4N4GA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
209
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4gA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4gA02
5C4QA 5EA1A 2XDPA 5J26A 2GF7A 4O71A 4HXPA 2E7OA 4IUUA 3OYGA 3D7CA 3OYNA 5HELA 3MP8A 2RJEA 5F3AA 5LKUA 2X4WA 4MEQA 5FH6A 4TT2A 3U5OA 3S6WA 5C89A 2I8NA 4O74A 4HXKA 5KTUA 4QR3A 5I40A 5FE2A 2E7NA 4IORA 4LZ2A 5FE1A 3H8ZA 2RFJA 2H60A 3QJ6A 3AADA 5FDZA 3UVDA 3K2JA 3S91A 5AD3A 5LKXA 3O34A 4KCXA 4L59A 2RHIA 4NR6A 2MJVB 5D3HA 5L96A 3GG3A 4PCEA 5F2PA 4A9MA 4YY4A 5FROA 2LDMA 2D9TA 4KV1A 5ENHA 4QBMA 4QZSA 3E9FA 3RCWA 1OYXA 5A5RA 5CQ8A 5DX4A 4HBWA 5D7XA 2WP1A 5A5QA 5LKTA 1H3ZA 5IN1A 5DYXA 3SVHA 4CL9A 5E9YA 4NUEA 1E6IA 4CUUA 4KV4A 5F60A 3L2UA 5IBNA 3MEUA 5KE3A 2DVQA 5L98A 4O72A 2MWOA 2EQJA 5IGLA 3Q1JA 4UIXA 5E9KA 5E3GA 5KTXA 2M1HA 4O7FA 2QQRA 3JVKA 5AD2A 3MEVA 5E73A 5CQ3A 5L8UA 5JWMA 5KCHA 4XUAA 4QEUA 5M9OA 2YRVA 5F25A 5FH7A 4NRBA 4QQDA 5A83A 5IG6A 5FE0A 4O7EA 5EWVA 3OYDA 2RJFA 2E6NA 3MUKA 2LTOA 4E96A 3O36A 5D3TA 4UIUA 5DYUA 3S3OA 2R0VA 4E7LA 2EKOA 5JI8A 5A82A 4HXLA 4B9XA 3KUFA 5AMFA 3LGLA 4GY5A 4B9WA 2E5QA 5FRNA 4QSVA 3DAIA 4A9KA 4A4FA 3G0LA 1KHCA 2R0YA 5CU8A 5AMEA 3MO8A 5EWWA 3MEAA 4FL6A 2YQDA 5II2A 4PLLA 4IR5A 5FE5A 2RJCA 3LQHA 4NYXA 4WIVA 3P1CA 4UIVA 5D3PA 3UWNA 5EICA 2LVMA 5CUEA 4QSSA 3MP1A 4N4HA 5CQ7A 2OO1A 5EPBA 2L85A 5I88A 2O4XB 5F5ZA 4IOOA 4ALGA 2CKKA 3OYAA 3TLPA 5KU3A 4PTBA 1N72A 1WUGA 4IUQA 4TU6A 1ZS5A 2DKWA 4MR4A 4UIYA 3U5KA 2RHZA 4OVAA 4BE2A 4YYKA 5LUUA 5FG4A 5D6WA 3LLRA 3QIIA 4QEVA 2HQXA 4C66A 1WJSA 2FHDA 4QSWA 5LJ1A 2NLUA 3LH0A 5L8TA 4E7KA 4CUQA 3SD4A 5FBXA 5HJCA 5COIA 2R5AA 4FU6A 5HRWA 3OYMA 3UW9A 5EV9A 4YC9A 3OS0A 5D6YA 3QZVA 2I7KA 3HMFA 5ENGA 5HENA 3MP6A 3MQMA 5FE4A 4HXNA 4YY6A 4A4GA 2L5EA 2BKDN 4QB3A 2L84A 3FC3A 3PMIA 2LCCA 3QZTA 4LYIA 5I1QA 4O7AA 3MB3A 3MEWA 3FKMX 4CURA 2PQWA 5F36A 4CUTA 4YH3A 3OY9A 2R5MA 4IOQA 2P0KA 3LYIA 5C8GA 4QVZA 3P8DA 4QSQA 2GFUA 5FG6A 3AQAA 4YH4A 4J1PA 5I83A 3DWYA 2RNWA 3IU6A 2M16A 4LYSA 4LRGA 3ME9A 1MHNA 4XY8A 5HRVA 5CUGA 5IGKA 4PCIA 4MEOA 4A9LA 2EFIA 4NYWA 5ENBA 5FH8A 2GFAA 5HQ5A 5D3JA 2RI2A 4EDUA 1OZ3A 5E9MA 4TU4A 2BUDA 3UT1A 2DWWA 5FB1A 4BD3A 4J0RA 3PFSA 4QSPA 1WGSA 5II1A 5LJ2A 2R10A 3LJWA 2JZ2A 3MB4A 4BW1A 3S3NA 1WUMA 4F3IA 3S92A 2EQKA 5EPSA 4X2IA 4O78A 4YYJA 3OYFA 2YYNA 5CGPA 4BE1A 4MEPA 5G4SA 3O35A 2WACA 2RHXA 4TTEA 3PMTA 2RNYA 2YEMA 5EGUA 2F6JA 3U5PA 4ZQLA 5E3DA 5I80A 3P5OA 3E9GA 2OUOA 5FB0A 2K3XA 1EQFA 4UITA 4HXSA 4WHUA 4DONA 2L8DA 5BT4A 3QKJA 2LRQA 5D3SA 3C4SA 5CUBA 2DVRA 5DKHA 2EQUA 5EWHA 4BDZA 5A85A 4YAXA 5L97A 4QUUA 2D9EA 4CUSA 5DY7A 3L2RA 2L3RA 5C0MA 5DLZA 2OSSA 4A9FA 2R0SA 5ENCA 2M0OA 2E3KA 3JVJA 4Q5WA 1F68A 4PLIA 5BT5A 2JTFA 4HXOA 3SVGA 4O76A 2X4YA 3FLGA 5HQ7A 4Y03A 2IG0A 4UYHA 5F1LA 4Z02A 2X35A 5CQAA 4NRCA 4YBMA 2R58A 4QY4A 3IU5A 5H1TA 4TYLA 3NXBA 3P1EA 4YADA 4PY6A 3OYHA 5I7YA 4NR5A 2X4XA 5D26A 4QYDA 4XYAA 4YYMA 4IR3A 2DATA 1OZ2A 4YATA 4IKFA 5J0DA 3UVYA 4N4GA 5ENIA 4HXRA 3OS1A 5FFYA 3S3MA 2MWPA 4Q0NA 2WP2A 4YYHA 2RHUA 4QSTA 3NTHA 3OQ5A 3LXJA 3OYEA 5EP7A 5KTWA 3PNWC 4XY9A 2L89A 3OS2A 4QSXA 5HRXA 3OYBA 4LDFA 4A9NA 5E9LA 4BW4A 4O77A 5KHMA 2B8AA 5KH6A 4QEWA 5CUAA 4LYWA 5CPEA 5FE7A 5H85A 1SSFA 3JVMA 3EAEA 5ENEA 5LJ0A 5HQ6A 4UYGA 4MR3A 4NXJA 5EPRA 5EWCA 2N9GA 3P8HA 3OYLA 5DW2A 4O7CA 4LR6A 2F5KA 3U5MA 5CZGA 4CFKA 2XK0A 3META 4UYEA 4NR4A 4UIZA 4NS5A 4O75A 4IUVA 4BW2A 5ACYA 3O8VA 3Q2EA 4O70A 4Q0OA 2DVVA 3L42A 5L99A 3LQJA 1OI1A 2DAQA 3DLMA 4IUTA 5BT3A 4MENA 4LZSA 3QZSA 5CRMA 5H1VA 5LVQA 3OMGA 4OGIA 4NYVA 3H6ZA 4X34A 5D24A 4RG2A 4C5IA 5ENJA 3UV4A 5F62A 3NTKA 3UV5A 2DIQA 2DIGA 5IIDA 3CEYA 5TB6A 4OUFA 4BE0A 4QNSA 4GPJA 5DLXA 4QQ6A 5DKCA 4TT4A 5A7CA 5E74A 5EI4A 3L2VA 5DFCA 4LC2A 4BJXA 5I89A 4NUDA 5FG5A 3ZYUA 5KE2A 3OA6A 4N4IA 3FDRA 4TS8A 4YK0A 2R57A 5FFVA 4PL6A 5CQTA 3OB9A 3UVXA 4ZW1A 4Z93A 4J3IA 4YYIA 5KO4A 4CRIA 4YBTA 5EQ1A 4YYGA 5LVRA 5FE6A 1G5VA 4MR6A 5CUDA 5CUCA 5EWDA 2RI7A 3NTIA 3O33A 5HFRA 5EU1A 5EVAA 2F6NA 3SVFA 4NQMA 1JM4B 2G4AA 5A5NA 5CTLA 5IGMA 4HXMA 2DVSA 4A9HA 5DW1A 5C6SA 5CY9A 4HCZA 3UVWA 3FEOA 5I86A 5DFDA 3U5LA 5F1HA 5FE9A 4UYFA 2VYTA 4CUPA 5CQ4A 4ZC9A 5C87A 3ZEHA 3LQIA 3MXFA 4UYFB 4XUBA 5A5PA 4O7BA 5CS8A 5D3RA 1WJQA 2YW5A 2RJDA 4YYDA 2RI3A 3Q2FA 5E0RA 3P1FA 5D0CA 4LZRA 4ZTJA 5EISA 4C5EA 4IUPA 4QYLA 2EQMA 4Z1QA 4QQGA 4J0SA 5CP5A 3LX7A 4OGJA 5HLSA 1WJRA 5CFWA 4A4EA 5DYCA 5C7NA 4NRAA 4QC3A 4YABA 2YDWA 2KTBB 4TT6A 3MULA 4TZ2A 5E9VA 5A81A 4QR4A 2D82A 4E7IA 5FRMA 4HBYA 3O37A 4NUCA 3L2QA 4QR5A 5IAYA 2RS9B 4Z6IA 3DB4A 3OYKA 4QSUA 5HCLA 5ETBA 2HQEA 5ETDA 5D3NA 2LSPB 5TCMA 4BDYA 4Z1SA 4A9JA 5KCOA 4UYDA 4MR5A 2NXBA 4BW3A 4A4HA 3M9QA 4N3WA 5G4RA 4CFLA 1XNIA 4IR4A 5CIUA 4CLBA 4PKLA 4BHWA 3JVLA 4TZ8A 4HBXA 2G3RA 3ASKA 3U5JA 5LKZA 5D25A 4BACA 4Z6HA 4E7JA 1RI0A 5C85A 5F61A 5ENFA 2RNXA 4A9EA 3OYCA 5J39A 3U5NA 5DKDA 4A9IA 1X0JA 2RHYA 5E7DA 4C5HA 4UIWA 5DYAA 4FLPA 2O4XA 4ALHA 5E9IA 4PS5A 4NR7A 2BIVA 2FSAA 4QUTA 3LGFA 4A9OA 5HFQA 3F70A 4II1A 3UV2A 5DFBA 3ONIA 3GOXA 1JSPB 5FE3A 3G0JA 5K29A 4QW2A 5CQ6A 3HMEA 4RVRA 3QBYA 5HEMA 4YYNA 3OYJA 3P1DA 4YBSA 4AKNA 5I29A 5CRZA 4UC4A 4IR6A 2K3YA 4IURA 2QQSA 5FE8A 5F63A 4NR8A 4NR9A 2GRCA 4C67A 5HM0A 2RI5A 5D6XA 4C5GA 5CQ5A 3OYIA 2YEKA 5EK9A 1N27A 2RO1A 4QSRA 5FFWA 5DBMA 3L2WA 5H1UA 2YELA 5A5SA 4LD6A 4NQNA 4HBVA 4QC1A 4WHWA 3DB3A 5IGNA 5EM3A 3OMCA 3I3JA 4ZTFA 5D3LA 5A5OA 3BDLA 2RO0A 3HMHA 4E7HA 4N4FA 5I7XA 4TQNA
chains in the Genus database with same CATH superfamily
3CPWA 2C0OA 2XDPA 2GF7A 1BB9A 2HSEB 4IIMA 4M78D 4XU3A 4AFZC 3OYNA 3OYGA 2XD0A 1BYMA 5HCKA 5LKUA 2X4WA 3ULRB 3EG9B 3EGDB 4TT2A 1NZ9A 5C89A 2E12A 3I9QA 4O74A 3OYYA 3LWIA 2EYXA 1Q7YC 4LZ2A 3H8ZA 2IPOB 1T3LA 3QJ6A 3AADA 5LKXA 3O34A 4L59A 3TEEA 1SHFA 5L96A 4DBFA 1M8VA 4OGCA 3JCMe 1D09B 4QVCA 4A9MA 2A28A 2LCLA 1HJDA 2D9TA 1AWOA 4QZSA 2NUPA 3E9FA 4AFUC 4AFSC 1BK2A 1M90R 2K5LA 4HBWA 2WP1A 2ZPBB 5A5QA 5IN1A 1S1NA 5E9YA 2HAXA 2GBQA 1K8AR 5F60A 3CC2T 2DVQA 1NG2A 4OMNA 2V26A 3FRNA 3Q1JA 2CP5A 5E9KA 4O7FA 2QQRA 5AD2A 3MEVA 3CMAQ 3QDRB 1NJIU 3OW2P 2E65A 2DYIA 5JWMA 1W6XA 2DVEA 3ZBDA 1M4ZA 1ZUUA 1JBMA 3OYDA 2RJFA 1K76A 2E6NA 1WYXA 2J7IA 3NMZC 3VS2A 3VUZA 4JS5A 3D1DA 4RMOA 4HXJA 4JUVA 5JI8A 5A82A 4HXLA 1PG5B 2QA4T 5AMFA 3AT1B 4M77A 1ZA1B 5CVIA 1TUDA 5FRNA 2RA2A 4QSVA 2MCNA 2ESWA 5GAMj 3CBPA 2JOYA 4F7UG 1ZX6A 1D3BB 3MEAA 5L23A 5II2A 4OMQA 1N9RA 1QVGA 4WIVA 5GANg 1JEGA 5D3PA 1IREB 2CP3A 3UWNA 1T3SA 4QSSA 5EPBA 5F5ZA 4IOOA 4ALGA 3OYAA 2IIMA 2F69A 1UJ0A 1WUGA 1BU1A 1ZS5A 3CC2A 2DBKA 4OVAA 4YYKA 5LUUA 5FG4A 1QQJA 2LC4A 3QIIA 1H8KA 4C66A 1WJSA 4M7AG 4CUQA 5COIA 2O01E 2RF0A 3QZVA 3VYGA 2I7KA 2A3LA 1MGQA 1KQ2A 4QB3A 2DXBA 4DOWA 4CURA 2HEQA 2PQWA 4JRIA 4YH3A 2KDSA 5LJ3e 3MHXA 2H3JA 2QA4A 2P4TA 1TUGB 