A;  4M7A B;  5LJ3 e;  4BY6 B;  2L3Q A;  3LYI A;  1KQ2 A;  4NQN A;  4HCZ A;  3JB9 H;  4OMM A;  1VQ6 T;  3I35 A;  4A4F A;  4PTB A;  2R0V A;  3OMC A;  3GG3 A;  4PJO C;  2FB7 A;  5F1H A;  1SHF A;  3VS2 A;  4TS8 A;  4LYS A;  1PD0 A;  3RR6 A;  1I81 A;  4OVA A;  5GAO l;  3EHR A;  3NHN A;  3X20 B;  4C5H A;  3U5P A;  5I21 A;  1QMC A;  4PFZ A;  2FZG B;  2QAS A;  1VQ8 Q;  2K57 A;  3JCM h;  2EGA A;  5ETB A;  3EG3 A;  3MB3 A;  5A85 A;  1M2V A;  2RQV A;  1PUO A;  1UJ0 A;  4XTX A;  3CCS Q;  4ZGD B;  3G7Z A;  2RI5 A;  3G6E Q;  1BI2 A;  5E0R A;  2F2X A;  2EJN A;  1ABO A;  3VS0 A;  5A5O A;  3KUF A;  3D1D A;  3M4Y A;  3V7C A;  5GAN f;  5FW9 A;  2FG0 A;  4FU6 A;  3CCL Q;  1YCY A;  5FE2 A;  5EIC A;  4RVR A;  2DBK A;  1YJW Q;  5ENB A;  2NUP A;  1WUM A;  4M7D C;  5CTL A;  6AT1 B;  2YEK A;  5KHM A;  3M55 A;  2DJZ A;  3OB9 A;  4WHW A;  2X4W A;  3FEO A;  4E7Z A;  3QZ9 B;  1K9A A;  3AAD A;  4A9H A;  3C94 A;  1Q81 C;  5E3D A;  2E64 A;  2JVV A;  3EFR A;  5D26 A;  1VQK Q;  3PVL A;  2CZ7 B;  2FYK A;  4AMC A;  3GBQ A;  3GNF B;  4FYV B;  4KUD K;  5KYN A;  4DQ2 A;  1VQN T;  5GAO r;  3QSU A;  2RNY A;  5IT9 E;  3UVX A;  4MR6 A;  4TT4 A;  2L84 A;  1ZUU A;  5C8G A;  1MMG A;  3UA7 A;  1VQL Q;  3J80 E;  3CD6 A;  5E9V A;  5D3L A;  4CUT A;  4DOV A;  4LR6 A;  4RG8 A;  5GAM d;  2BUD A;  2NUT A;  1E6G A;  5KTW A;  2DJQ A;  5D0C A;  1X6G A;  1ZSZ C;  3EH2 A;  4A4E A;  1QKW A;  3U5N A;  1VQ4 T;  4XU0 A;  5I22 A;  2AZS A;  3UF4 A;  1C1A A;  2EQK A;  2EQU A;  3LGL A;  4LD6 A;  3NPF A;  4GLM A;  2H3J A;  3LH5 A;  2CZ0 B;  4X34 A;  2RF0 A;  3M58 A;  2DYI A;  1TS9 A;  3OYM A;  1Q7Y C;  5KYX B;  3CCQ Q;  4Q5W A;  4UIU A;  3PTA A;  4DEX A;  3CCE T;  1OPK A;  1VQO Q;  5EGU A;  5CP5 A;  5GMK h;  1YI2 A;  4TT6 A;  2ZCF B;  1KQ1 A;  3MP6 A;  3CCR T;  5CQ6 A;  4O71 A;  2WSE E;  5LJ5 f;  1ZLM A;  1VQ9 T;  1KC8 R;  2RFJ A;  1MMN A;  5EP7 A;  3I56 A;  2MIO A;  4J3I A;  3RBB B;  4YYM A;  5DM7 R;  4DBR A;  2V1Q A;  2OO1 A;  1NEG A;  3ASK A;  4C92 F;  3MEW A;  3S3N A;  1QVF A;  5H1T A;  1BI3 A;  3EGU A;  4FL6 A;  3ERR A;  1G3W A;  2LJ0 A;  1VQP Q;  2MYS A;  3LLR A;  4MMK A;  5D7X A;  2FPF A;  3HRS A;  2DXB A;  3OYE A;  2F2V A;  1TH7 A;  1D1B A;  2CP6 A;  1X6B A;  2VUB A;  1M1G A;  2BE7 D;  2E12 A;  4DEY A;  1LNX A;  2RHI A;  4BDZ A;  2YYN A;  4QY4 A;  2DL4 A;  4QT7 A;  3BFM A;  3LQH A;  3BW1 A;  3QDF A;  5KH6 A;  3PVQ A;  2EKO A;  1VQ7 Q;  4M7A G;  5I80 A;  4M7A E;  4E7J A;  4LZS A;  1ABQ A;  3FKM X;  1H8K A;  1E7O A;  1WIE A;  4HXM A;  4QEU A;  2QA4 Q;  2VGM A;  3SFM A;  4QSQ A;  2R5M A;  2YSQ A;  5DX4 A;  4C92 D;  1SRM A;  3LW5 E;  5E3G A;  2P4R A;  1YIT T;  4HXR A;  2FO0 A;  5GAN 6;  3U5L A;  4PKL A;  5ENE A;  3OYN A;  2KRN A;  2A28 A;  3QYH B;  4ALG A;  2VB6 A;  4QUT A;  4A9J A;  4BW4 A;  3SWN C;  3VS4 A;  2DYB A;  1SPK A;  3UV2 A;  1KD1 C;  4NR8 A;  1IXD A;  4M7A A;  2R0S A;  2H8H A;  3VUZ A;  5F62 A;  5CUA A;  1Y07 A;  1XJW B;  2GF7 A;  2GGR A;  4O78 A;  4O77 A;  3OW2 A;  1WJR A;  1XOV A;  5A82 A;  5EU1 A;  2QQR A;  3Q2F A;  3L1A A;  5D3T A;  2DNU A;  3L2V A;  2R58 A;  2FL7 A;  2KGT A;  4RTY A;  3QJ6 A;  4QBM A;  3G4S A;  1IO6 A;  2CDT A;  1PRL C;  4EDU A;  4JS5 A;  4HT9 A;  4J6X A;  1JSP B;  3MP1 A;  3TEE A;  1MMA A;  3GLX A;  3V8K A;  4EMK C;  2CRE A;  2A7Y A;  5CKD A;  3PGG A;  5J0D A;  2CUD A;  4F7U G;  4F7U E;  1X2K A;  2XI9 A;  2L0A A;  4F16 A;  5GAN d;  4JS4 A;  4PJO A;  2ROL A;  3VKI A;  5FE4 A;  1PC0 A;  2J7I A;  4YK0 A;  5HFR A;  4CLB A;  4X9D A;  4E47 A;  4HCC A;  2QQA A;  4GBQ A;  2HQX A;  1VQ5 A;  2YUP A;  5FU6 C;  5ENJ A;  5KTU A;  1LJO A;  3Q2E A;  2A0F B;  1IGQ A;  4C8Q C;  4BDY A;  4M75 C;  1YJN T;  2DVJ A;  2QXF A;  3A8L B;  2KBT A;  3CME A;  1WHL A;  1B3Q A;  5DFD A;  5F1L A;  1YBY A;  5F2P A;  5EWW A;  3M59 A;  3JCM b;  4X2I A;  3FJP A;  2YLB A;  4YAB A;  2DFU A;  5AD2 A;  1KSW A;  4M77 F;  1QVF P;  2HNI A;  1BYM A;  5GMK j;  2E4H A;  5F36 A;  2E65 A;  1X01 A;  2Y4X A;  3U23 A;  2BKD N;  4F17 A;  1K73 C;  5E9L A;  5I7Y A;  1C0M A;  3UT1 A;  1WUG A;  3LWI A;  1JO8 A;  1W2B A;  3MJX A;  4A9O A;  4M75 B;  4HBX A;  3U5M A;  2DVV A;  2K5I A;  3QO3 A;  3OYA A;  2FPD A;  4HXP A;  4MEP A;  2K4Y A;  4M7D A;  4PL6 A;  5IGM A;  4NR7 A;  4RMO A;  1PKT A;  2CP0 A;  3JCM e;  2DBM A;  2M1H A;  2RO0 A;  4FSX A;  4YBM A;  4X9C A;  2DD4 A;  2XID A;  1ZKR A;  4FYY B;  4YBS A;  4J8O A;  2BTT A;  1K9M U;  3FRN A;  1Y57 A;  2D8J A;  2F6N A;  5IGN A;  4M77 D;  4M78 F;  4TU4 A;  3CPW A;  1GCQ C;  5GMK i;  1KQS P;  1YHQ Q;  1Q86 C;  2ZPE B;  1QLY A;  4J83 A;  3LWH A;  2DEU A;  1D0Z A;  4RUG A;  3S3M A;  2L85 A;  5LJ5 e;  4WCI A;  1BB9 A;  5LJ5 d;  4IR4 A;  2VWF A;  4O74 A;  3AQA A;  1ZSZ A;  1QCF A;  5IHK A;  3MB4 A;  4LYW A;  1IRX A;  2ESW A;  4AFU C;  3P1F A;  1WGS A;  2RHU A;  1PKS A;  1LCK A;  3M0U A;  3OS2 A;  4Z1Q A;  3T9N A;  3JCM Q;  3VYH B;  1MUZ A;  1N8R U;  4ZGE B;  5LL6 S;  3C12 A;  1YIJ Q;  1EZZ B;  4MDX A;  1K9M C;  1ZS5 A;  5FE5 A;  5HCL A;  1VQM Q;  4M78 D;  4O72 A;  2X3W D;  3A8O B;  4JRP A;  1GFC A;  2FSA A;  3CC4 T;  2EPD A;  4QSV A;  1V1C A;  3R6N A;  1UDL A;  2EGE A;  3CCU A;  2EQI A;  4IUP A;  3DKM A;  3FJ5 A;  5D3J A;  2DEQ A;  2AT1 B;  1OYX A;  5LJ0 A;  1N5Z A;  3NTH A;  4QR3 A;  3TU4 K;  1RLP C;  1Q82 R;  4BAC A;  1QVF S;  1Q82 U;  1WI7 A;  3JCM g;  5GAM h;  1T3L A;  4AFS C;  1PRM C;  2HL3 A;  2L3P A;  4BW3 A;  4NUE A;  4QSX A;  3MHX A;  2QEX Q;  5FWC A;  3CCV T;  3JB9 F;  3CBP A;  2DVE A;  1NLO C;  1W1F A;  3HSB A;  4YC9 A;  2HDA A;  1IRE B;  2KXC A;  5JWM A;  2NUP B;  4IOO A;  5D3N A;  1M3A A;  4HVW A;  1JU5 C;  3QII A;  1YJ9 Q;  1K76 A;  2RB6 A;  2WP2 A;  2O4X A;  2D1X A;  5L23 A;  5H1U A;  3MEA A;  5D6Y A;  5CQ8 A;  3JCM X;  2JW4 A;  4N4G A;  2EVR A;  5BT5 A;  3PE0 A;  5E9M A;  4IUT A;  1VQ8 A;  2DX1 A;  5DLX A;  5FG5 A;  2P0Q A;  2VXE A;  4IUU A;  2P0K A;  1UGQ B;  2M0Y A;  4PNO A;  5J39 A;  4Z6H A;  3GOX A;  3V7S A;  4KH1 B;  1KQS S;  3CCS A;  3G6E A;  5C6S A;  3JB9 D;  1O9S A;  1WX6 A;  2K3B A;  2YT6 A;  1GRI A;  4KT0 E;  1M8V A;  1OI1 A;  2K3Y A;  2DAT A;  4C5I A;  4IKF A;  4J9C A;  3CBM A;  2YUO A;  3CCL A;  5FLX E;  3G71 T;  3SWN A;  4A9K A;  2DL8 A;  3OS5 A;  2ZPF B;  2NUT B;  3A8H B;  3FDR A;  3CPW P;  3JVJ A;  1MV0 B;  1QCO A;  4DON A;  1D1A A;  1NLP C;  1YJW A;  2DVS A;  4OGC A;  2W0Z A;  3CCM T;  1TU0 B;  2ZPI B;  3CC2 Q;  2HKN A;  3VS1 A;  4PCI A;  2KRO A;  3I55 Q;  1SSF A;  2JOY A;  4R0K A;  4NXJ A;  4AFQ C;  4C0D C;  4V2S A;  1UG1 A;  4UIT A;  2DAQ A;  5I2S A;  3CQT A;  3LJW A;  1OUL A;  2MK5 A;  5E9K A;  2O31 A;  5GMK l;  4F3I A;  4O7B A;  4NL3 A;  5DYU A;  1NBE B;  4J9B A;  4M75 G;  1VQK A;  1BK2 A;  4M75 E;  4J6W A;  1V76 A;  5CS8 A;  1RAC B;  4XTY A;  3EG1 A;  1J3T A;  2F6J A;  2FEI A;  4B9X A;  4BB7 A;  5DYC A;  1ZSG A;  2BZX A;  5CIU A;  5EI4 A;  1NJI C;  1M1K C;  2XMF A;  3EGD B;  4CUP A;  1T3S A;  2CYZ B;  5I7X A;  3P8D A;  3VS5 A;  3OYI A;  1VQL A;  5FFV A;  3SDZ A;  5A5R A;  2EYQ A;  3RKX A;  1PM3 A;  3REA B;  4JPB W;  2PUO B;  4YAT A;  5L8U A;  3VS7 A;  2I8N A;  4M75 A;  3REB B;  2QGF B;  4KGX B;  