4HKEA 1UGRB 5FG6A 1RAIB 2JVVA 5I83A 1MV3A 3DWYA 1RUWA 1YJNQ 2BZYA 2KI7A 1AWXA 1YHQT 2RN8A 1QVPA 1K9MR 2DL5A 1YJWQ 5D3JA 2KMTA 1TG0A 3TSWA 2DWWA 3RBBB 1M8MA 2DD4A 2O2OA 3LW5E 3JB9J 4QSPA 2L5QA 5II1A 2R10A 4C92C 2P4RA 3GBQA 1VOMA 4F3IA 3S92A 1X6GA 3GNGA 1SRLA 5GAOl 1JQQA 4YYJA 3OYFA 5LJ5f 5G4SA 3O35A 4TTEA 3IQLA 2F6JA 3P5OA 1HK9A 2K3XA 3OBWA 5CUBA 4PJNA 5DKHA 2EQUA 3CCSQ 5EWHA 2JT4A 4BDZA 4C0DC 4EMKB 5I11A 4PJOE 2FB7A 2QQAA 5C0MA 4MMKA 2OSSA 2CUDA 1ZSGA 4A9FA 2DTOA 5LJ5g 1TU0B 5CKDA 1VQ8Q 2RNAA 3JVJA 1F68A 1X2QA 2JTFA 4O76A 2X4YA 1IRXA 4XQ3A 2MPXC 2ZPFB 2LCSA 4LDVA 2R58A 2L2PA 2DXTA 1QKWA 1D1BA 5H1TA 1T0HA 2A37A 2A08A 3X24B 2CZ7B 1I4K1 3M4YA 4ZN3A 1TTHB 5I7YA 2X4XA 5D26A 2KT8A 4QYDA 4YYMA 1V76A 4R0KA 1B34A 4IR3A 1OZ2A 2RM4A 4YATA 4LDXA 2KE9A 5J0DA 3VS5A 3CCRQ 3S3MA 3JCMg 2WP2A 4KRTA 4F7UF 2DFUA 2D8HA 2FRWA 1VQMQ 3OYEA 1M27C 4RCBA 2BZXA 3OS2A 1A0NB 5HRXA 3OYBA 2DX1A 1WHLA 4LDFA 4A9NA 1M2VB 3TVTA 3UF4A 2QTVA 2B8AA 4KGVB 5GAN8 1D0XA 1SSFA 3JVMA 3VKIA 1TSFA 1UGQB 2YRCA 3P8BB 3P8HA 1HSQA 3N5BB 2P0QA 4M7AF 3QDFA 2QASA 1Q82R 3T9NA 1M1FA 1KQSS 4A54A 2QQBA 4NS5A 1IB8A 2LJ1A 4M7DD 1IGQA 4Q0OA 2DVVA 1M5Q1 4JZ3A 2DAQA 4LDYA 1KJWA 1WA7A 3PE0A 3M58A 2KROA 2CZ1B 1OV3A 2LT4A 3OSSC 2O88A 2RQUA 4OMLA 4RG2A 2DETA 4JS4A 3UV4A 5KYWB 3CEYA 5TB6A 5DLXA 2HKQB 4AKGA 1NE8A 5DKCA 5A7CA 2K79A 2JXBA 5EI4A 3QWYA 4PFPA 3L2VA 1NBEB 4C92B 2K7AA 3ZYUA 3EGDA 4N4IA 2V1QA 3FDRA 5CQTA 2W0ZA 5ECAA 2FVUA 1VQOQ 1PD1A 4FYYB 1OPLA 5EWDA 1VQKQ 3M0UA 3NTIA 3JCMb 4RTWA 5EU1A 2WSEE 3J80E 1OU8A 4NQMA 4TVRA 4OMMA 5IGMA 5C6SA 5CY9A 1FXXA 4M7AB 5I86A 5DFDA 5FE9A 2VYTA 1IGUA 5CQ4A 5AT1B 5C87A 3ZEHA 3LQIA 3MXFA 3OS5A 4UYFB 5LJ3g 5A5PA 4O7BA 3SFMA 2RJDA 4RUGA 3TSZA 4YYDA 1NJIC 2GGRA 4J9IA 3E1SA 4J0SA 2ABLA 5FW9A 4PJOA 5CP5A 1WJRA 2GNCA 2ZPEB 1GBRA 2YDWA 2XMFA 1K73U 2COYA 4CC2A 1NEGA 4FW1A 5IAYA 4BUGA 4XU1A 3CCMT 1S72A 2RS9B 3DB4A 1YNZA 3MKDA 1TXQA 4MZPA 5HCLA 3OYKA 5ETBA 1VQPT 2PNIA 1KC8C 2LSPB 2L3PA 5TCMA 4Z1SA 5KCOA 3LH5A 3M4GA 4C0GA 2DL8A 2K2VA 2NXBA 4P5NA 3M5AA 1HYOA 4CFLA 3CCQQ 4PKLA 2KYMA 3REBB 2OTJT 3CCLQ 2QK0A 4AG2C 3U5JA 2W10A 4M7DC 3CC7Q 3QUIA 3CCUT 4E7JA 1D3BA 3GNFB 5GAMe 3C12A 5ENFA 2RNXA 4RTYA 3UPUA 2XICA 4A9IA 4C5HA 1QCOA 5EC7A 5E9IA 4OB0B 5KYXA 2KXCA 4II1A 1EIFA 3UV2A 2YLCA 5FE3A 1NM7A 3QHSA 1Z9ZA 4PJMA 5CQ6A 2MMPA 1G3SA 3I35A 1Q7YR 4GLKA 4YBSA 4AKNA 5I29A 3H9NA 4IR6A 2K3YA 4IURA 1ACMB 3OYIA 2E3IA 2YEKA 5EK9A 2RO1A 4QSRA 2Z0WA 4RTXA 5EG2A 3CCMA 4ATOA 5A0DA 2CT4A 3UA7A 1BI1A 1VQPA 1J3TA 5A5SA 2XDDA 4LD6A 1VQ7Q 4FT4A 5IGNA 2ZCFB 2EJNA 4ZTFA 2DTHA 1ZUYA 2OTJA 4TQNA 3CBOA 3QYGB 2F2VA 3I56Q 4HXPA 2E10A 1RI9A 2SRCA 1PRLC 2E7OA 4IUUA 4WCIA 4C92E 4AT1B 3OW2S 3MP8A 2ZPHB 1H641 3M59A 4MEQA 1WX6A 1WZOA 1KQSP 1GFDA 3U5OA 2HD0A 4HXKA 4QR3A 1C6VX 4JZ4A 3GF5A 1QVFA 1WLPB 3S91A 1UGVA 4NR6A 3PIOA 3CCVT 5F2PA 4HVUA 1VQ5A 3RUXA 4ORZA 4KUDK 2LDMA 4A53A 5ENHA 1UUEA 5CAIA 1OYXA 4LDUA 5A5RA 5CQ8A 2A7YA 1W4SA 3JB9G 4HCCA 3QJYA 2FYKA 2E41A 4CL9A 4NUEA 1E6IA 4J9DA 1QVGS 1KQ1A 4AI6A 3QXEB 1MNDA 4C8QC 2MAMA 1MUZA 2RQWA 3FIFA 1SF9A 2M1HA 1GL5A 3QZ5B 2H8HA 5E73A 5CQ3A 4LUDA 2XKOC 4F17A 2J05A 1K1ZA 4XUAA 4QEUA 3VRZA 5F25A 2PVDB 2K2MA 5IG6A 5FE0A 4O7EA 3MUKA 4E96A 3CCJQ 2QGGA 1Q81R 4J7FA 4LNPA 1RLPC 1QMCA 4B9XA 2COWA 2RK1A 1N8RU 3HFNA 4M75G 2LNHB 3LGLA 4M7DB 1IHVA 4B9WA 4OF1A 2V8KA 2QEXA 4FCYA 2F2XA 2JTEA 1VQ4Q 1KHCA 1MMDA 3MO8A 3CCVA 1B7TA 2YQDA 4L5GA 4IR5A 2RJCA 3LQHA 1M2VA 1FYNA 3P1CA 4UIVA 2LVMA 3MP1A 4N4HA 5CQ7A 2O4XB 1W2BA 3TLPA 2XI9A 3U5KA 1U5SA 2EKHA 2RHZA 4MZMA 4X1VA 4BE2A 2ATCB 3TU4K 3LLRA 3MCAB 4XTXA 2DMOA 1VQ6T 3CPFA 1AHJB 4QSWA 1Q95G 2NLUA 2O31A 4ANJA 2KRSA 2KSSA 4E7KA 1VQ9Q 2GTOA 4HCBA 4DBRA 5EV9A 4J9HA 4YC9A 5D6YA 2MYSA 5ENGA 4Y92A 1VUBA 2LX7A 2L5EA 2KQWA 3HFOA 2L84A 3PGGA 1TUCA 5I1QA 3I55T 2YHTA 1OX8A 3CPWP 5LJ5e 3OY9A 5KYWA 5GAOn 2HNIA 5C8GA 3A98A 3P8DA 4YH4A 3WVEB 3CD6Q 2M16A 1JU5C 4LRGA 1Q86R 1MHNA 2YSQA 5GAMg 4B6MA 5HRVA 1U1TA 4MEOA 2LX9A 5GMKm 3FJ5A 5FH8A 5ENBA 2YUPA 3FJPA 1S72Q 4TU4A 4RTUA 4C92A 3FB9A 3UDCA 4J0RA 3PFSA 2QTXA 4PJLA 1PKSA 1RABB 3LJWA 2QQ9A 2JZ2A 1UHCA 4BW1A 4R56A 1WUMA 3BY7A 1EZZB 2P0PA 5CGPA 4MEPA 1VQ6A 2WACA 1YJ9A 2YEMA 2V8IA 3JB9F 2GQIA 1P92A 3U5PA 2FPDA 4ZQLA 2KVQG 5I80A 3O5ZA 3E9GA 5GANd 1R0BG 1XTDA 5FB0A 1GFCA 1BCMA 4D8DA 4DONA 3QKJA 2YLBA 4J6XA 4C8QB 4C92D 1YITT 2QG9B 2CUBA 4WTOB 5A85A 4FYXB 4KGZB 5L97A 4EMKC 4E7ZA 3VV0A 5DLZA 1D1CA 1T0JA 1W1FA 2R0SA 2E3KA 4PLIA 4WF2A 4AKIA 4KT0E 1M1KC 1K73C 5HQ7A 4M78G 4Y03A 2IG0A 4UYHA 5F1LA 2OX7A 4MMLA 4NRCA 2LQNA 4RCCA 4QY4A 3IU5A 3BW1A 4TYLA 1YI2T 4PFOA 1WQWA 4M7AD 4PY6A 4Y28E 2CGHA 1KC8U 4M75F 1X27A 4XYAA 5CKEA 2DATA 2K6DA 2EW3A 3EHQA 3KBGA 4XTUA 4M7DE 3OBYA 1BBZA 3M0RA 3OS1A 5FFYA 2MWPA 4Q0NA 1OPKA 2E5KA 2ED0A 3EGXB 2RHUA 1YN8A 8AT1B 1NYGA 3VYHB 3U23A 1QVGP 2XU8A 3PNWC 4QSXA 1U06A 4JRPA 2E64A 2YWWA 2K9GA 5KH6A 5GAOq 4QEWA 2VUBA 2F5TX 5FE7A 5H85A 1QCFA 3GPLA 4UYGA 4NXJA 5EPRA 3HPWA 1YITA 1VQNQ 2FPEA 2DZCA 5DW2A 3U5MA 1JRIA 4CFKA 1IZ6A 3G71T 4UYEA 4UIZA 1PSEA 3NPFA 2EGAA 2HDAA 4JLGA 1VQ5Q 5ACYA 3CCEQ 5GAN4 5L99A 2CREA 3JCMX 5BT3A 2LNVA 3C0CA 5I22A 1YI2A 1GCQC 2OTLT 4LZSA 3QZSA 2XHCA 4KGXB 5GAN2 3EG0A 4NYVA 3H6ZA 4X34A 5D24A 4C5IA 2A0FB 1OU9A 5GAN7 3VKHA 2RH2A 3NTKA 3THKA 3DLLA 2YXYA 2DIQA 2AKKA 1PC0A 4HCKA 3CXCA 2H3EB 2PUOB 4QNSA 2DJZA 1KK7A 2RPNA 4QQ6A 2DZ9A 3TQ7P 2ENMA 1NJIR 1D1AA 1UJYA 4LDWA 2EBPA 2SEMA 2V8JA 1N5ZA 2NUZA 4BJXA 5I89A 1YCSB 2LT1A 3G7ZA 2DBMA 4BI8B 2LQKA 2R57A 2J6FA 4M77G 5HK0A 3HTRA 3JCMd 4MDXA 3CC4T 2EJ9A 2I0NA 3UATA 4CRIA 5EQ1A 5LVRA 5CUDA 2FG0A 5A2QE 2X3WD 3G71A 2QEXQ 5HK3A 1BI3A 1RAGB 5A5NA 2CSIA 4HXMA 4C8QE 5DW1A 2J06A 1IXDA 4HCZA 3VS0A 4M7AC 3CMEQ 3RKWA 4ZC9A 9ATCB 1RAEB 5D3RA 1YBYA 2YW5A 2JUFA 4ZGJB 3QG1A 4M78F 4QYLA 2EQMA 4LN2A 1FX7A 1RADB 2KRMA 3VS4A 5GMKh 4A4EA 4X9CA 5DYCA 2KYBA 5C7NA 1NEBA 1YHQA 2HSPA 3EGUA 3MPUB 2KTBB 4TT6A 3MULA 5A81A 2ZPIB 2D82A 4E7IA 5FRMA 4PFZA 4HBYA 4HVVA 4QT7A 2BE7D 1B3QA 2HQEA 1N8RC 3H41A 3M0QA 4XK8E 4ZGEB 3URGA 4MR5A 2K5FA 5A0LA 3M9QA 1M2OA 4N3WA 3QZ9B 4PKCC 1XNIA 2LJ0A 3CC4A 1WHMA 4BHWA 3A1PA 1AD5A 1VYVA 3G1JA 4M7DA 1ZBXA 2PUKB 2GTJA 4CI0C 1M90C 1NYFA 4Z6HA 1TWBA 3CBMA 4A9EA 2OAUA 1CSKA 5J39A 2DD5A 2O4XA 2PZ1A 4J9BA 4PS5A 1WXUA 4QUTA 4DEYA 1QVFS 3LGFA 4A9OA 1RAAB 3EG1A 5GANh 3RKYA 1LOJA 4YYNA 1Y0MA 1YJ9Q 2DO3A 3PVQA 3OYJA 3OSVA 3JB9H 2DEQA 1PCXA 3TREA 5FU6C 2WSCE 5FE8A 4NR8A 5CR2A 5HM0A 2LQ8A 5CQ5A 1Y96B 3G6ET 5KYYB 1AT1B 5GAN3 1WIEA 5FFWA 3H0HA 4FM4B 5H1UA 3L1AA 1KD1U 3JCMW 3AHUA 3DB3A 1YIJT 5EA1A 1QKXA 2RB6A 4O71A 4F7UB 5CKFA 3EG9A 3QSUA 2FZCB 1K0XA 1PRMC 2K3BA 4M77F 2OJ2A 4ZNXA 2D8JA 5FH6A 2FEIA 3S6WA 4C0FA 5KTUA 2WSFE 5I40A 1JXMA 1V29B 2E7NA 4IORA 2RFJA 2CYZB 2RMOA 2H60A 3I5SA 3K2JA 1LCKA 2KBTA 2RHIA 1B07A 