3V8J A;  1RAA B;  4NUC A;  4FW2 A;  1OX9 A;  5FG4 A;  1XTD A;  4OUF A;  1B7T A;  2D8H A;  5CO7 A;  5M9O A;  3O37 A;  5HRV A;  2VV5 A;  2P0P A;  5ACY A;  1ZBJ A;  1W70 A;  1UHF A;  4N0A C;  5HRX A;  3JAM E;  1ZA1 B;  3VYG A;  4O5V A;  4OB3 B;  3CCQ A;  3Q1J A;  5GAN 8;  2RK1 A;  1VQO A;  1WFW A;  4QSS A;  2ZPG B;  1AVZ C;  2DL7 A;  2DER A;  3H0F A;  1OU9 A;  2A37 A;  5LJ2 A;  4YYD A;  5HJC A;  5AMF A;  1Y0M A;  5GAM j;  5EG2 A;  2H3E B;  2IPO B;  4CI0 C;  2DTI A;  3VRY A;  3O33 A;  1HK9 A;  3SVG A;  2QTX A;  4LDW A;  4O76 A;  2B86 A;  5ENF A;  1RAH B;  1ZUK A;  2QYZ A;  4JJN K;  5GAO q;  2DZC A;  3INZ A;  1VQP A;  3WVD B;  4XQ3 A;  1M9S A;  3EFO B;  2KMT A;  3IU6 A;  3I5S A;  3CPW S;  3UW9 A;  5D6W A;  4BE1 A;  4NL2 A;  5I88 A;  2EQM A;  2CS7 A;  2G6F X;  5DYX A;  4ZQL A;  3UV4 A;  1GCQ A;  2RQT A;  4A53 A;  2JM9 A;  5A83 A;  1T0H A;  1UEB A;  4UIX A;  5E7D A;  5IXB A;  2NLU A;  4OMN A;  2J6F A;  2QQS A;  2ZZD A;  4O7A A;  2OX7 A;  3WXM B;  5FU7 B;  3NTI A;  3CMA Q;  2RQW A;  1VQ7 A;  3CCJ Q;  3OS0 A;  3CD6 T;  3URG A;  1IHV A;  4NQM A;  2OTJ Q;  3A8M B;  2QA4 A;  2WAC A;  3X24 B;  1VYU A;  2ZGW A;  2RNW A;  2COZ A;  3HP9 A;  1Q81 U;  1MV3 A;  4A9M A;  4RTV A;  1QQJ A;  5CKE A;  4PJN A;  5A81 A;  1WLP B;  5GAN 7;  2QI2 A;  4OML A;  5EVA A;  2F69 A;  1WNL A;  4YAX A;  4NYV A;  3E19 A;  2HZY A;  4A63 B;  4PJO B;  2HD0 A;  5GAN 2;  2LT1 A;  1WXU A;  3SHW A;  1EQF A;  3LXJ A;  3M56 A;  2M16 A;  3QDR B;  2C0T A;  1Z9Q A;  5KYY B;  5LKZ A;  3QZV A;  1YI2 T;  3UDC A;  3NFC A;  3JCM V;  3UV5 A;  5AD3 A;  1AEY A;  3LQJ A;  2QK0 A;  4QQ6 A;  2ENM A;  3IQL A;  4C92 C;  3I56 T;  2D82 A;  4GY5 A;  1NEB A;  5LJ5 h;  2JMA A;  5DKH A;  2KRS A;  4XTU A;  5GJW B;  1GFD A;  2RO1 A;  4MR5 A;  4CUU A;  1R8O B;  2PVO B;  2XG8 D;  1JB0 E;  1N6A A;  2X4J A;  2HSP A;  3ZBD A;  3D7C A;  2GQV A;  2YRC A;  2VGN A;  4A9I A;  5LJ3 g;  4LYI A;  4R55 A;  4M7D B;  1E6I A;  2I0N A;  1QKX A;  4CC7 A;  1Q7Y U;  4MZP A;  4NR6 A;  1RAF B;  3P1C A;  1RI9 A;  1GBR A;  2EYW A;  4M7A F;  2G3R A;  1PCX A;  3NGP A;  3D1B A;  4A4H A;  2X51 A;  4QSR A;  2AZV A;  5CUD A;  5DKC A;  3VKH A;  2WP1 A;  3RKW A;  3OYJ A;  4LN2 A;  2E41 A;  2VXF A;  4K11 A;  1H92 A;  2E3I A;  3OYK A;  4JLI A;  5IXF A;  2EYY A;  5GAM e;  1I8F A;  5HEN A;  1JXM A;  2HSE B;  2KE9 A;  3S92 A;  2MF2 A;  2HL5 C;  4B9W A;  4AT1 B;  5CUE A;  5A0G A;  1OPL A;  4XU2 A;  5IHI A;  2YUN A;  3S6W A;  1OX8 A;  2HBP A;  3PT9 A;  5FWB A;  3M54 A;  4A4G A;  1S72 Q;  1X43 A;  2IVW A;  3QXE B;  4II1 A;  1R77 A;  2O2O A;  1VIF A;  1M90 C;  5GAN j;  1K8A U;  3PNW C;  2YEM A;  4XY9 A;  1ZSZ B;  2L2P A;  5CAI A;  2F5K A;  4XY8 A;  4M7A D;  2LJ1 A;  3FLG A;  1U8R A;  2E7N A;  4UYH A;  5CUG A;  2EQJ A;  4JJC A;  5CQ5 A;  2XKO C;  4AI6 A;  4YYH A;  5A2Q E;  2DTO A;  3MO8 A;  3JCM c;  3EGD A;  3IU5 A;  3EG2 A;  2XU8 A;  5KU3 A;  1VA7 A;  4XTW A;  4OMP A;  4O75 A;  3G4S T;  1SSH A;  2X35 A;  5FH6 A;  3P8H A;  2KYB A;  2PQW A;  1TUC A;  2DXC A;  4F7U F;  1X75 C;  5BT3 A;  1H3Z A;  2DKG A;  2NYS A;  1AD5 A;  3RIR A;  2O88 A;  1JEG A;  1U1S A;  4ANJ A;  3QPH A;  2O9S A;  1YHQ A;  3QWX X;  2Y4Y A;  4PFO A;  4TVR A;  2PVG B;  2K2M A;  2D0N A;  2X4X A;  2GRC A;  1K8A C;  2JT4 A;  2M51 A;  4RTX A;  4CC4 B;  3L42 A;  3GIB A;  3CC7 Q;  3NXB A;  3O8V A;  1KD1 U;  4RKU E;  2LTO A;  1JRI A;  2ECZ A;  3PFS A;  1WQ7 A;  5KYW A;  3M53 A;  3H6Z A;  1VQ5 T;  5I40 A;  3THK A;  2KXD A;  3C0C A;  2GFU A;  5C89 A;  1N9S A;  4MZT A;  4QVD A;  3S3O A;  1IZ6 A;  2FHD A;  2E3H A;  1QWE A;  4M77 C;  4BJX A;  3CME T;  4A9E A;  1YIJ A;  4ALH A;  1NPR A;  3UVD A;  1M27 C;  1VQM A;  2OTL Q;  1TSF A;  2A08 A;  1KHC A;  2RHX A;  2O4X B;  1MMD A;  2JTF A;  1WA7 A;  3K2J A;  2DET A;  3TLP A;  3EFS A;  5EC7 A;  2MCN A;  4HXL A;  1H3H A;  2RH2 A;  4E7L A;  1M3C A;  4QSP A;  5D3H A;  5FFW A;  3EFO A;  4QYD A;  2PVD B;  2HAX A;  1JJ2 A;  5LJ5 j;  2MAM A;  2VVK A;  4MZM A;  4E7S A;  4PLL A;  4RTT A;  1QVP A;  1BIA A;  1NZ9 A;  3O36 A;  1JBM A;  4PJO G;  4PJO E;  5EM3 A;  1FMW A;  3I3J A;  4PY6 A;  5A5S A;  1AT1 B;  3RNJ A;  3OYB A;  8ATC B;  2QEX A;  3H0I A;  4QSU A;  1UGS B;  4M78 C;  3X25 B;  2YDW A;  5CGP A;  3SWN B;  4N4H A;  4BUG A;  5ENC A;  5GAO n;  1IB8 A;  4LUE A;  2LQW A;  1WHG A;  1V29 B;  2KVQ G;  4YY6 A;  3M0R A;  3U5K A;  3VS3 A;  3BDL A;  1SG5 A;  1K73 R;  2KQW A;  1EFN A;  4IIO A;  1YJ9 A;  1K73 U;  2F2W A;  5I1Q A;  2M0O A;  2LJ3 A;  5GAN e;  3SEM A;  3U5O A;  4QKU A;  5CQ4 A;  1BBZ A;  5A5P A;  5L8R E;  5K29 A;  5LVQ A;  2LVM A;  2ROT A;  4PS5 A;  4OGJ A;  1FX7 A;  1SKU B;  4EMK B;  5KYY A;  1MHN A;  4ORZ A;  4M7D G;  5FRO A;  4RCC A;  4M7D E;  2JJ9 A;  2XHC A;  1G83 A;  1QVG A;  2J6K A;  1UTI A;  4RTW A;  5ENH A;  2ABL A;  4J9F A;  4XAX B;  3VJP A;  5CQ3 A;  2MJV B;  1VQ6 Q;  4QR4 A;  4QUU A;  3P1E A;  5FU6 B;  5II1 A;  4ZW1 A;  5CQ7 A;  3CCU T;  1Q86 U;  3G0L A;  4C8Q B;  2YDL A;  4CUQ A;  3CC2 A;  3I55 A;  3CEY A;  5DY9 A;  4C0G A;  5EIS A;  3J81 E;  2V1R A;  2KAF A;  3QZS A;  5FE9 A;  2EKH A;  3V7R A;  5ENI A;  2C0O A;  3UPU A;  4PFP A;  1KJW A;  1Q95 G;  2OSS A;  4EMH A;  3OA6 A;  1RI0 A;  3JCM W;  3OYY A;  4O7C A;  2P4T A;  4RTZ A;  5EQ1 A;  5J3B A;  2HEQ A;  3QKJ A;  4XYA A;  1K9M R;  1TG0 A;  1E6H A;  3L2Z A;  2QTV A;  2YHT A;  4LDV A;  5FE6 A;  4D8K A;  1F68 A;  1OV3 A;  3M0P A;  5CK9 A;  1RL2 A;  2E10 A;  4IOR A;  3QZT A;  5I89 A;  1TWB A;  5KO4 A;  2RK2 A;  2AIR B;  5DBM A;  2L8D A;  3I9Q A;  2AKL A;  2JS2 A;  3VKG A;  3EG0 A;  1BCM A;  4IUV A; 
#chains in the Genus database with same CATH homology
 2CZ1 B;  5I29 A;  4XUA A;  3U5J A;  3SB2 A;  1VQ8 T;  5H1V A;  5IG6 A;  5F60 A;  4O7E A;  5FE1 A;  3CCS T;  4TU6 A;  1G3T A;  3G6E T;  4N3W A;  2E7O A;  4CL9 A;  4LDU A;  3PIO A;  4J0S A;  4YYJ A;  3CCL T;  2L89 A;  3JCM J;  5LKU A;  4QR5 A;  4C66 A;  5JI8 A;  5F61 A;  4OB0 B;  1YJW T;  3E1S A;  4QEW A;  3E9F A;  2RJE A;  4MDW A;  5CQA A;  2LCL A;  3WVE B;  5KE2 A;  3GPL A;  4M75 F;  5KTX A;  5LJ3 f;  4BE2 A;  2LX9 A;  3QYG B;  3JVM A;  1VQK T;  5FRM A;  4OMF B;  2EJG A;  5IBN A;  4NOY A;  5HRW A;  5KCH A;  1FXX A;  3C95 A;  3RES A;  1Y7X A;  1XNI A;  3CMA A;  5AME A;  1H64 1;  1VQL T;  3SD4 A;  3CCJ A;  1UB4 A;  5LKX A;  1G3S A;  3N5B B;  4TZ8 A;  5LJ5 g;  2OTJ A;  2VC8 A;  5EWD A;  5CFW A;  4QC3 A;  4YTL A;  4M75 D;  5EA1 A;  4BW1 A;  2RI2 A;  3FC3 A;  4XU1 A;  4ME7 A;  4GLK A;  4JRQ A;  4NRB A;  3HHT B;  3LQI A;  5G4R A;  3CCQ T;  2R5A A;  2MWP A;  1JJ2 S;  1NJI U;  1M1K U;  1VQO T;  4BI4 A;  4IOQ A;  4LDF A;  4QSW A;  2B8A A;  4HBW A;  3OW2 S;  1OZ3 A;  3OQ5 A;  3OSV A;  4L6V 5;  3RKY A;  5IAY A;  4E7I A;  4A9F A;  4PLI A;  5CU8 A;  4HBY A;  4UC4 A;  5DW2 A;  4FLP A;  4NRC A;  1EIF A;  3ZEH A;  3JVL A;  5CPE A;  3L2Q A;  1VQP T;  4C8Q G;  4C8Q E;  2EFI A;  5H85 A;  4EMK A;  4RCB A;  5CQX A;  5FB0 A;  4ZC9 A;  5DY7 A;  4C0D B;  5HQ5 A;  1M5Q 1;  4J1P A;  4C67 A;  4NS5 A;  4XU3 A;  2ZPH B;  4P5N A;  4QVZ A;  2AHJ B;  2K5F A;  1VQ7 T;  1JM4 B;  5EWV A;  2RS9 B;  3UVY A;  3CXC A;  2QA4 T;  1QVG S;  4OGI