2JMCA 1CKBA 2O9VA 5IXBA 2DJQA 2Y4XA 5FROA 3A5ZB 4KV1A 3EFOB 2MIOA 1E7OA 4QBMA 3RCWA 4J83A 3I5RA 5DX4A 5D7XA 2ROTA 1H3ZA 5DYXA 3SVHA 4C8QA 3CC2Q 3G6EA 1D0ZA 4CUUA 4KV4A 5IBNA 5KE3A 5L98A 2MWOA 1WHKA 2C0IA 5IGLA 4UIXA 5KTXA 4CC4B 1M30A 5DLOA 1MMNA 1M1KU 4KBMB 2VKNA 2I2LA 4XU0A 5L8UA 3CMAT 1UFFA 5KCHA 5M9OA 1E6HA 2DILA 2YRVA 5FH7A 4QQDA 1AOJA 2RQVA 2CS7A 2LTOA 2ZPGB 4AG1C 5LJ5h 4UIUA 3S3OA 2R0VA 4J5YA 4E7LA 4C8QD 2EKOA 2QA4Q 3KUFA 1VYTA 1OULA 4GY5A 4Z88A 4M77B 3CPWS 1YFNA 5FWBA 1LNXA 1WXTA 4JJBA 5CU8A 1RAFB 3QYHB 2CZ6B 2K57A 1AWJA 2HZYA 3JCMh 4PNOA 1OQKA 4NYXA 1EFNA 4JLIA 3GP8A 2ROLA 1C0MA 3V8LA 5IHNA 2OO1A 5I88A 4K11A 5KU3A 4IUQA 4TU6A 4UIYA 4MR4A 3HHTB 5I2MA 2XG8D 2NUTB 4OMPA 5D6WA 4QEVA 5FU6B 3J81E 2CH4A 2JMAA 3CMAA 5FBXA 5HJCA 3OYMA 2R5AA 4FU6A 3UW9A 3SWNC 2V1RA 1Y7XA 3OS0A 2AHJB 3HMFA 3MP6A 3MQMA 4YY6A 4HXNA 2DEUA 2BKDN 5J3BA 1XQHA 3FC3A 3PMIA 2LCCA 4LYIA 7AT1B 1ARKA 3MEWA 3FKMX 5F36A 4PJOG 4IOQA 2P0KA 4QVZA 2M9UA 3AQAA 3EFSA 4J1PA 1BIAA 4KH1B 4F7UE 4LYSA 2YUQA 3WVDB 1TOVA 2VC8A 3CCUA 1YJNT 3ME9A 1YHQQ 2VXEA 1D0YA 4JRKA 1U3OA 3PTAA 4PCIA 2EFIA 2P84A 4OB1B 5AYFA 1QVFP 5HQ5A 2FL7A 1OZ3A 1YJWT 3ER0A 3UT1A 1K73R 5A0GA 5FB1A 1AVZC 4BD3A 4HT9A 2VWFA 2B86A 1Q82C 1KIKA 1PKTA 2EGCA 2CSQA 2LQWA 5GJVB 2JN0A 2X9HA 4F04B 2EQKA 3CC4Q 5EPSA 4X2IA 4M7AE 4OMOA 4O78A 1HD3A 4O5VA 1I5LA 3PMTA 4M75D 2EWNA 2DNUA 2COZA 4O6JA 3DKMA 2OUOA 4UITA 4HXSA 2L8DA 5D3SA 1X75C 1JXOA 3C4SA 4JJCA 4EMKA 1PUOA 2OI3A 3A8HB 4YAXA 1KG1A 2VASA 3HRSA 2D9EA 4CUSA 5DY7A 3A8OB 2L3RA 4XAXB 5D7UA 5IHIA 1M1GA 5ENCA 4Q5WA 4DOVA 1VQ8T 4HXOA 2DVJA 3SVGA 3FLGA 4L6V5 4JDSA 4Z02A 5LJ3h 3TCJA 2X35A 3V8KA 2GQVA 2DYBA 3NXBA 4FSSA 2DERA 2M51A 4YADA 3OYHA 2CP6A 3C94A 1BKBA 1QW1A 1SG5A 3JCMJ 3UVYA 5ENIA 4M77E 4HXRA 3JCMV 1WQ7A 3V7RA 3A8GB 3CCRT 2EYZA 2E4HA 3H0FA 5DLQE 4QSTA 5GAMd 3NTHA 3OQ5A 3LXJA 2ECZA 1JJ2A 3JSCA 1GBQA 2JM8A 5EP7A 1VQMT 3V8JA 4XY9A 1M90U 3PT9A 2F2WA 1I1JA 1W2BP 1Y07A 3D1BA 4O77A 4XTYA 1K8AU 2X51A 1JO8A 4PK4A 4DA4A 3EAEA 5ENEA 2QDYB 1FMKA 5HQ6A 2CT3A 3SEMA 5EWCA 3OYLA 1VQLT 8ATCB 4DBHA 4EIKA 4O7CA 1QWFA 1I81A 2F5KA 5KYUB 2DL7A 3NFCA 2FO0A 3META 4PJJA 2PVGB 4XU2A 3SWNB 4AMCA 4BW2A 2MOXA 5CQYA 1VQ8A 3EFRA 2MK5A 3ZFJA 3Q2EA 4O70A 5FU7B 3LQJA 1GCQA 3DLMA 2YT6A 4IUTA 2X3XD 4XTWA 2QGFB 1KD1C 1Y96A 5FWCA 5KYYA 1PNJA 4PJOF 3OMGA 5LVQA 1W70A 2JW4A 3JCMc 3RESA 5ENJA 3M55A 1UEBA 4IIOA 1WHJA 4BE0A 2DL3A 1UDLA 2CP7A 3JB9I 4FW2A 4M75C 5E74A 4MZTA 3VS7A 3VS1A 1RL2A 1JB0E 2RQRA 1ZKRA 1NLOC 2L3SA 2AKLA 5KE2A 2NWMA 3OA6A 1I0CA 3SB2A 2L0AA 1SEMA 1WFWA 3OB9A 3UVXA 4ZW1A 4J3IA 4YYIA 4E2FB 5KO4A 1VQLA 1BI2A 5FE6A 1G5VA 4MR6A 1VQOT 3O33A 3M53A 1N8RR 2BTTA 1VQKT 1UB4A 2CP2A 3VUBA 1XOVA 2EGEA 4J7IA 2F6NA 1VIEA 2G4AA 4M7AA 2YDLA 1M9SA 2EYQA 2DM1A 4A9HA 3EFOA 3UVWA 3FEOA 3M57A 3U5LA 5F1HA 2DXCA 4UYFA 2E6ZA 4ELYC 1G8XA 2DK3A 3R6NA 3I55A 2VVKA 5GAN5 5CS8A 4J8OA 4RTVA 2EPDA 3Q2FA 2E3HA 1LPLA 3X20B 4Z1QA 4QQGA 4BY6C 3LX7A 5HLSA 2FPFA 4N0AC 3ZL7C 4A4KA 1K9MU 4PJOB 4QC3A 1EX4A 5E9VA 2LP5A 4AFQC 4QR4A 3OW2A 3CCMQ 3O37A 4QR5A 4V2SA 1VQPQ 4Z6IA 4QSUA 1Y57A 1UE9A 2C06A 4LD9K 5D3NA 1ZBJA 1OOTA 4A9JA 5I2SA 4KH0B 1H3HA 4BW3A 4OB2B 4A4HA 4JPBW 4LUEA 2OTJQ 5G4RA 4E47A 5GANf 5CIUA 3A8MB 3CCQT 4CC3A 1AZGB 5GMKl 1E6GA 4TZ8A 1VQOA 3CCLT 4HBXA 2G3RA 3CCUQ 1VQKA 1FMWA 5D25A 5GAOm 4BACA 3JV3A 3CC7T 1RI0A 5C85A 5F61A 2FZKB 2G6FX 3SHWA 2CZ0B 4C92G 3A8LB 1H92A 2DTIA 1YWPA 1YP5A 2HMAA 5DKDA 1NPRA 1X0JA 2RHYA 1ZSZC 2VB6A 5E7DA 1X69A 5DYAA 1WI7A 4XTVA 1CKAA 3PIPA 1VIFA 2XIDA 1KHIA 3F70A 4D8KA 5CK9A 1JSPB 2NUTA 5KYXB 5K29A 4M77D 4QW2A 3HMEA 4RVRA 3QBYA 2Y4YA 3P1DA 1Q81C 5F63A 5GMKj 2RI5A 4C5GA 1MV0B 4F16A 4M78C 5LJ5d 2IVWA 1G83A 5DM7R 4JJDA 5DBMA 2QI2A 3L2WA 2CDTA 3CXCP 4QC1A 5EM3A 4M75B 1VQ7T 2JM9A 5D3LA 1UTIA 3DAIA 4QUUA 4A4FA 4DEXA 3V7SA 5I7XA 4HT8A 5C4QA 3CCQA 1O75A 3G4ST 1NPPA 5J26A 3CCLA 3D7CA 3I56T 2HKNA 5HELA 1PHTA 2RJEA 5F3AA 3CC7A 3JCMP 2DF6A 2KK4A 2I8NA 3J7AF 3E2UA 5FE2A 3MJXA 1X6OA 1Q82U 2A36A 2L3QA 5FE1A 5GAMh 4QKUA 1ABQA 2LMJA 1KC8R 4GLMA 5FDZA 3UVDA 5AD3A 4KCXA 2ZAEA 2YUNA 3CCVQ 2MJVB 5D3HA 2RD1A 2GCXA 3GG3A 4PCEA 1N6AA 4YY4A 5DY9A 2RQTA 2JS0A 3JAME 3NHNA 1G2BA 5GANj 4ELZC 1AWWA 2OTLA 5GAOr 5LKTA 1UGPB 5IHKA 1G3TA 3L2UA 3MEUA 4BY6B 4O72A 2XDBA 2EQJA 1DJ7B 1HXDA 5E3GA 1FWZA 3JVKA 1R0CB 3BFMA 2HQHA 2KR3A 1Q86C 1VQ7A 1GCPA 2FRYA 2AK5A 2QAZA 1QP3A 1QWEA 5GJWB 1C1AA 3JRZA 4NRBA 3G4SA 3JCMf 5A83A 1AEYA 4J9GA 4J6YA 5EWVA 3O36A 3I56A 5D3TA 5DYUA 3R6OA 5CCAA 2KRNA 3CCJT 2ZGWA 4R55A 5GAOp 4ZGDB 1QCNA 4A63B 2VV5A 4X9DA 1ZUKA 5CQXA 1VYUA 5KYNA 3QO3A 4OGEA 2E5QA 1FMVA 2HBWA 4A9KA 4M77C 3G0LA 4C92F 2R0YA 5AMEA 1K8AC 5EWWA 1VQ4T 1ZSZB 4FL6A 4PLLA 5FE5A 1MMGA 3X26B 4J9CA 5IT9E 2CP0A 1K4US 4ESRA 5EICA 5CUEA 4LXCA 3E19A 1K9AA 2L85A 2CKKA 4PTBA 1N72A 1IO6A 2DKWA 1BI0A 1YWOA 5L8RE 1VQLQ 4HA8A 5KYUA 4FT2A 1VQ6Q 1RLQC 2JNGA 2HQXA 2HBPA 1XJWB 2FHDA 5LJ1A 3LH0A 5L8TA 3SWNA 3SD4A 4M78B 1SSHA 2JJ9A 3EHRA 5LJ3d 1VQ9T 1Y71A 5HRWA 1KFZA 4CC7A 1ZLMA 1U8RA 2EAYA 5GAN6 5HENA 4RTZA 1PD0A 2DLPA 5FE4A 4A4GA 3CCJA 3HRUA 3D7SB 3I55Q 2D0QB 4M75E 3QZTA 4LE9A 4O7AA 5LJ5j 3MB3A 4CUTA 1N9SA 2DE0X 2EJGA 2R5MA 3LYIA 2MF2A 5CKHA 1GRIA 3X25B 2DRKA 4QSQA 2GFUA 3HRTA 2RNWA 3IU6A 2BZ8A 4DQ2A 3CD6T 2LJ3A 2C0TA 4KUIA 4XY8A 5IGKA 5CUGA 2F1LA 3EG2A 4A9LA 1VQ4A 4NYWA 1SRMA 1ZA2B 2GFAA 2AT1B 2RI2A 4EDUA 5E9MA 2BUDA 2QXFA 3HP9A 1S72T 1WGSA 2O9SA 5LJ2A 2QYZA 1OX9A 3MB4A 4M7DG 3S3NA 3VU3C 1AZEA 2Y90A 2YRDA 3REAB 1Q7YU 2KXDA 4ME7A 2AZSA 3VRYA 2YYNA 5LJ3f 4FIBA 1MMAA 4BE1A 1WXBA 2RHXA 2RNYA 3C95A 4RKUE 5EGUA 2NUPB 1JJ2S 3VS6A 5E3DA 2FZGB 2OAWA 4DBQA 1VQ9A 2DRMA 1EQFA 4NL2A 4WHUA 1YITQ 5BT4A 2LRQA 1W2BS 2VXFA 2DVRA 4E7SA 4C0DB 5FLXE 1YIJA 2KEAA 3L2RA 1ABOA 3RKXA 2NYSA 2E1HA 2K4YA 2M0OA 1K9MC 5BT5A 4YTLA 3M56A 1NLPC 1QP2A 2JTMA 5CQAA 1O9SA 3CD6A 4YBMA 1YI2Q 3INZA 1UGSB 3RMQA 1WNLA 1RAHB 3P1EA 4HVWA 1M3CA 1UHFA 1SKUB 4FYWB 4NR5A 1X2KA 4IKFA 3EGXA 1BCOA 5CO7A 3VJPA 3X28B 4N4GA 2AIRB 2HCKA 2KT1A 2KNBB 1M3AA 4YYHA 1KD1R 3M0TA 3QWXX 2EQIA 4GBQA 3EH2A 2EYWA 5KTWA 1TH7A 2L89A 4PJOD 5E9LA 4BW4A 5KHMA 1GXIE 2BE9B 1R77A 4RG8A 5CUAA 4LYWA 2E70A 5CPEA 1YCYA 1Z9QA 1UECA 4BI4A 1QLYA 3JCMQ 5LJ0A 4D6WA 4MR3A 2N9GA 2EJFA 1VQNT 4LR6A 3WXMB 3G71Q 1WHHA 3EG3A 5CZGA 4EPCA 2XK0A 3ERRA 1WPYA 4NR4A 3BDUA 4M78E 4JJNK 4O75A 5HY6A 4IUVA 2DA9A 3PVLA 3O8VA 1LJOA 1ZHIA 2K5IA 1VQ5T 1Q81U 3L42A 3CCET 4EMHA 5FU7C 1OI1A 1WDXA 4C8QG 2OTLQ 5LJ3j 2VGNA 4C0ZA 4MENA 3JB9D 1K0SA 2MI6A 5CRMA 5H1VA 1M3BA 4OGIA 1PWTA 4MDWA 1I8FA 3VS3A 5GMKe 3HSBA 3NGPA 3KXTA 5F62A 3UV5A 1X43A 2DIGA 5IIDA 2YUOA 4KULA 4M75A 3QPHA 4OUFA 4GPJA 3UA6A 2KAFA 4TT4A 1M1KR 1BIBA 2KGTA 3M54A 3G4SQ 1MNEA 2PTKA 4Z89A 2M0YA 5DFCA 4LC2A 4M4ZA 4VUBA 4NUDA 5FG5A 5CKBA 4M7DF 1PM3A 4J9EA 4TS8A 4YK0A 5FFVA 1KSWA 1PSFA 4PL6A 4FSXA 4Z8AA 2J6OA 1KQSA 4Z93A 3M0PA 4YBTA 1VQNA 4YYGA 5CUCA 2QDLA 3RMSA 2RI7A 1I07A 4Y91A 2DKGA 3L2ZA 4ZN1A 1VA7A 5HFRA 4RTTA 5EVAA 2QEXT 1RACB 5LL6S 3SVFA 1JM4B 5HKCA 3SDZA 5CTLA 2DVSA 2X4JA 3CQTA 1IHWA 1I5OB 3EH1A 4J9FA 3CCST 3CCEA 4CUPA 3CMET 2D6FA 2AZVA 4XUBA 5GANe 1WJQA 2VGMA 2RI3A 5E0RA 5D0CA 3P1FA 1SHGA 4LZRA 4E6RA 1G3WA 4ZTJA 5EISA 4N0AA 4IUPA 4C5EA 1Q86U 2ED1A 2LZ6B 1YJNA 5IXFA 2D0NA 4OGJA 3KFVA 5CFWA 2EIFA 4EMGA 4NRAA 1X6BA 4YABA 4PJOC 4TZ2A 3RNJA 2PU9B 1X01A 1WHGA 4NUCA 1YJWA 3L2QA 4F14A 1F1BB 2PVOB 1B34B 5ETDA 2DL4A 3H0IA 1V1CA 4BDYA 4J6WA 3GIBA 4UYDA 4QVDA 1JJ2P 2M02A 1TS9A 2CH4W 4IR4A 5GMKi 4CLBA 4BI3A 1OEBA 3CXCS 3JVLA 1UG1A 4OB3B 4NOYA 3ASKA 5LKZA 1U1SA 3V7CA 3RR6A 1ZSZA 2JS2A 2ZZDA 2DXUA 3OYCA 1LVKA 3U5NA 4XTZA 3CCSA 4FYVB 4UIWA 1R8OB 3CMEA 4FLPA 4ALHA 3VKGA 4AKHA 5I21A 3GLXA 2J6KA 4NR7A 2BIVA 2EYYA 2FSAA 5HFQA 5DFBA 3ONIA 3GOXA 3RERA 3G0JA 4BB7A 2EVRA 3RDVA 2DPPB 5HEMA 4C8QF 4M78A 5CRZA 1YJ9T 5IH2A 4UC4A 2QQSA 3HL8A 2HL3A 3RIRA 4NR9A 2GRCA 4C67A 5D6XA 3G6EQ 1G3YA 1N27A 2D1XA 2RK2A 4OP0A 6AT1B 3HKSA 5GAMf 4JRQA 3M0SA 2YELA 1SPKA 1YIJQ 2KY9A 3CCRA 4NQNA 4HBVA 4WHWA 1ZQ1A 4OMFB 3OMCA 3I3JA 2HL5C 3BE3A 5A5OA 3LWHA 2RO0A 3HMHA 4E7HA 4N4FA 1VQMA 3BDLA 4NL3A 4F7UA
chains in the Genus database with same CATH topology
3CPWA 2XDPA 2GF7A 4M78D 3OYGA 4XU3A 1BYMA 3OYNA 2XD0A 5LKUA 2X4WA 4TT2A 1NZ9A 5C89A 2E12A 4O74A 3OYYA 3LWIA 1Q7YC 4LZ2A 3H8ZA 3QJ6A 3AADA 5LKXA 3O34A 4L59A 3TEEA 5L96A 1M8VA 4OGCA 3JCMe 4QVCA 4A9MA 2LCLA 2D9TA 4QZSA 3E9FA 2K5LA 4HBWA 2WP1A 2ZPBB 5A5QA 5IN1A 5E9YA 2HAXA 5F60A 3CC2T 2DVQA 3FRNA 3Q1JA 5E9KA 4O7FA 2QQRA 5AD2A 3MEVA 3QDRB 1NJIU 2E65A 5JWMA 2DVEA 3ZBDA 1M4ZA 1JBMA 3OYDA 2RJFA 2E6NA 3VUZA 4JS5A 4RMOA 4JUVA 5JI8A 5A82A 4HXLA 2QA4T 5AMFA 4M77A 5CVIA 5FRNA 2RA2A 4QSVA 5GAMj 3CBPA 2JOYA 4F7UG 1D3BB 3MEAA 5II2A 1N9RA 1QVGA 4WIVA 5GANg 5D3PA 1IREB 3UWNA 4QSSA 5EPBA 5F5ZA 4IOOA 4ALGA 3OYAA 2F69A 1WUGA 1ZS5A 3CC2A 4OVAA 4YYKA 5LUUA 5FG4A 2LC4A 3QIIA 4C66A 1WJSA 4M7AG 4CUQA 5COIA 2O01E 3QZVA 3VYGA 2I7KA 2A3LA 1MGQA 1KQ2A 4QB3A 2DXBA 4DOWA 4CURA 2PQWA 4JRIA 4YH3A 2KDSA 5LJ3e 3MHXA 2H3JA 2QA4A 2P4TA 4HKEA 1UGRB 5FG6A 2JVVA 5I83A 3DWYA 1YHQT 1QVPA 5D3JA 2KMTA 2DWWA 3LW5E 2DD4A 3JB9J 4QSPA 2L5QA 5II1A 2R10A 4C92C 4F3IA 3S92A 3GNGA 5GAOl 4YYJA 3OYFA 5LJ5f 5G4SA 3O35A 4TTEA 2F6JA 3P5OA 1HK9A 2K3XA 3OBWA 5CUBA 5DKHA 2EQUA 5EWHA 4BDZA 4C0DC 4EMKB 4PJOE 2FB7A 2QQAA 5C0MA 4MMKA 2OSSA 2DTOA 4A9FA 5LJ5g 5CKDA 3JVJA 1F68A 2JTFA 4O76A 2X4YA 4XQ3A 2ZPFB 4LDVA 2R58A 2DXTA 5H1TA 3X24B 2CZ7B 1I4K1 3M4YA 4ZN3A 5I7YA 2X4XA 5D26A 4QYDA 4YYMA 1B34A 4IR3A 1OZ2A 2RM4A 4YATA 4LDXA 5J0DA 3S3MA 3JCMg 2WP2A 4F7UF 3OYEA 4RCBA 3OS2A 5HRXA 3OYBA 4LDFA 4A9NA 2B8AA 5GAN8 1SSFA 3JVMA 3VKIA 1UGQB 3P8BB 3P8HA 3N5BB 2P0QA 4M7AF 3T9NA 1M1FA 1KQSS 4A54A 2QQBA 4NS5A 4M7DD 4Q0OA 2DVVA 1M5Q1 2DAQA 4LDYA 3M58A 2LT4A 2CZ1B 3OSSC 4RG2A 4JS4A 3UV4A 3CEYA 5TB6A 5DLXA 1NE8A 5DKCA 5A7CA 5EI4A 3L2VA 4C92B 3ZYUA 4N4IA 3FDRA 5CQTA 2FVUA 5EWDA 3NTIA 3JCMb 5EU1A 2WSEE 3J80E 4NQMA 4TVRA 5IGMA 5C6SA 5CY9A 1FXXA 4M7AB 5I86A 5DFDA 5FE9A 2VYTA 5CQ4A 5C87A 3ZEHA 3LQIA 3MXFA 3OS5A 4UYFB 5LJ3g 5A5PA 4O7BA 3SFMA 2RJDA 4YYDA 1NJIC 3E1SA 4J0SA 4PJOA 5CP5A 1WJRA 2ZPEB 2YDWA 1K73U 5IAYA 4BUGA 4XU1A 3CCMT 1S72A 2RS9B 3DB4A 3OYKA 4MZPA 5HCLA 5ETBA 1VQPT 1KC8C 2LSPB 5TCMA 4Z1SA 5KCOA 3M4GA 4C0GA 2K2VA 2NXBA 4P5NA 3M5AA 4CFLA 4PKLA 2OTJT 3U5JA 4M7DC 3QUIA 3CCUT 4E7JA 1D3BA 3GNFB 5GAMe 3C12A 5ENFA 2RNXA 3UPUA 2XICA 4A9IA 4C5HA 5E9IA 4OB0B 4II1A 1EIFA 3UV2A 2YLCA 5FE3A 3QHSA 5CQ6A 2MMPA 1G3SA 4GLKA 4YBSA 4AKNA 5I29A 4IR6A 2K3YA 4IURA 3OYIA 2YEKA 5EK9A 2RO1A 4QSRA 5EG2A 3CCMA 4ATOA 5A0DA 1BI1A 1VQPA 5A5SA 2XDDA 4LD6A 4FT4A 5IGNA 2ZCFB 4ZTFA 2DTHA 2OTJA 4TQNA 3CBOA 3QYGB 4HXPA 2E10A 2E7OA 4IUUA 4C92E 3OW2S 3MP8A 2ZPHB 1H641 3M59A 4MEQA 3U5OA 2HD0A 4HXKA 4QR3A 3GF5A 1QVFA 3S91A 4NR6A 3PIOA 3CCVT 5F2PA 1VQ5A 3RUXA 4KUDK 2LDMA 4A53A 5ENHA 5CAIA 1OYXA 4LDUA 5A5RA 5CQ8A 2A7YA 1W4SA 3JB9G 4HCCA 3QJYA 2FYKA 2E41A 4CL9A 4NUEA 1E6IA 1QVGS 1KQ1A 3QXEB 4C8QC 2MAMA 3FIFA 2M1HA 3QZ5B 5E73A 5CQ3A 2XKOC 4XUAA 4QEUA 5F25A 2PVDB 5IG6A 5FE0A 4O7EA 3MUKA 4E96A 4J7FA 4B9XA 2RK1A 1N8RU 3HFNA 4M75G 3LGLA 4M7DB 4B9WA 4OF1A 2V8KA 2QEXA 1KHCA 3MO8A 3CCVA 2YQDA 4L5GA 4IR5A 2RJCA 3LQHA 3P1CA 4UIVA 2LVMA 3MP1A 4N4HA 5CQ7A 2O4XB 1W2BA 3TLPA 2XI9A 3U5KA 2RHZA 4MZMA 4BE2A 3TU4K 3LLRA 3MCAB 4XTXA 1VQ6T 3CPFA 1AHJB 4QSWA 2NLUA 2KSSA 4E7KA 4HCBA 5EV9A 4YC9A 5D6YA 5ENGA 1VUBA 3HFOA 2L5EA 2KQWA 2L84A 3PGGA 5I1QA 3I55T 2YHTA 5LJ5e 3OY9A 5GAOn 2HNIA 5C8GA 3P8DA 4YH4A 3WVEB 2M16A 4LRGA 1MHNA 5GAMg 5HRVA 1U1TA 4MEOA 2LX9A 5GMKm 5FH8A 5ENBA 3FJPA 4TU4A 4C92A 3FB9A 3UDCA 4J0RA 3PFSA 2QTXA 3LJWA 2QQ9A 2JZ2A 4BW1A 4R56A 1WUMA 3BY7A 2P0PA 5CGPA 4MEPA 1VQ6A 2WACA 1YJ9A 2YEMA 2V8IA 3JB9F 1P92A 3U5PA 4ZQLA 2KVQG 5I80A 5GANd 3E9GA 1XTDA 5FB0A 4DONA 3QKJA 2YLBA 4J6XA 4C8QB 4C92D 1YITT 5A85A 5L97A 4EMKC 3VV0A 5DLZA 2R0SA 2E3KA 4PLIA 4WF2A 4KT0E 1M1KC 1K73C 5HQ7A 4M78G 4Y03A 2IG0A 4UYHA 5F1LA 4MMLA 4NRCA 4RCCA 4QY4A 3IU5A 3BW1A 4TYLA 1YI2T 1WQWA 4M7AD 4PY6A 4Y28E 2CGHA 1KC8U 4M75F 4XYAA 5CKEA 2DATA 4XTUA 3KBGA 4M7DE 3OBYA 3OS1A 5FFYA 2MWPA 4Q0NA 2RHUA 3VYHB 2XU8A 3PNWC 4QSXA 4JRPA 2E64A 5KH6A 5GAOq 4QEWA 2VUBA 2F5TX 5FE7A 5H85A 3GPLA 4UYGA 4NXJA 5EPRA 3HPWA 1YITA 2DZCA 5DW2A 3U5MA 1JRIA 4CFKA 1IZ6A 3G71T 4UYEA 4UIZA 1PSEA 4JLGA 5ACYA 5GAN4 5L99A 3JCMX 5BT3A 2LNVA 1YI2A 2OTLT 4LZSA 3QZSA 2XHCA 5GAN2 4NYVA 3H6ZA 4X34A 5D24A 4C5IA 5GAN7 2RH2A 3NTKA 3DLLA 2DIQA 3CXCA 2PUOB 4QNSA 2DJZA 4QQ6A 2DZ9A 4LDWA 2V8JA 4BJXA 5I89A 2LT1A 3G7ZA 4BI8B 2LQKA 2R57A 4M77G 5HK0A 3JCMd 4MDXA 3CC4T 2EJ9A 4CRIA 5EQ1A 5LVRA 5CUDA 5A2QE 3G71A 5HK3A 1BI3A 5A5NA 4HXMA 4C8QE 5DW1A 4HCZA 4M7AC 3RKWA 4ZC9A 5D3RA 1YBYA 2YW5A 2JUFA 4ZGJB 3QG1A 4M78F 4QYLA 2EQMA 1FX7A 5GMKh 4A4EA 4X9CA 5DYCA 5C7NA 1YHQA 2ZPIB 2KTBB 4TT6A 3MULA 5A81A 2D82A 4E7IA 5FRMA 4HBYA 2HQEA 1N8RC 4XK8E 4ZGEB 3URGA 4MR5A 2K5FA 5A0LA 3M9QA 3QZ9B 4N3WA 4PKCC 1XNIA 3CC4A 4BHWA 4M7DA 1ZBXA 2PUKB 4CI0C 1M90C 4Z6HA 3CBMA 4A9EA 2OAUA 5J39A 2DD5A 2O4XA 4PS5A 4QUTA 1QVFS 3LGFA 4A9OA 5GANh 3RKYA 1LOJA 4YYNA 2DO3A 3OYJA 3OSVA 3JB9H 2DEQA 3TREA 5FU6C 2WSCE 5FE8A 4NR8A 5CR2A 5HM0A 2LQ8A 5CQ5A 1Y96B 3G6ET 5GAN3 5FFWA 4FM4B 5H1UA 3L1AA 1KD1U 3JCMW 3AHUA 3DB3A 1YIJT 5EA1A 2RB6A 4O71A 4F7UB 5CKFA 3QSUA 4M77F 5FH6A 3S6WA 4C0FA 5KTUA 2WSFE 5I40A 1V29B 2E7NA 4IORA 2RFJA 2CYZB 2H60A 3K2JA 2RHIA 2Y4XA 5FROA 3A5ZB 4KV1A 4QBMA 3RCWA 4J83A 5DX4A 5D7XA 1H3ZA 5DYXA 3SVHA 4C8QA 3G6EA 4CUUA 4KV4A 5IBNA 5KE3A 5L98A 2MWOA 5IGLA 4UIXA 5KTXA 5DLOA 1M1KU 4KBMB 2I2LA 4XU0A 5L8UA 3CMAT 5KCHA 5M9OA 2YRVA 5FH7A 4QQDA 2CS7A 2LTOA 2ZPGB 5LJ5h 4UIUA 3S3OA 