A;  4QST A;  4C8Q A;  2DIQ A;  1G5V A;  2FVU A;  4KUL A;  2KSS A;  1G3Y A;  4OB1 B;  4LDY A;  2CZ6 B;  2RJF A;  1S72 A;  5EPB A;  1M1F A;  2E6Z A;  4IR5 A;  1UGR B;  5FRN A;  5TCM A;  1W2B S;  1D3B B;  4YYG A;  3C4S A;  4YY4 A;  5FB1 A;  2JNG A;  5DW1 A;  4FT4 A;  3H8Z A;  4XTV A;  3HPW A;  3ER0 A;  5GAN h;  4CFL A;  5D3R A;  5CQT A;  5A7C A;  5CCA A;  5GAO p;  5C85 A;  5LJ1 A;  3M9Q A;  5IGL A;  4UYF B;  2YLC A;  3ZFJ A;  3M57 A;  5FE0 A;  3OSS C;  4QQD A;  4LRG A;  1FWZ A;  4M7A C;  2K2V A;  4BY6 C;  3GP8 A;  3CC7 A;  3TRE A;  4KBM B;  2GCX A;  4UIZ A;  2V8I A;  4A54 A;  1GXI E;  4TTE A;  5HK3 A;  2R57 A;  1XQH A;  2CGH A;  4BI3 A;  1QP3 A;  2DD5 A;  3M4G A;  3RMS A;  5LJ3 d;  3OYF A;  2LQK A;  5D25 A;  2OTL A;  2LT4 A;  3HL8 A;  4C0F A;  4EMG A;  1KHI A;  3S91 A;  1AHJ B;  1PSF A;  2E70 A;  4C5E A;  4BW2 A;  3PMT A;  1ZBX A;  4PCE A;  5CKF A;  2GFA A;  3EAE A;  4O70 A;  2YEL A;  3RCW A;  4QQG A;  4HA8 A;  1ZHI A;  2RI3 A;  2DKW A;  4OGE A;  1WPY A;  5EWC A;  5GAN 5;  3OMG A;  4PKC C;  4JLG A;  4YAD A;  1OZ2 A;  4HXN A;  5FE3 A;  5TB6 A;  1NE8 A;  5BT4 A;  2EJ9 A;  2I7K A;  2LSP B;  1HXD A;  2Y90 A;  5CRM A;  1Y96 A;  2QQ9 A;  4A4K A;  4QZS A;  4D6W A;  2KDS A;  1YHQ T;  5F3A A;  5CQY A;  1M90 U;  4C92 B;  2RHY A;  5GAO m;  4MR4 A;  1ZQ1 A;  4F7U B;  5DFC A;  2K3X A;  3X26 B;  4YYI A;  5GAN 4;  4BI8 B;  3VU3 C;  4HXO A;  1WJQ A;  3FB9 A;  4OF1 A;  2L5E A;  5II2 A;  4ZN3 A;  2R0Y A;  3LGF A;  4NUD A;  4WIV A;  3OBW A;  4Y28 E;  3JB9 I;  2JTM A;  3OYL A;  2JN0 A;  1YIJ T;  1VQM T;  1VQ6 A;  3A5Z B;  4UYG A;  4OB2 B;  4QYL A;  5DKD A;  4BE0 A;  4TZ2 A;  2YRV A;  2KK4 A;  1I5L A;  3DLM A;  2RNX A;  3MUK A;  4MR3 A;  2XK0 A;  3UVW A;  3JRZ A;  4PJO F;  2JZ2 A;  1BI1 A;  2MWO A;  3OYG A;  3JCM f;  5KCO A;  5J26 A;  1Y71 A;  5GAN 3;  5EPR A;  5E9Y A;  4QVC A;  4HT8 A;  5E74 A;  2QEX T;  4YYN A;  5HM0 A;  5HKC A;  2DVQ A;  5FBX A;  2EWN A;  3QUI A;  3JB9 J;  2X4Y A;  3SVF A;  3DAI A;  5CR2 A;  1YJ9 T;  4JRK A;  4JUV A;  1KC8 U;  3L2U A;  5DYA A;  3MEU A;  4MEQ A;  2K5L A;  2E3K A;  2XDP A;  4PJO D;  3CXC S;  1UGP B;  4M7D F;  2D9T A;  2BIV A;  1D3B A;  4Y03 A;  5DLO A;  4KV1 A;  5GAM g;  5L98 A;  5D6X A;  2DVR A;  2WSC E;  4CFK A;  2ZPB B;  2XDB A;  4YH4 A;  3P8B B;  3RUX A;  2PUK B;  1VQN A;  4N0A A;  5I86 A;  2E1H A;  1BKB A;  4Z02 A;  2I2L A;  4E7H A;  4UYF A;  2LRQ A;  4A9N A;  2H60 A;  2LNV A;  1KC8 C;  4O6J A;  5IN1 A;  3CC2 T;  4OP0 A;  2QDY B;  3I55 T;  4M77 B;  5D3P A;  3ZYU A;  3MP8 A;  4EPC A;  4M7D D;  1VQ4 A;  4NYX A;  1BI0 A;  4GPJ A;  3GF5 A;  4MEO A;  4Q0O A;  5L99 A;  2O01 E;  1KQS A;  5A5N A;  4A9L A;  4O7F A;  1KG1 A;  4UYE A;  1MGQ A;  2G4A A;  5HY6 A;  3G0J A;  2RHZ A;  4KUI A;  3QHS A;  3CCE A;  5ENG A;  2DZ9 A;  5FG6 A;  4ATO A;  3P1D A;  5EV9 A;  2CKK A;  3CCR A;  3VUB A;  4LZ2 A;  1VQ9 A;  4VUB A;  2WSF E;  5EPS A;  4UIW A;  4N4I A;  5FDZ A;  4DOW A;  5F63 A;  4M78 B;  3HRU A;  1I4K 1;  5C87 A;  5HEM A;  1WJS A;  4C92 G;  4C92 E;  3OBY A;  1B34 B;  2DXU A;  4YBT A;  4E96 A;  5CY9 A;  1X0J A;  4ZN1 A;  3OYH A;  4QW2 A;  5C0M A;  4NR9 A;  2YQD A;  2RM4 A;  3PMI A;  2XD0 A;  3HMH A;  3O35 A;  5L8T A;  5D3S A;  2IG0 A;  4LDX A;  4C92 A;  3ONI A;  4F7U A;  1YIT A;  4QNS A;  3MCA B;  4XTZ A;  4ELZ C;  3J7A F;  3MXF A;  4N4F A;  5LJ3 h;  5CZG A;  4HBV A;  4CRI A;  3LH0 A;  1U1T A;  3JCM P;  5L97 A;  5AYF A;  3CMA T;  2XDD A;  3P5O A;  4RG2 A;  5GAN g;  2MMP A;  3CCJ T;  4IUQ A;  2DK3 A;  4FIB A;  4AKN A;  4HKE A;  3O34 A;  3JCM d;  2OTJ T;  4Z93 A;  4MML A;  5C4Q A;  3HME A;  4XUB A;  3OS1 A;  5DFB A;  3L2R A;  5DLQ E;  3KBG A;  3L2W A;  5IGK A;  5HK0 A;  3GNG A;  2DIG A;  2V8J A;  5I83 A;  3DB4 A;  2RJD A;  5HFQ A;  5LUU A;  4NRA A;  4JDS A;  4UIV A;  5CRZ A;  2DTH A;  1QP2 A;  2RI7 A;  1WQW A;  5EK9 A;  2RA2 A;  4LC2 A;  2PU9 B;  1YJN A;  5A0L A;  4FT2 A;  2QQB A;  1N72 A;  3OYD A;  4C8Q F;  4IR6 A;  5HLS A;  3FIF A;  5LVR A;  1N27 A;  3HFN A;  2L5Q A;  3CBO A;  2V8K A;  2D9E A;  4L5G A;  4J0R A;  2DXT A;  3LX7 A;  3JVK A;  4HXS A;  4M77 G;  4M77 E;  5FFY A;  5COI A;  1DJ7 B;  5CUC A;  4LD9 K;  2EIF A;  4TQN A;  4Q0N A;  3F70 A;  1O75 A;  5F5Z A;  3JSC A;  5LKT A;  4Z1S A;  3MQM A;  2RJC A;  4YYK A;  1X6O A;  1N8R C;  2DPP B;  5C7N A;  3QZ5 B;  4CUS A;  1Y96 B;  5A5Q A;  4C8Q D;  5A0D A;  4M77 A;  4UYD A;  3ME9 A;  3BY7 A;  4WHU A;  5FH8 A;  5GMK e;  3SVH A;  4NR5 A;  2LQ8 A;  1S72 T;  2D6F A;  4LZR A;  2LC4 A;  3HRT A;  2OAU A;  4M78 G;  4M78 E;  4ZTF A;  5I2M A;  2LDM A;  4L59 A;  4TT2 A;  3HMF A;  1NPP A;  2NXB A;  4BHW A;  5CKB A;  4J7F A;  5EWH A;  3UWN A;  4J7I A;  1Q82 C;  3RMQ A;  2LCC A;  4J6Y A;  5F25 A;  3R6O A;  5LJ3 j;  4IR3 A;  4BD3 A;  5FE7 A;  5KE3 A;  3RER A;  2A3L A;  5CKH A;  1QW1 A;  2C06 A;  4M78 A;  3CC4 A;  3HFO A;  1P92 A;  4QEV A;  2KY9 A;  1PSE A;  2E6N A;  5G4S A;  4HCB A;  5E73 A;  5HQ7 A;  2EAY A;  4WF2 A;  3NTK A;  3CC7 T;  2N9G A;  2HQE A;  1B34 A;  3BDU A;  5GAM f;  4KCX A;  3KXT A;  2DWW A;  3QJY A;  3VV0 A;  3QBY A;  3A8G B;  4MEN A;  4C0Z A;  2JUF A;  3CCV A;  4ELY C;  4QC1 A;  2OTL T;  4QB3 A;  5FE8 A;  3HKS A;  2MI6 A;  3JB9 G;  3QG1 A;  1N9R A;  3MET A;  4J5Y A;  3E9G A;  5D24 A;  2L3R A;  5HQ6 A;  5CVI A;  5L96 A;  2F5T X;  2DO3 A;  1VIE A;  2E5Q A;  4KV4 A;  4Z6I A;  5GMK m;  4NYW A;  5DLZ A;  4FM4 B;  4XK8 E;  4ZGJ B;  2VYT A;  1W4S A;  3CPF A;  3OY9 A;  1M4Z A;  5HEL A;  4HXK A;  4CUR A;  1VUB A;  5IID A;  5CUB A;  4UIY A;  3G71 A;  4ZTJ A;  4TYL A;  4DA4 A;  3DWY A;  3PIP A;  4IUR A;  2D0Q B;  1BIB A;  3OYC A;  2YW5 A;  3CCM A;  3DB3 A;  3V8L A;  2RD1 A;  5ETD A;  4Y91 A;  3X28 B;  4JRI A;  3MUL A;  4YH3 A;  2R10 A;  1LOJ A;  4R56 A;  2XIC A;  5FU7 C;  2OUO A;  3MEV A;  4NR4 A;  3TCJ A;  2M9U A;  5FH7 A;  5E9I A;  3DLL A;  2KTB B;  3AHU A;  3M5A A;  4C5G A;  4E7K A;  2EJF A;  4M7A B;  5LJ3 e;  4BY6 B;  3LYI A;  1KQ2 A;  4NQN A;  4HCZ A;  3JB9 H;  1VQ6 T;  4A4F A;  4PTB A;  2R0V A;  3OMC A;  3GG3 A;  4PJO C;  2FB7 A;  5F1H A;  4TS8 A;  4LYS A;  1I81 A;  4OVA A;  5GAO l;  3X20 B;  4C5H A;  3U5P A;  5I21 A;  2K57 A;  3JCM h;  5ETB A;  3MB3 A;  5A85 A;  4XTX A;  4ZGD B;  3G7Z A;  2RI5 A;  1BI2 A;  5E0R A;  5A5O A;  3KUF A;  3M4Y A;  3V7C A;  5GAN f;  4FU6 A;  1YCY A;  5FE2 A;  5EIC A;  4RVR A;  5ENB A;  1WUM A;  4M7D C;  5CTL A;  2YEK A;  5KHM A;  3M55 A;  2DJZ A;  3OB9 A;  4WHW A;  2X4W A;  3FEO A;  3QZ9 B;  3C94 A;  3AAD A;  4A9H A;  1Q81 C;  5E3D A;  2E64 A;  2JVV A;  3EFR A;  5D26 A;  2CZ7 B;  2FYK A;  3GNF B;  4KUD K;  4DQ2 A;  1VQN T;  5GAO r;  3QSU A;  2RNY A;  5IT9 E;  3UVX A;  4MR6 A;  4TT4 A;  2L84 A;  5C8G A;  3J80 E;  3CD6 A;  5E9V A;  5D3L A;  4CUT A;  4DOV A;  4LR6 A;  4RG8 A;  5GAM d;  2BUD A;  5KTW A;  5D0C A;  4A4E A;  3U5N A;  1VQ4 T;  4XU0 A;  2EQK A;  2EQU A;  3LGL A;  4LD6 A;  2H3J A;  2CZ0 B;  4X34 A;  3M58 A;  3OYM A;  1Q7Y C;  4Q5W A;  4UIU A;  3PTA A;  3CCE T;  5EGU A;  5CP5 A;  5GMK h;  1YI2 A;  4TT6 A;  2ZCF B;  1KQ1 A;  3MP6 A;  3CCR T;  5CQ6 A;  4O71 A;  2WSE E;  5LJ5 f;  1VQ9 T;  2RFJ A;  5EP7 A;  3I56 A;  