2R0VA 4J5YA 4E7LA 4C8QD 2EKOA 3KUFA 4GY5A 4M77B 3CPWS 1LNXA 5CU8A 3QYHB 2CZ6B 2K57A 3JCMh 4PNOA 4NYXA 4JLIA 3GP8A 3V8LA 2OO1A 5I88A 5KU3A 4IUQA 4TU6A 4UIYA 4MR4A 3HHTB 5I2MA 2XG8D 5D6WA 4QEVA 5FU6B 3J81E 3CMAA 5FBXA 5HJCA 3OYMA 2R5AA 4FU6A 3UW9A 3SWNC 1Y7XA 3OS0A 2AHJB 3HMFA 3MP6A 3MQMA 4YY6A 4HXNA 5J3BA 2BKDN 1XQHA 3FC3A 3PMIA 2LCCA 4LYIA 3MEWA 3FKMX 5F36A 4PJOG 4IOQA 2P0KA 4QVZA 2M9UA 3AQAA 3EFSA 4J1PA 1BIAA 4F7UE 4LYSA 3WVDB 3CCUA 2VC8A 1YJNT 3ME9A 2VXEA 4JRKA 3PTAA 4PCIA 2EFIA 4OB1B 5AYFA 5HQ5A 2FL7A 1OZ3A 1YJWT 3ER0A 3UT1A 5A0GA 5FB1A 4BD3A 4HT9A 1Q82C 2JN0A 2EQKA 5EPSA 4X2IA 4M7AE 4O78A 4O5VA 1I5LA 3PMTA 4M75D 2EWNA 4O6JA 3DKMA 2OUOA 4UITA 4HXSA 2L8DA 5D3SA 1X75C 4EMKA 3C4SA 3A8HB 4YAXA 1KG1A 3HRSA 2D9EA 4CUSA 5DY7A 3A8OB 2L3RA 4XAXB 1M1GA 5ENCA 4Q5WA 4DOVA 1VQ8T 4HXOA 3SVGA 3FLGA 4L6V5 4JDSA 4Z02A 5LJ3h 3TCJA 2X35A 3V8KA 2GQVA 3NXBA 4YADA 3OYHA 3C94A 1BKBA 1QW1A 3JCMJ 3UVYA 5ENIA 4M77E 4HXRA 3JCMV 1WQ7A 3V7RA 3A8GB 3CCRT 5DLQE 4QSTA 5GAMd 3NTHA 3OQ5A 3LXJA 1JJ2A 3JSCA 5EP7A 1VQMT 3V8JA 4XY9A 1M90U 3PT9A 1Y07A 4O77A 4XTYA 1K8AU 4DA4A 3EAEA 5ENEA 2QDYB 5HQ6A 5EWCA 3OYLA 1VQLT 4O7CA 1I81A 2F5KA 3NFCA 3META 2PVGB 4XU2A 3SWNB 4BW2A 5CQYA 1VQ8A 3EFRA 3ZFJA 3Q2EA 4O70A 5FU7B 3LQJA 3DLMA 4IUTA 4XTWA 1KD1C 1Y96A 4PJOF 3OMGA 5LVQA 3JCMc 3RESA 5ENJA 3M55A 1UEBA 4BE0A 3JB9I 4M75C 5E74A 4MZTA 1RL2A 1JB0E 5KE2A 3OA6A 3SB2A 3OB9A 3UVXA 4ZW1A 4J3IA 4YYIA 1VQLA 5KO4A 1BI2A 5FE6A 1G5VA 4MR6A 1VQOT 3O33A 3M53A 1VQKT 1UB4A 3VUBA 1XOVA 4J7IA 2F6NA 1VIEA 2G4AA 4M7AA 1M9SA 2EYQA 4A9HA 3UVWA 3FEOA 3M57A 3U5LA 5F1HA 2DXCA 4UYFA 2E6ZA 4ELYC 2DK3A 3I55A 5GAN5 5CS8A 4J8OA 3Q2FA 3X20B 4Z1QA 4QQGA 4BY6C 3LX7A 5HLSA 4N0AC 4A4KA 1K9MU 4PJOB 4QC3A 5E9VA 4QR4A 3OW2A 3O37A 4QR5A 4V2SA 4Z6IA 4QSUA 2C06A 4LD9K 5D3NA 4A9JA 5I2SA 4BW3A 4OB2B 4A4HA 5G4RA 4E47A 5GANf 5CIUA 3A8MB 3CCQT 5GMKl 4TZ8A 1VQOA 3CCLT 4HBXA 2G3RA 1VQKA 5D25A 5GAOm 4BACA 3CC7T 1RI0A 5C85A 5F61A 2CZ0B 4C92G 3A8LB 2DTIA 5DKDA 1NPRA 1X0JA 2RHYA 5E7DA 5DYAA 4XTVA 3PIPA 1VIFA 2XIDA 1KHIA 3F70A 5CK9A 1JSPB 5K29A 4M77D 4QW2A 3HMEA 4RVRA 3QBYA 2Y4YA 3P1DA 1Q81C 5F63A 5GMKj 2RI5A 4C5GA 4M78C 5LJ5d 2IVWA 5DM7R 5DBMA 2QI2A 3L2WA 4QC1A 5EM3A 4M75B 1VQ7T 5D3LA 3DAIA 4QUUA 4A4FA 4HT8A 3V7SA 5I7XA 5C4QA 3CCQA 1O75A 3G4ST 1NPPA 5J26A 3CCLA 3D7CA 3I56T 5HELA 2RJEA 5F3AA 3CC7A 3JCMP 2KK4A 2I8NA 3J7AF 5FE2A 1X6OA 1Q82U 5GAMh 5FE1A 5FDZA 3UVDA 5AD3A 4KCXA 2MJVB 5D3HA 2RD1A 2GCXA 3GG3A 4PCEA 1N6AA 4YY4A 5DY9A 3JAME 5GANj 4ELZC 2OTLA 5GAOr 5LKTA 1UGPB 1G3TA 3L2UA 3MEUA 4BY6B 4O72A 2XDBA 2EQJA 1DJ7B 1HXDA 5E3GA 1FWZA 3JVKA 3BFMA 1Q86C 1VQ7A 1QP3A 3JRZA 4NRBA 3G4SA 3JCMf 5A83A 4J6YA 5EWVA 3O36A 3I56A 5D3TA 5DYUA 3R6OA 5CCAA 3CCJT 2ZGWA 4R55A 5GAOp 4ZGDB 2VV5A 4X9DA 5CQXA 3QO3A 4OGEA 2E5QA 4A9KA 4M77C 3G0LA 4C92F 2R0YA 5AMEA 1K8AC 5EWWA 1VQ4T 4FL6A 4PLLA 5FE5A 3X26B 5IT9E 5EICA 5CUEA 3E19A 2L85A 2CKKA 4PTBA 1N72A 2DKWA 1BI0A 5L8RE 4HA8A 4FT2A 2JNGA 2HQXA 2HBPA 2FHDA 5LJ1A 3LH0A 5L8TA 3SWNA 3SD4A 4M78B 5LJ3d 1VQ9T 1Y71A 5HRWA 1U8RA 2EAYA 5GAN6 5HENA 5FE4A 4A4GA 3CCJA 3HRUA 2D0QB 4M75E 3QZTA 4O7AA 5LJ5j 3MB3A 4CUTA 1N9SA 2EJGA 2R5MA 3LYIA 2MF2A 5CKHA 3X25B 4QSQA 2GFUA 3HRTA 2RNWA 3IU6A 4DQ2A 3CD6T 4KUIA 4XY8A 5IGKA 5CUGA 4A9LA 1VQ4A 4NYWA 2GFAA 2RI2A 4EDUA 5E9MA 2BUDA 2QXFA 3HP9A 1S72T 1WGSA 5LJ2A 3MB4A 4M7DG 3S3NA 3VU3C 2Y90A 1Q7YU 4ME7A 2YYNA 5LJ3f 4FIBA 4BE1A 2RHXA 2RNYA 3C95A 4RKUE 5EGUA 1JJ2S 5E3DA 1VQ9A 1EQFA 4NL2A 4WHUA 5BT4A 2LRQA 1W2BS 2VXFA 2DVRA 4C0DB 5FLXE 1YIJA 3L2RA 3RKXA 2E1HA 2K4YA 2M0OA 1K9MC 5BT5A 4YTLA 3M56A 1QP2A 2JTMA 5CQAA 1O9SA 3CD6A 4YBMA 3INZA 1UGSB 3RMQA 1WNLA 3P1EA 4NR5A 4IKFA 5CO7A 3VJPA 3X28B 4N4GA 4YYHA 5KTWA 1TH7A 2L89A 4PJOD 5E9LA 4BW4A 5KHMA 1GXIE 4RG8A 5CUAA 4LYWA 5CPEA 1YCYA 2E70A 4BI4A 3JCMQ 5LJ0A 4D6WA 4MR3A 2N9GA 2EJFA 1VQNT 4LR6A 3WXMB 5CZGA 4EPCA 2XK0A 1WPYA 4NR4A 3BDUA 4M78E 4JJNK 4O75A 5HY6A 4IUVA 3O8VA 1LJOA 1ZHIA 2K5IA 1VQ5T 1Q81U 3L42A 3CCET 4EMHA 5FU7C 1OI1A 4C8QG 5LJ3j 2VGNA 4C0ZA 4MENA 3JB9D 2MI6A 5CRMA 5H1VA 4OGIA 4MDWA 1I8FA 5GMKe 3HSBA 3KXTA 5F62A 3UV5A 2DIGA 5IIDA 4KULA 4M75A 3QPHA 4OUFA 4GPJA 2KAFA 4TT4A 1BIBA 3M54A 5DFCA 4LC2A 4VUBA 4NUDA 5FG5A 5CKBA 4M7DF 4TS8A 4YK0A 5FFVA 1PSFA 4PL6A 4FSXA 1KQSA 4Z93A 4YBTA 1VQNA 4YYGA 5CUCA 3RMSA 2RI7A 4Y91A 2DKGA 3L2ZA 4ZN1A 5HFRA 5EVAA 2QEXT 5LL6S 5HKCA 3SVFA 1JM4B 3SDZA 5CTLA 2DVSA 2X4JA 3CCST 3CCEA 4CUPA 3CMET 2D6FA 4XUBA 5GANe 1WJQA 2VGMA 2RI3A 5E0RA 5D0CA 3P1FA 4ZTJA 4LZRA 1G3WA 5EISA 4N0AA 4IUPA 4C5EA 1Q86U 1YJNA 4OGJA 5CFWA 2EIFA 4EMGA 4NRAA 4YABA 4PJOC 4TZ2A 2PU9B 1X01A 1YJWA 4NUCA 3L2QA 2PVOB 1B34B 5ETDA 4BDYA 4J6WA 3GIBA 4UYDA 4QVDA 4IR4A 5GMKi 4CLBA 4BI3A 3CXCS 3JVLA 4OB3B 4NOYA 3ASKA 5LKZA 1U1SA 3V7CA 2ZZDA 2DXUA 3OYCA 3U5NA 4XTZA 3CCSA 4UIWA 1R8OB 3CMEA 4FLPA 4ALHA 5I21A 3GLXA 4NR7A 2BIVA 2FSAA 5HFQA 5DFBA 3ONIA 3GOXA 3RERA 3G0JA 4BB7A 2DPPB 5HEMA 4C8QF 4M78A 5CRZA 1YJ9T 4UC4A 2QQSA 3HL8A 3RIRA 4NR9A 2GRCA 4C67A 5D6XA 1G3YA 1N27A 2RK2A 4OP0A 3HKSA 5GAMf 4JRQA 2YELA 2KY9A 3CCRA 4NQNA 4HBVA 4WHWA 1ZQ1A 4OMFB 3OMCA 3I3JA 5A5OA 3LWHA 2RO0A 3HMHA 4E7HA 4N4FA 1VQMA 3BDLA 4NL3A 4F7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Q A;  5EA1 A;  2XDP A;  5J26 A;  2GF7 A;  4O71 A;  4HXP A;  2E7O A;  4IUU A;  3OYG A;  3D7C A;  3OYN A;  5HEL A;  3MP8 A;  2RJE A;  5F3A A;  5LKU A;  2X4W A;  4MEQ A;  5FH6 A;  4TT2 A;  3U5O A;  3S6W A;  5C89 A;  2I8N A;  4O74 A;  4HXK A;  5KTU A;  4QR3 A;  5I40 A;  5FE2 A;  2E7N A;  4IOR A;  4LZ2 A;  5FE1 A;  3H8Z A;  2RFJ A;  2H60 A;  3QJ6 A;  3AAD A;  5FDZ A;  3UVD A;  3K2J A;  3S91 A;  5AD3 A;  5LKX A;  3O34 A;  4KCX A;  4L59 A;  2RHI A;  4NR6 A;  2MJV B;  5D3H A;  5L96 A;  3GG3 A;  4PCE A;  5F2P A;  4A9M A;  4YY4 A;  5FRO A;  2LDM A;  2D9T A;  4KV1 A;  5ENH A;  4QBM A;  4QZS A;  3E9F A;  3RCW A;  1OYX A;  5A5R A;  5CQ8 A;  5DX4 A;  4HBW A;  5D7X A;  2WP1 A;  5A5Q A;  5LKT A;  1H3Z A;  5IN1 A;  5DYX A;  3SVH A;  4CL9 A;  5E9Y A;  4NUE A;  1E6I A;  4CUU A;  4KV4 A;  5F60 A;  3L2U A;  5IBN A;  3MEU A;  5KE3 A;  2DVQ A;  5L98 A;  4O72 A;  2MWO A;  2EQJ A;  5IGL A;  3Q1J A;  4UIX A;  5E9K A;  5E3G A;  5KTX A;  2M1H A;  4O7F A;  2QQR A;  3JVK A;  5AD2 A;  3MEV A;  5E73 A;  5CQ3 A;  5L8U A;  5JWM A;  5KCH A;  4XUA A;  4QEU A;  5M9O A;  2YRV A;  5F25 A;  5FH7 A;  4NRB A;  4QQD A;  5A83 A;  5IG6 A;  5FE0 A;  4O7E A;  5EWV A;  3OYD A;  2RJF A;  2E6N A;  3MUK A;  2LTO A;  4E96 A;  3O36 A;  5D3T A;  4UIU A;  5DYU A;  3S3O A;  2R0V A;  4E7L A;  2EKO A;  5JI8 A;  5A82 A;  4HXL A;  4B9X A;  3KUF A;  5AMF A;  3LGL A;  4GY5 A;  4B9W A;  2E5Q A;  5FRN A;  4QSV A;  3DAI A;  4A9K A;  4A4F A;  3G0L A;  1KHC A;  2R0Y A;  5CU8 A;  5AME A;  3MO8 A;  5EWW A;  