4J3I A;  4YYM A;  5DM7 R;  2OO1 A;  3ASK A;  4C92 F;  3MEW A;  3S3N A;  1QVF A;  5H1T A;  1BI3 A;  4FL6 A;  1G3W A;  3LLR A;  4MMK A;  5D7X A;  3HRS A;  2DXB A;  3OYE A;  1TH7 A;  2VUB A;  1M1G A;  2E12 A;  1LNX A;  2RHI A;  4BDZ A;  2YYN A;  4QY4 A;  3BFM A;  3LQH A;  3BW1 A;  5KH6 A;  2EKO A;  4M7A G;  5I80 A;  4M7A E;  4E7J A;  4LZS A;  3FKM X;  4HXM A;  4QEU A;  2VGM A;  3SFM A;  4QSQ A;  2R5M A;  4C92 D;  5DX4 A;  3LW5 E;  5E3G A;  1YIT T;  4HXR A;  5GAN 6;  3U5L A;  4PKL A;  5ENE A;  3OYN A;  3QYH B;  4ALG A;  4QUT A;  4A9J A;  4BW4 A;  3SWN C;  3UV2 A;  1KD1 C;  4NR8 A;  4M7A A;  2R0S A;  3VUZ A;  5F62 A;  5CUA A;  1Y07 A;  2GF7 A;  3OW2 A;  4O78 A;  4O77 A;  1WJR A;  1XOV A;  5A82 A;  5EU1 A;  2QQR A;  3Q2F A;  3L1A A;  5D3T A;  3L2V A;  2R58 A;  2FL7 A;  3G4S A;  3QJ6 A;  4QBM A;  4EDU A;  4JS5 A;  4HT9 A;  4J6X A;  1JSP B;  3MP1 A;  3TEE A;  3GLX A;  3V8K A;  4EMK C;  2A7Y A;  5CKD A;  3PGG A;  5J0D A;  4F7U G;  4F7U E;  2XI9 A;  5GAN d;  4JS4 A;  4PJO A;  3VKI A;  5FE4 A;  4YK0 A;  5HFR A;  4CLB A;  4X9D A;  4E47 A;  4HCC A;  2QQA A;  2HQX A;  1VQ5 A;  5FU6 C;  5ENJ A;  5KTU A;  1LJO A;  3Q2E A;  4C8Q C;  4BDY A;  4M75 C;  1YJN T;  2QXF A;  3A8L B;  3CME A;  5DFD A;  5F1L A;  1YBY A;  3M59 A;  5F2P A;  5EWW A;  3JCM b;  4X2I A;  3FJP A;  2YLB A;  4YAB A;  5AD2 A;  4M77 F;  2HNI A;  1BYM A;  5GMK j;  5F36 A;  2E65 A;  1X01 A;  2Y4X A;  2BKD N;  1K73 C;  5E9L A;  5I7Y A;  3UT1 A;  1WUG A;  3LWI A;  1W2B A;  4M75 B;  4A9O A;  4HBX A;  3U5M A;  2DVV A;  2K5I A;  3QO3 A;  3OYA A;  4HXP A;  4MEP A;  2K4Y A;  4M7D A;  4PL6 A;  5IGM A;  4NR7 A;  4RMO A;  3JCM e;  2M1H A;  2RO0 A;  4FSX A;  4YBM A;  4X9C A;  2DD4 A;  2XID A;  4YBS A;  4J8O A;  1K9M U;  3FRN A;  2F6N A;  5IGN A;  4M77 D;  4M78 F;  4TU4 A;  3CPW A;  5GMK i;  1Q86 C;  2ZPE B;  4J83 A;  3LWH A;  3S3M A;  2L85 A;  5LJ5 e;  5LJ5 d;  4IR4 A;  4O74 A;  3AQA A;  3MB4 A;  4LYW A;  3P1F A;  1WGS A;  2RHU A;  3OS2 A;  4Z1Q A;  3T9N A;  3JCM Q;  3VYH B;  1N8R U;  4ZGE B;  5LL6 S;  3C12 A;  4MDX A;  1K9M C;  1ZS5 A;  5FE5 A;  5HCL A;  4M78 D;  4O72 A;  3A8O B;  4JRP A;  2FSA A;  3CC4 T;  4QSV A;  3CCU A;  4IUP A;  3DKM A;  5D3J A;  2DEQ A;  1OYX A;  5LJ0 A;  3NTH A;  4QR3 A;  3TU4 K;  4BAC A;  1QVF S;  1Q82 U;  3JCM g;  5GAM h;  4BW3 A;  4NUE A;  4QSX A;  3MHX A;  3CCV T;  3JB9 F;  3CBP A;  2DVE A;  3HSB A;  4YC9 A;  1IRE B;  5JWM A;  4IOO A;  5D3N A;  3QII A;  2RB6 A;  2WP2 A;  2O4X A;  5H1U A;  3MEA A;  5D6Y A;  5CQ8 A;  3JCM X;  4N4G A;  5BT5 A;  4IUT A;  5E9M A;  1VQ8 A;  5DLX A;  5FG5 A;  2P0Q A;  2VXE A;  4IUU A;  2P0K A;  1UGQ B;  4PNO A;  5J39 A;  4Z6H A;  3GOX A;  3V7S A;  1KQS S;  3CCS A;  3G6E A;  5C6S A;  3JB9 D;  1O9S A;  4KT0 E;  1M8V A;  1OI1 A;  2K3Y A;  2DAT A;  4C5I A;  4IKF A;  3CBM A;  3CCL A;  5FLX E;  3G71 T;  3SWN A;  4A9K A;  3OS5 A;  2ZPF B;  3A8H B;  3FDR A;  3JVJ A;  4DON A;  1YJW A;  2DVS A;  4OGC A;  3CCM T;  2ZPI B;  4PCI A;  4V2S A;  1SSF A;  2JOY A;  4NXJ A;  4C0D C;  4UIT A;  2DAQ A;  5I2S A;  3LJW A;  5E9K A;  5GMK l;  4F3I A;  4O7B A;  4NL3 A;  5DYU A;  4M75 G;  1VQK A;  4M75 E;  4J6W A;  5CS8 A;  4XTY A;  2F6J A;  4B9X A;  4BB7 A;  5DYC A;  5CIU A;  5EI4 A;  1NJI C;  1M1K C;  4CUP A;  2CYZ B;  5I7X A;  3P8D A;  1VQL A;  3OYI A;  5FFV A;  3SDZ A;  5A5R A;  2EYQ A;  3RKX A;  2PUO B;  4YAT A;  5L8U A;  2I8N A;  4M75 A;  3V8J A;  4NUC A;  5FG4 A;  1XTD A;  4OUF A;  5CO7 A;  5M9O A;  3O37 A;  5HRV A;  2VV5 A;  2P0P A;  5ACY A;  4N0A C;  5HRX A;  3JAM E;  3VYG A;  4O5V A;  4OB3 B;  3CCQ A;  3Q1J A;  5GAN 8;  2RK1 A;  1VQO A;  4QSS A;  2ZPG B;  5LJ2 A;  4YYD A;  5HJC A;  5AMF A;  5GAM j;  5EG2 A;  4CI0 C;  2DTI A;  3O33 A;  1HK9 A;  3SVG A;  2QTX A;  4LDW A;  4O76 A;  5ENF A;  4JJN K;  5GAO q;  2DZC A;  3INZ A;  1VQP A;  3WVD B;  4XQ3 A;  1M9S A;  2KMT A;  3IU6 A;  3CPW S;  3UW9 A;  5D6W A;  4BE1 A;  4NL2 A;  5I88 A;  2EQM A;  2CS7 A;  5DYX A;  4ZQL A;  3UV4 A;  4A53 A;  5A83 A;  1UEB A;  4UIX A;  5E7D A;  2NLU A;  2QQS A;  2ZZD A;  4O7A A;  3WXM B;  5FU7 B;  3NTI A;  1VQ7 A;  3OS0 A;  3CD6 T;  3URG A;  4NQM A;  3A8M B;  2QA4 A;  2WAC A;  3X24 B;  2ZGW A;  2RNW A;  3HP9 A;  1Q81 U;  4A9M A;  5CKE A;  5A81 A;  5GAN 7;  2QI2 A;  5EVA A;  1WNL A;  2F69 A;  4YAX A;  4NYV A;  3E19 A;  4PJO B;  2HD0 A;  5GAN 2;  2LT1 A;  1EQF A;  3LXJ A;  3M56 A;  2M16 A;  3QDR B;  5LKZ A;  3QZV A;  1YI2 T;  3UDC A;  3NFC A;  3JCM V;  3UV5 A;  5AD3 A;  3LQJ A;  4QQ6 A;  4C92 C;  3I56 T;  2D82 A;  4GY5 A;  5LJ5 h;  5DKH A;  4XTU A;  2RO1 A;  4MR5 A;  4CUU A;  1R8O B;  2PVO B;  2XG8 D;  1JB0 E;  1N6A A;  2X4J A;  3ZBD A;  3D7C A;  2GQV A;  2VGN A;  4A9I A;  5LJ3 g;  4LYI A;  4R55 A;  4M7D B;  1E6I A;  1Q7Y U;  4MZP A;  4NR6 A;  3P1C A;  4M7A F;  2G3R A;  4A4H A;  4QSR A;  5CUD A;  5DKC A;  3RKW A;  2WP1 A;  3OYJ A;  2E41 A;  2VXF A;  3OYK A;  4JLI A;  5GAM e;  1I8F A;  5HEN A;  3S92 A;  2MF2 A;  4B9W A;  5CUE A;  5A0G A;  4XU2 A;  3S6W A;  2HBP A;  3PT9 A;  3M54 A;  4A4G A;  2IVW A;  3QXE B;  4II1 A;  1VIF A;  1M90 C;  5GAN j;  1K8A U;  3PNW C;  2YEM A;  4XY9 A;  5CAI A;  2F5K A;  4XY8 A;  4M7A D;  3FLG A;  1U8R A;  2E7N A;  4UYH A;  5CUG A;  2EQJ A;  5CQ5 A;  2XKO C;  4YYH A;  5A2Q E;  2DTO A;  3MO8 A;  3JCM c;  3IU5 A;  2XU8 A;  5KU3 A;  4XTW A;  4O75 A;  3G4S T;  2X35 A;  5FH6 A;  3P8H A;  2PQW A;  2DXC A;  4F7U F;  1X75 C;  5BT3 A;  1H3Z A;  2DKG A;  3RIR A;  1U1S A;  3QPH A;  1YHQ A;  2Y4Y A;  4TVR A;  2PVG B;  2X4X A;  2GRC A;  1K8A C;  3L42 A;  3GIB A;  3NXB A;  3O8V A;  1KD1 U;  4RKU E;  2LTO A;  1JRI A;  3PFS A;  1WQ7 A;  3M53 A;  3H6Z A;  1VQ5 T;  5I40 A;  2GFU A;  5C89 A;  1N9S A;  4MZT A;  4QVD A;  3S3O A;  1IZ6 A;  2FHD A;  4M77 C;  4BJX A;  3CME T;  4A9E A;  1YIJ A;  4ALH A;  1NPR A;  3UVD A;  1VQM A;  1KHC A;  2RHX A;  2O4X B;  2JTF A;  3K2J A;  3TLP A;  3EFS A;  4HXL A;  2RH2 A;  4E7L A;  4QSP A;  5D3H A;  5FFW A;  4QYD A;  2PVD B;  2HAX A;  1JJ2 A;  5LJ5 j;  2MAM A;  4MZM A;  4PLL A;  1QVP A;  1BIA A;  1NZ9 A;  3O36 A;  1JBM A;  4PJO G;  4PJO E;  5EM3 A;  3I3J A;  4PY6 A;  5A5S A;  3OYB A;  2QEX A;  4QSU A;  1UGS B;  4M78 C;  3X25 B;  2YDW A;  5CGP A;  3SWN B;  4N4H A;  4BUG A;  5ENC A;  5GAO n;  1V29 B;  2KVQ G;  4YY6 A;  3U5K A;  3BDL A;  2KQW A;  1YJ9 A;  1K73 U;  5I1Q A;  2M0O A;  5GAN e;  3U5O A;  5CQ4 A;  5A5P A;  5L8R E;  5K29 A;  5LVQ A;  2LVM A;  4PS5 A;  4OGJ A;  1FX7 A;  4EMK B;  1MHN A;  4M7D G;  5FRO A;  4RCC A;  4M7D E;  2XHC A;  1QVG A;  5ENH A;  4XAX B;  3VJP A;  5CQ3 A;  2MJV B;  4QR4 A;  4QUU A;  3P1E A;  5FU6 B;  5II1 A;  4ZW1 A;  5CQ7 A;  3CCU T;  1Q86 U;  3G0L A;  4C8Q B;  3CC2 A;  4CUQ A;  3I55 A;  3CEY A;  5DY9 A;  4C0G A;  5EIS A;  3J81 E;  2KAF A;  3QZS A;  5FE9 A;  3V7R A;  5ENI A;  3UPU A;  2OSS A;  4EMH A;  3OA6 A;  1RI0 A;  3JCM W;  3OYY A;  4O7C A;  2P4T A;  5EQ1 A;  5J3B A;  3QKJ A;  4XYA A;  3L2Z A;  2YHT A;  4LDV A;  5FE6 A;  1F68 A;  5CK9 A;  1RL2 A;  2E10 A;  4IOR A;  3QZT A;  5I89 A;  5KO4 A;  2RK2 A;  2L8D A;  5DBM A;  4IUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...