3MEA A;  4FL6 A;  2YQD A;  5II2 A;  4PLL A;  4IR5 A;  5FE5 A;  2RJC A;  3LQH A;  4NYX A;  4WIV A;  3P1C A;  4UIV A;  5D3P A;  3UWN A;  5EIC A;  2LVM A;  5CUE A;  4QSS A;  3MP1 A;  4N4H A;  5CQ7 A;  2OO1 A;  5EPB A;  2L85 A;  5I88 A;  2O4X B;  5F5Z A;  4IOO A;  4ALG A;  2CKK A;  3OYA A;  3TLP A;  5KU3 A;  4PTB A;  1N72 A;  1WUG A;  4IUQ A;  4TU6 A;  1ZS5 A;  2DKW A;  4MR4 A;  4UIY A;  3U5K A;  2RHZ A;  4OVA A;  4BE2 A;  4YYK A;  5LUU A;  5FG4 A;  5D6W A;  3LLR A;  3QII A;  4QEV A;  2HQX A;  4C66 A;  1WJS A;  2FHD A;  4QSW A;  5LJ1 A;  2NLU A;  3LH0 A;  5L8T A;  4E7K A;  4CUQ A;  3SD4 A;  5FBX A;  5HJC A;  5COI A;  2R5A A;  4FU6 A;  5HRW A;  3OYM A;  3UW9 A;  5EV9 A;  4YC9 A;  3OS0 A;  5D6Y A;  3QZV A;  2I7K A;  3HMF A;  5ENG A;  5HEN A;  3MP6 A;  3MQM A;  5FE4 A;  4HXN A;  4YY6 A;  4A4G A;  2L5E A;  2BKD N;  4QB3 A;  2L84 A;  3FC3 A;  3PMI A;  2LCC A;  3QZT A;  4LYI A;  5I1Q A;  4O7A A;  3MB3 A;  3MEW A;  3FKM X;  4CUR A;  2PQW A;  5F36 A;  4CUT A;  4YH3 A;  3OY9 A;  2R5M A;  4IOQ A;  2P0K A;  3LYI A;  5C8G A;  4QVZ A;  3P8D A;  4QSQ A;  2GFU A;  5FG6 A;  3AQA A;  4YH4 A;  4J1P A;  5I83 A;  3DWY A;  2RNW A;  3IU6 A;  2M16 A;  4LYS A;  4LRG A;  3ME9 A;  1MHN A;  4XY8 A;  5HRV A;  5CUG A;  5IGK A;  4PCI A;  4MEO A;  4A9L A;  2EFI A;  4NYW A;  5ENB A;  5FH8 A;  2GFA A;  5HQ5 A;  5D3J A;  2RI2 A;  4EDU A;  1OZ3 A;  5E9M A;  4TU4 A;  2BUD A;  3UT1 A;  2DWW A;  5FB1 A;  4BD3 A;  4J0R A;  3PFS A;  4QSP A;  1WGS A;  5II1 A;  5LJ2 A;  2R10 A;  3LJW A;  2JZ2 A;  3MB4 A;  4BW1 A;  3S3N A;  1WUM A;  4F3I A;  3S92 A;  2EQK A;  5EPS A;  4X2I A;  4O78 A;  4YYJ A;  3OYF A;  2YYN A;  5CGP A;  4BE1 A;  4MEP A;  5G4S A;  3O35 A;  2WAC A;  2RHX A;  4TTE A;  3PMT A;  2RNY A;  2YEM A;  5EGU A;  2F6J A;  3U5P A;  4ZQL A;  5E3D A;  5I80 A;  3P5O A;  3E9G A;  2OUO A;  5FB0 A;  2K3X A;  1EQF A;  4UIT A;  4HXS A;  4WHU A;  4DON A;  2L8D A;  5BT4 A;  3QKJ A;  2LRQ A;  5D3S A;  3C4S A;  5CUB A;  2DVR A;  5DKH A;  2EQU A;  5EWH A;  4BDZ A;  5A85 A;  4YAX A;  5L97 A;  4QUU A;  2D9E A;  4CUS A;  5DY7 A;  3L2R A;  2L3R A;  5C0M A;  5DLZ A;  2OSS A;  4A9F A;  2R0S A;  5ENC A;  2M0O A;  2E3K A;  3JVJ A;  4Q5W A;  1F68 A;  4PLI A;  5BT5 A;  2JTF A;  4HXO A;  3SVG A;  4O76 A;  2X4Y A;  3FLG A;  5HQ7 A;  4Y03 A;  2IG0 A;  4UYH A;  5F1L A;  4Z02 A;  2X35 A;  5CQA A;  4NRC A;  4YBM A;  2R58 A;  4QY4 A;  3IU5 A;  5H1T A;  4TYL A;  3NXB A;  3P1E A;  4YAD A;  4PY6 A;  3OYH A;  5I7Y A;  4NR5 A;  2X4X A;  5D26 A;  4QYD A;  4XYA A;  4YYM A;  4IR3 A;  2DAT A;  1OZ2 A;  4YAT A;  4IKF A;  5J0D A;  3UVY A;  4N4G A;  5ENI A;  4HXR A;  3OS1 A;  5FFY A;  3S3M A;  2MWP A;  4Q0N A;  2WP2 A;  4YYH A;  2RHU A;  4QST A;  3NTH A;  3OQ5 A;  3LXJ A;  3OYE A;  5EP7 A;  5KTW A;  3PNW C;  4XY9 A;  2L89 A;  3OS2 A;  4QSX A;  5HRX A;  3OYB A;  4LDF A;  4A9N A;  5E9L A;  4BW4 A;  4O77 A;  5KHM A;  2B8A A;  5KH6 A;  4QEW A;  5CUA A;  4LYW A;  5CPE A;  5FE7 A;  5H85 A;  1SSF A;  3JVM A;  3EAE A;  5ENE A;  5LJ0 A;  5HQ6 A;  4UYG A;  4MR3 A;  4NXJ A;  5EPR A;  5EWC A;  2N9G A;  3P8H A;  3OYL A;  5DW2 A;  4O7C A;  4LR6 A;  2F5K A;  3U5M A;  5CZG A;  4CFK A;  2XK0 A;  3MET A;  4UYE A;  4NR4 A;  4UIZ A;  4NS5 A;  4O75 A;  4IUV A;  4BW2 A;  5ACY A;  3O8V A;  3Q2E A;  4O70 A;  4Q0O A;  2DVV A;  3L42 A;  5L99 A;  3LQJ A;  1OI1 A;  2DAQ A;  3DLM A;  4IUT A;  5BT3 A;  4MEN A;  4LZS A;  3QZS A;  5CRM A;  5H1V A;  5LVQ A;  3OMG A;  4OGI A;  4NYV A;  3H6Z A;  4X34 A;  5D24 A;  4RG2 A;  4C5I A;  5ENJ A;  3UV4 A;  5F62 A;  3NTK A;  3UV5 A;  2DIQ A;  2DIG A;  5IID A;  3CEY A;  5TB6 A;  4OUF A;  4BE0 A;  4QNS A;  4GPJ A;  5DLX A;  4QQ6 A;  5DKC A;  4TT4 A;  5A7C A;  5E74 A;  5EI4 A;  3L2V A;  5DFC A;  4LC2 A;  4BJX A;  5I89 A;  4NUD A;  5FG5 A;  3ZYU A;  5KE2 A;  3OA6 A;  4N4I A;  3FDR A;  4TS8 A;  4YK0 A;  2R57 A;  5FFV A;  4PL6 A;  5CQT A;  3OB9 A;  3UVX A;  4ZW1 A;  4Z93 A;  4J3I A;  4YYI A;  5KO4 A;  4CRI A;  4YBT A;  5EQ1 A;  4YYG A;  5LVR A;  5FE6 A;  1G5V A;  4MR6 A;  5CUD A;  5CUC A;  5EWD A;  2RI7 A;  3NTI A;  3O33 A;  5HFR A;  5EU1 A;  5EVA A;  2F6N A;  3SVF A;  4NQM A;  1JM4 B;  2G4A A;  5A5N A;  5CTL A;  5IGM A;  4HXM A;  2DVS A;  4A9H A;  5DW1 A;  5C6S A;  5CY9 A;  4HCZ A;  3UVW A;  3FEO A;  5I86 A;  5DFD A;  3U5L A;  5F1H A;  5FE9 A;  4UYF A;  2VYT A;  4CUP A;  5CQ4 A;  4ZC9 A;  5C87 A;  3ZEH A;  3LQI A;  3MXF A;  4UYF B;  4XUB A;  5A5P A;  4O7B A;  5CS8 A;  5D3R A;  1WJQ A;  2YW5 A;  2RJD A;  4YYD A;  2RI3 A;  3Q2F A;  5E0R A;  3P1F A;  5D0C A;  4LZR A;  4ZTJ A;  5EIS A;  4C5E A;  4IUP A;  4QYL A;  2EQM A;  4Z1Q A;  4QQG A;  4J0S A;  5CP5 A;  3LX7 A;  4OGJ A;  5HLS A;  1WJR A;  5CFW A;  4A4E A;  5DYC A;  5C7N A;  4NRA A;  4QC3 A;  4YAB A;  2YDW A;  2KTB B;  4TT6 A;  3MUL A;  4TZ2 A;  5E9V A;  5A81 A;  4QR4 A;  2D82 A;  4E7I A;  5FRM A;  4HBY A;  3O37 A;  4NUC A;  3L2Q A;  4QR5 A;  5IAY A;  2RS9 B;  4Z6I A;  3DB4 A;  3OYK A;  4QSU A;  5HCL A;  5ETB A;  2HQE A;  5ETD A;  5D3N A;  2LSP B;  5TCM A;  4BDY A;  4Z1S A;  4A9J A;  5KCO A;  4UYD A;  4MR5 A;  2NXB A;  4BW3 A;  4A4H A;  3M9Q A;  4N3W A;  5G4R A;  4CFL A;  1XNI A;  4IR4 A;  5CIU A;  4CLB A;  4PKL A;  4BHW A;  3JVL A;  4TZ8 A;  4HBX A;  2G3R A;  3ASK A;  3U5J A;  5LKZ A;  5D25 A;  4BAC A;  4Z6H A;  4E7J A;  1RI0 A;  5C85 A;  5F61 A;  5ENF A;  2RNX A;  4A9E A;  3OYC A;  5J39 A;  3U5N A;  5DKD A;  4A9I A;  1X0J A;  2RHY A;  5E7D A;  4C5H A;  4UIW A;  5DYA A;  4FLP A;  2O4X A;  4ALH A;  5E9I A;  4PS5 A;  4NR7 A;  2BIV A;  2FSA A;  4QUT A;  3LGF A;  4A9O A;  5HFQ A;  3F70 A;  4II1 A;  3UV2 A;  5DFB A;  3ONI A;  3GOX A;  1JSP B;  5FE3 A;  3G0J A;  5K29 A;  4QW2 A;  5CQ6 A;  3HME A;  4RVR A;  3QBY A;  5HEM A;  4YYN A;  3OYJ A;  3P1D A;  4YBS A;  4AKN A;  5I29 A;  5CRZ A;  4UC4 A;  4IR6 A;  2K3Y A;  4IUR A;  2QQS A;  5FE8 A;  5F63 A;  4NR8 A;  4NR9 A;  2GRC A;  4C67 A;  5HM0 A;  2RI5 A;  5D6X A;  4C5G A;  5CQ5 A;  3OYI A;  2YEK A;  5EK9 A;  1N27 A;  2RO1 A;  4QSR A;  5FFW A;  5DBM A;  3L2W A;  5H1U A;  2YEL A;  5A5S A;  4LD6 A;  4NQN A;  4HBV A;  4QC1 A;  4WHW A;  3DB3 A;  5IGN A;  5EM3 A;  3OMC A;  3I3J A;  4ZTF A;  5D3L A;  5A5O A;  3BDL A;  2RO0 A;  3HMH A;  4E7H A;  4N4F A;  5I7X A;  4TQN A; 
#chains in the Genus database with same CATH topology
 3CPW A;  2C0O A;  2XDP A;  2GF7 A;  1BB9 A;  2HSE B;  4IIM A;  4M78 D;  4XU3 A;  4AFZ C;  3OYN A;  3OYG A;  2XD0 A;  1BYM A;  5HCK A;  5LKU A;  2X4W A;  3ULR B;  3EG9 B;  3EGD B;  4TT2 A;  1NZ9 A;  5C89 A;  2E12 A;  3I9Q A;  4O74 A;  3OYY A;  3LWI A;  2EYX A;  1Q7Y C;  4LZ2 A;  3H8Z A;  2IPO B;  1T3L A;  3QJ6 A;  3AAD A;  5LKX A;  3O34 A;  4L59 A;  3TEE A;  1SHF A;  5L96 A;  4DBF A;  1M8V A;  4OGC A;  3JCM e;  1D09 B;  4QVC A;  4A9M A;  2A28 A;  2LCL A;  1HJD A;  2D9T A;  1AWO A;  4QZS A;  2NUP A;  3E9F A;  4AFU C;  4AFS C;  1BK2 A;  1M90 R;  2K5L A;  4HBW A;  2WP1 A;  2ZPB B;  5A5Q A;  5IN1 A;  1S1N A;  5E9Y A;  2HAX A;  2GBQ A;  1K8A R;  5F60 A;  3CC2 T;  2DVQ A;  1NG2 A;  4OMN A;  2V26 A;  3FRN A;  3Q1J A;  2CP5 A;  5E9K A;  4O7F A;  2QQR A;  5AD2 A;  3MEV A;  3CMA Q;  3QDR B;  1NJI U;  3OW2 P;  2E65 A;  2DYI A;  5JWM A;  1W6X A;  2DVE A;  3ZBD A;  1M4Z A;  1ZUU A;  1JBM A;  3OYD A;  2RJF A;  1K76 A;  2E6N A;  1WYX A;  2J7I A;  3NMZ C;  3VS2 A;  3VUZ A;  4JS5 A;  3D1D A;  4RMO A;  4HXJ A;  4JUV A;  5JI8 A;  5A82 A;  4HXL A;  1PG5 B;  2QA4 T;  5AMF A;  3AT1 B;  4M77 A;  1ZA1 B;  5CVI A;  1TUD A;  5FRN A;  2RA2 A;  4QSV A;  2MCN A;  2ESW A;  5GAM j;  3CBP A;  2JOY A;  4F7U G;  1ZX6 A;  1D3B B;  3MEA A;  5L23 A;  5II2 A;  4OMQ A;  1N9R A;  1QVG A;  4WIV A;  5GAN g;  1JEG A;  5D3P A;  1IRE B;  2CP3 A;  3UWN A;  1T3S A;  4QSS A;  5EPB A;  5F5Z A;  4IOO A;  4ALG A;  3OYA A;  2IIM A;  2F69 A;  1UJ0 A;  1WUG A;  1BU1 A;  1ZS5 A;  3CC2 A;  2DBK A;  4OVA A;  4YYK A;  5LUU A;  5FG4 A;  1QQJ A;  2LC4 A;  3QII A;  1H8K A;  4C66 A;  1WJS A;  4M7A G;  4CUQ A;  5COI A;  2O01 E;  2RF0 A;  3QZV A;  3VYG A;  2I7K A;  2A3L A;  1MGQ A;  1KQ2 A;  4QB3 A;  2DXB A;  4DOW A;  4CUR A;  2HEQ A;  2PQW A;  4JRI A;  4YH3 A;  2KDS A;  5LJ3 e;  3MHX A;  2H3J A;  2QA4 A;  2P4T A;  1TUG B;  4HKE A;  1UGR B;  5FG6 A;  1RAI B;  2JVV A;  5I83 A;  1MV3 A;  3DWY A;  1RUW A;  1YJN Q;  2BZY A;  2KI7 A;  1AWX A;  1YHQ T;  2RN8 A;  1QVP A;  1K9M R;  2DL5 A;  1YJW Q;  5D3J A;  2KMT A;  1TG0 A;  3TSW A;  2DWW A;  3RBB B;  1M8M A;  2DD4 A;  2O2O A;  3LW5 E;  3JB9 J;  4QSP A;  2L5Q A;  5II1 A;  2R10 A;  4C92 C;  2P4R A;  3GBQ A;  1VOM A;  4F3I A;  3S92 A;  1X6G A;  3GNG A;  1SRL A;  5GAO l;  1JQQ A;  4YYJ A;  3OYF A;  5LJ5 f;  5G4S A;  3O35 A;  4TTE A;  3IQL A;  2F6J A;  3P5O A;  1HK9 A;  2K3X A;  3OBW A;  5CUB A;  4PJN A;  5DKH A;  2EQU A;  3CCS Q;  5EWH A;  2JT4 A;  4BDZ A;  4C0D C;  4EMK B;  5I11 A;  4PJO E;  2FB7 A;  2QQA A;  5C0M A;  4MMK A;  2OSS A;  2CUD A;  1ZSG A;  4A9F A;  2DTO A;  5LJ5 g;  1TU0 B;  5CKD A;  1VQ8 Q;  2RNA A;  3JVJ A;  1F68 A;  1X2Q A;  2JTF A;  4O76 A;  2X4Y A;  1IRX A;  4XQ3 A;  2MPX C;  2ZPF B;  2LCS A;  4LDV A;  2R58 A;  2L2P A;  2DXT A;  1QKW A;  1D1B A;  5H1T A;  1T0H A;  2A37 A;  2A08 A;  3X24 B;  2CZ7 B;  1I4K 1;  3M4Y A;  4ZN3 A;  1TTH B;  5I7Y A;  2X4X A;  5D26 A;  2KT8 A;  4QYD A;  4YYM A;  1V76 A;  4R0K A;  1B34 A;  4IR3 A;  1OZ2 A;  2RM4 A;  4YAT A;  4LDX A;  2KE9 A;  5J0D A;  3VS5 A;  3CCR Q;  3S3M A;  3JCM g;  2WP2 A;  4KRT A;  4F7U F;  2DFU A;  2D8H A;  2FRW A;  1VQM Q;  3OYE A;  1M27 C;  4RCB A;  2BZX A;  3OS2 A;  1A0N B;  5HRX A;  3OYB A;  2DX1 A;  1WHL A;  4LDF A;  4A9N A;  1M2V B;  3TVT A;  3UF4 A;  2QTV A;  2B8A A;  4KGV B;  5GAN 8;  1D0X A;  1SSF A;  3JVM A;  3VKI A;  1TSF A;  1UGQ B;  2YRC A;  3P8B B;  3P8H A;  1HSQ A;  3N5B B;  2P0Q A;  4M7A F;  3QDF A;  2QAS A;  1Q82 R;  3T9N A;  1M1F A;  1KQS S;  4A54 A;  2QQB A;  4NS5 A;  1IB8 A;  2LJ1 A;  4M7D D;  1IGQ A;  4Q0O A;  2DVV A;  1M5Q 1;  4JZ3 A;  2DAQ A;  4LDY A;  1KJW A;  1WA7 A;  3PE0 A;  3M58 A;  2KRO A;  2CZ1 B;  1OV3 A;  2LT4 A;  3OSS C;  2O88 A;  2RQU A;  4OML A;  4RG2 A;  2DET A;  4JS4 A;  3UV4 A;  5KYW B;  3CEY A;  5TB6 A;  5DLX A;  2HKQ B;  4AKG A;  1NE8 A;  5DKC A;  5A7C A;  2K79 A;  2JXB A;  5EI4 A;  3QWY A;  4PFP A;  3L2V A;  1NBE B;  4C92 B;  2K7A A;  3ZYU A;  3EGD A;  4N4I A;  2V1Q A;  3FDR A;  5CQT A;  2W0Z A;  5ECA A;  2FVU A;  1VQO Q;  1PD1 A;  4FYY B;  1OPL A;  5EWD A;  1VQK Q;  3M0U A;  3NTI A;  3JCM b;  4RTW A;  5EU1 A;  2WSE E;  3J80 E;  1OU8 A;  4NQM A;  4TVR A;  4OMM A;  5IGM A;  5C6S A;  5CY9 A;  1FXX A;  4M7A B;  5I86 A;  5DFD A;  5FE9 A;  2VYT A;  1IGU A;  5CQ4 A;  5AT1 B;  5C87 A;  3ZEH A;  3LQI A;  3MXF A;  3OS5 A;  4UYF B;  5LJ3 g;  5A5P A;  4O7B A;  3SFM A;  2RJD A;  4RUG A;  3TSZ A;  4YYD A;  1NJI C;  2GGR A;  4J9I A;  3E1S A;  4J0S A;  2ABL A;  5FW9 A;  4PJO A;  5CP5 A;  1WJR A;  2GNC A;  2ZPE B;  1GBR A;  2YDW A;  2XMF A;  1K73 U;  2COY A;  4CC2 A;  1NEG A;  4FW1 A;  5IAY A;  4BUG A;  4XU1 A;  3CCM T;  1S72 A;  2RS9 B;  3DB4 A;  1YNZ A;  3MKD A;  1TXQ A;  4MZP A;  5HCL A;  3OYK A;  5ETB A;  1VQP T;  2PNI A;  1KC8 C;  2LSP B;  2L3P A;  5TCM A;  4Z1S A;  5KCO A;  3LH5 A;  3M4G A;  4C0G A;  2DL8 A;  2K2V A;  2NXB A;  4P5N A;  3M5A A;  1HYO A;  4CFL A;  3CCQ Q;  4PKL A;  2KYM A;  3REB B;  2OTJ T;  3CCL Q;  2QK0 A;  4AG2 C;  3U5J A;  2W10 A;  4M7D C;  3CC7 Q;  3QUI A;  3CCU T;  4E7J A;  1D3B A;  3GNF B;  5GAM e;  3C12 A;  5ENF A;  2RNX A;  4RTY A;  3UPU A;  2XIC A;  4A9I A;  4C5H A;  1QCO A;  5EC7 A;  5E9I A;  4OB0 B;  5KYX A;  2KXC A;  4II1 A;  1EIF A;  3UV2 A;  2YLC A;  5FE3 A;  1NM7 A;  3QHS A;  1Z9Z A;  4PJM A;  5CQ6 A;  2MMP A;  1G3S A;  3I35 A;  1Q7Y R;  4GLK A;  4YBS A;  4AKN A;  5I29 A;  3H9N A;  4IR6 A;  2K3Y A;  4IUR A;  1ACM B;  3OYI A;  2E3I A;  2YEK A;  5EK9 A;  2RO1 A;  4QSR A;  2Z0W A;  4RTX A;  5EG2 A;  3CCM A;  4ATO A;  5A0D A;  2CT4 A;  3UA7 A;  1BI1 A;  1VQP A;  1J3T A;  5A5S A;  2XDD A;  4LD6 A;  1VQ7 Q;  4FT4 A;  5IGN A;  2ZCF B;  2EJN A;  4ZTF A;  2DTH A;  1ZUY A;  2OTJ A;  4TQN A;  3CBO A;  3QYG B;  2F2V A;  3I56 Q;  4HXP A;  2E10 A;  1RI9 A;  2SRC A;  1PRL C;  2E7O A;  4IUU A;  4WCI A;  4C92 E;  4AT1 B;  3OW2 S;  3MP8 A;  2ZPH B;  1H64 1;  3M59 A;  4MEQ A;  1WX6 A;  1WZO A;  1KQS P;  1GFD A;  3U5O A;  2HD0 A;  4HXK A;  4QR3 A;  1C6V X;  4JZ4 A;  3GF5 A;  1QVF A;  1WLP B;  3S91 A;  1UGV A;  4NR6 A;  3PIO A;  3CCV T;  5F2P A;  4HVU A;  1VQ5 A;  3RUX A;  4ORZ A;  4KUD K;  2LDM A;  4A53 A;  5ENH A;  1UUE A;  5CAI A;  1OYX A;  4LDU A;  5A5R A;  5CQ8 A;  2A7Y A;  1W4S A;  3JB9 G;  4HCC A;  3QJY A;  2FYK A;  2E41 A;  4CL9 A;  4NUE A;  1E6I A;  4J9D A;  1QVG S;  1KQ1 A;  4AI6 A;  3QXE B;  1MND A;  4C8Q C;  2MAM A;  1MUZ A;  2RQW A;  3FIF A;  1SF9 A;  2M1H A;  1GL5 A;  3QZ5 B;  2H8H A;  5E73 A;  5CQ3 A;  4LUD A;  2XKO C;  4F17 A;  2J05 A;  1K1Z A;  4XUA A;  4QEU A;  3VRZ A;  5F25 A;  2PVD B;  2K2M A;  5IG6 A;  5FE0 A;  4O7E A;  3MUK A;  4E96 A;  3CCJ Q;  2QGG A;  1Q81 R;  4J7F A;  4LNP A;  1RLP C;  1QMC A;  4B9X A;  2COW A;  2RK1 A;  1N8R U;  3HFN A;  4M75 G;  2LNH B;  3LGL A;  4M7D B;  1IHV A;  4B9W A;  4OF1 A;  2V8K A;  2QEX A;  4FCY A;  2F2X A;  2JTE A;  1VQ4 Q;  1KHC A;  1MMD A;  3MO8 A;  3CCV A;  1B7T A;  2YQD A;  4L5G A;  4IR5 A;  2RJC A;  3LQH A;  1M2V A;  1FYN A;  3P1C A;  4UIV A;  2LVM A;  3MP1 A;  4N4H A;  5CQ7 A;  2O4X B;  1W2B A;  3TLP A;  2XI9 A;  3U5K A;  1U5S A;  2EKH A;  2RHZ A;  4MZM A;  4X1V A;  4BE2 A;  2ATC B;  3TU4 K;  3LLR A;  3MCA B;  4XTX A;  2DMO A;  1VQ6 T;  3CPF A;  1AHJ B;  4QSW A;  1Q95 G;  2NLU A;  2O31 A;  4ANJ A;  2KRS A;  2KSS A;  4E7K A;  1VQ9 Q;  2GTO A;  4HCB A;  4DBR A;  5EV9 A;  4J9H A;  4YC9 A;  5D6Y A;  2MYS A;  5ENG A;  4Y92 A;  1VUB A;  2LX7 A;  2L5E A;  2KQW A;  3HFO A;  2L84 A;  3PGG A;  1TUC A;  5I1Q A;  3I55 T;  2YHT A;  1OX8 A;  3CPW P;  5LJ5 e;  3OY9 A;  5KYW A;  5GAO n;  2HNI A;  5C8G A;  3A98 A;  3P8D A;  4YH4 A;  3WVE B;  3CD6 Q;  2M16 A;  1JU5 C;  4LRG A;  1Q86 R;  1MHN A;  2YSQ A;  5GAM g;  4B6M A;  5HRV A;  1U1T A;  4MEO A;  2LX9 A;  5GMK m;  3FJ5 A;  5FH8 A;  5ENB A;  2YUP A;  3FJP A;  1S72 Q;  4TU4 A;  4RTU A;  4C92 A;  3FB9 A;  3UDC A;  4J0R A;  3PFS A;  2QTX A;  4PJL A;  1PKS A;  1RAB B;  3LJW A;  2QQ9 A;  2JZ2 A;  1UHC A;  4BW1 A;  4R56 A;  1WUM A;  3BY7 A;  1EZZ B;  2P0P A;  5CGP A;  4MEP A;  1VQ6 A;  2WAC A;  1YJ9 A;  2YEM A;  2V8I A;  3JB9 F;  2GQI A;  1P92 A;  3U5P A;  2FPD A;  4ZQL A;  2KVQ G;  5I80 A;  3O5Z A;  3E9G A;  5GAN d;  1R0B G;  1XTD A;  5FB0 A;  1GFC A;  1BCM A;  4D8D A;  4DON A;  3QKJ A;  2YLB A;  4J6X A;  4C8Q B;  4C92 D;  1YIT T;  2QG9 B;  2CUB A;  4WTO B;  5A85 A;  4FYX B;  4KGZ B;  5L97 A;  4EMK C;  4E7Z A;  3VV0 A;  5DLZ A;  1D1C A;  1T0J A;  1W1F A;  2R0S A;  2E3K A;  4PLI A;  4WF2 A;  4AKI A;  4KT0 E;  1M1K C;  1K73 C;  5HQ7 A;  4M78 G;  4Y03 A;  2IG0 A;  4UYH A;  5F1L A;  2OX7 A;  4MML A;  4NRC A;  2LQN A;  4RCC A;  4QY4 A;  3IU5 A;  3BW1 A;  4TYL A;  1YI2 T;  4PFO A;  1WQW A;  4M7A D;  4PY6 A;  4Y28 E;  2CGH A;  1KC8 U;  4M75 F;  1X27 A;  4XYA A;  5CKE A;  2DAT A;  2K6D A;  2EW3 A;  3EHQ A;  3KBG A;  4XTU A;  4M7D E;  3OBY A;  1BBZ A;  3M0R A;  3OS1 A;  5FFY A;  2MWP A;  4Q0N A;  1OPK A;  2E5K A;  2ED0 A;  3EGX B;  2RHU A;  1YN8 A;  8AT1 B;  1NYG A;  3VYH B;  3U23 A;  1QVG P;  2XU8 A;  3PNW C;  4QSX A;  1U06 A;  4JRP A;  2E64 A;  2YWW A;  2K9G A;  5KH6 A;  5GAO q;  4QEW A;  2VUB A;  2F5T X;  5FE7 A;  5H85 A;  1QCF A;  3GPL A;  4UYG A;  4NXJ A;  5EPR A;  3HPW A;  1YIT A;  1VQN Q;  2FPE A;  2DZC A;  5DW2 A;  3U5M A;  1JRI A;  4CFK A;  1IZ6 A;  3G71 T;  4UYE A;  4UIZ A;  1PSE A;  3NPF A;  2EGA A;  2HDA A;  4JLG A;  1VQ5 Q;  5ACY A;  3CCE Q;  5GAN 4;  5L99 A;  2CRE A;  3JCM X;  5BT3 A;  2LNV A;  3C0C A;  5I22 A;  1YI2 A;  1GCQ C;  2OTL T;  4LZS A;  3QZS A;  2XHC A;  4KGX B;  5GAN 2;  3EG0 A;  4NYV A;  3H6Z A;  4X34 A;  5D24 A;  4C5I A;  2A0F B;  1OU9 A;  5GAN 7;  3VKH A;  2RH2 A;  3NTK A;  3THK A;  3DLL A;  2YXY A;  2DIQ A;  2AKK A;  1PC0 A;  4HCK A;  3CXC A;  2H3E B;  2PUO B;  4QNS A;  2DJZ A;  1KK7 A;  2RPN A;  4QQ6 A;  2DZ9 A;  3TQ7 P;  2ENM A;  1NJI R;  1D1A A;  1UJY A;  4LDW A;  2EBP A;  2SEM A;  2V8J A;  1N5Z A;  2NUZ A;  4BJX A;  5I89 A;  1YCS B;  2LT1 A;  3G7Z A;  2DBM A;  4BI8 B;  2LQK A;  2R57 A;  2J6F A;  4M77 G;  5HK0 A;  3HTR A;  3JCM d;  4MDX A;  3CC4 T;  2EJ9 A;  2I0N A;  3UAT A;  4CRI A;  5EQ1 A;  5LVR A;  5CUD A;  2FG0 A;  5A2Q E;  2X3W D;  3G71 A;  2QEX Q;  5HK3 A;  1BI3 A;  1RAG B;  5A5N A;  2CSI A;  4HXM A;  4C8Q E;  5DW1 A;  2J06 A;  1IXD A;  4HCZ A;  3VS0 A;  4M7A C;  3CME Q;  3RKW A;  4ZC9 A;  9ATC B;  1RAE B;  5D3R A;  1YBY A;  2YW5 A;  2JUF A;  4ZGJ B;  3QG1 A;  4M78 F;  4QYL A;  2EQM A;  4LN2 A;  1FX7 A;  1RAD B;  2KRM A;  3VS4 A;  5GMK h;  4A4E A;  4X9C A;  5DYC A;  2KYB A;  5C7N A;  1NEB A;  1YHQ A;  2HSP A;  3EGU A;  3MPU B;  2KTB B;  4TT6 A;  3MUL A;  5A81 A;  2ZPI B;  2D82 A;  4E7I A;  5FRM A;  4PFZ A;  4HBY A;  4HVV A;  4QT7 A;  2BE7 D;  1B3Q A;  2HQE A;  1N8R C;  3H41 A;  3M0Q A;  4XK8 E;  4ZGE B;  3URG A;  4MR5 A;  2K5F A;  5A0L A;  3M9Q A;  1M2O A;  4N3W A;  3QZ9 B;  4PKC C;  1XNI A;  2LJ0 A;  3CC4 A;  1WHM A;  4BHW A;  3A1P A;  1AD5 A;  1VYV A;  3G1J A;  4M7D A;  1ZBX A;  2PUK B;  2GTJ A;  4CI0 C;  1M90 C;  1NYF A;  4Z6H A;  1TWB A;  3CBM A;  4A9E A;  2OAU A;  1CSK A;  5J39 A;  2DD5 A;  2O4X A;  2PZ1 A;  4J9B A;  4PS5 A;  1WXU A;  4QUT A;  4DEY A;  1QVF S;  3LGF A;  4A9O A;  1RAA B;  3EG1 A;  5GAN h;  3RKY A;  1LOJ A;  4YYN A;  1Y0M A;  1YJ9 Q;  2DO3 A;  3PVQ A;  3OYJ A;  3OSV A;  3JB9 H;  2DEQ A;  1PCX A;  3TRE A;  5FU6 C;  2WSC E;  5FE8 A;  4NR8 A;  5CR2 A;  5HM0 A;  2LQ8 A;  5CQ5 A;  1Y96 B;  3G6E T;  5KYY B;  1AT1 B;  5GAN 3;  1WIE A;  5FFW A;  3H0H A;  4FM4 B;  5H1U A;  3L1A A;  1KD1 U;  3JCM W;  3AHU A;  3DB3 A;  1YIJ T;  5EA1 A;  1QKX A;  2RB6 A;  4O71 A;  4F7U B;  5CKF A;  3EG9 A;  3QSU A;  2FZC B;  1K0X A;  1PRM C;  2K3B A;  4M77 F;  2OJ2 A;  4ZNX A;  2D8J A;  5FH6 A;  2FEI A;  3S6W A;  4C0F A;  5KTU A;  2WSF E;  5I40 A;  1JXM A;  1V29 B;  2E7N A;  4IOR A;  2RFJ A;  2CYZ B;  2RMO A;  2H60 A;  3I5S A;  3K2J A;  1LCK A;  2KBT A;  2RHI A;  1B07 A;  2JMC A;  1CKB A;  2O9V A;  5IXB A;  2DJQ A;  2Y4X A;  5FRO A;  3A5Z B;  4KV1 A;  3EFO B;  2MIO A;  1E7O A;  4QBM A;  3RCW A;  4J83 A;  3I5R A;  5DX4 A;  5D7X A;  2ROT A;  1H3Z A;  5DYX A;  3SVH A;  4C8Q A;  3CC2 Q;  3G6E A;  1D0Z A;  4CUU A;  4KV4 A;  5IBN A;  5KE3 A;  5L98 A;  2MWO A;  1WHK A;  2C0I A;  5IGL A;  4UIX A;  5KTX A;  4CC4 B;  1M30 A;  5DLO A;  1MMN A;  1M1K U;  4KBM B;  2VKN A;  2I2L A;  4XU0 A;  5L8U A;  3CMA T;  1UFF A;  5KCH A;  5M9O A;  1E6H A;  2DIL A;  2YRV A;  5FH7 A;  4QQD A;  1AOJ A;  2RQV A;  2CS7 A;  2LTO A;  2ZPG B;  4AG1 C;  5LJ5 h;  4UIU A;  3S3O A;  2R0V A;  4J5Y A;  4E7L A;  4C8Q D;  2EKO A;  2QA4 Q;  3KUF A;  1VYT A;  1OUL A;  4GY5 A;  4Z88 A;  4M77 B;  3CPW S;  1YFN A;  5FWB A;  1LNX A;  1WXT A;  4JJB A;  5CU8 A;  1RAF B;  3QYH B;  2CZ6 B;  2K57 A;  1AWJ A;  2HZY A;  3JCM h;  4PNO A;  1OQK A;  4NYX A;  1EFN A;  4JLI A;  3GP8 A;  2ROL A;  1C0M A;  3V8L A;  5IHN A;  2OO1 A;  5I88 A;  4K11 A;  5KU3 A;  4IUQ A;  4TU6 A;  4UIY A;  4MR4 A;  3HHT B;  5I2M A;  2XG8 D;  2NUT B;  4OMP A;  5D6W A;  4QEV A;  5FU6 B;  3J81 E;  2CH4 A;  2JMA A;  3CMA A;  5FBX A;  5HJC A;  3OYM A;  2R5A A;  4FU6 A;  3UW9 A;  3SWN C;  2V1R A;  1Y7X A;  3OS0 A;  2AHJ B;  3HMF A;  3MP6 A;  3MQM A;  4YY6 A;  4HXN A;  2DEU A;  2BKD N;  5J3B A;  1XQH A;  3FC3 A;  3PMI A;  2LCC A;  4LYI A;  7AT1 B;  1ARK A;  3MEW A;  3FKM X;  5F36 A;  4PJO G;  4IOQ A;  2P0K A;  4QVZ A;  2M9U A;  3AQA A;  3EFS A;  4J1P A;  1BIA A;  4KH1 B;  4F7U E;  4LYS A;  2YUQ A;  3WVD B;  1TOV A;  2VC8 A;  3CCU A;  1YJN T;  3ME9 A;  1YHQ Q;  2VXE A;  1D0Y A;  4JRK A;  1U3O A;  3PTA A;  4PCI A;  2EFI A;  2P84 A;  4OB1 B;  5AYF A;  1QVF P;  5HQ5 A;  2FL7 A;  1OZ3 A;  1YJW T;  3ER0 A;  3UT1 A;  1K73 R;  5A0G A;  5FB1 A;  1AVZ C;  4BD3 A;  4HT9 A;  2VWF A;  2B86 A;  1Q82 C;  1KIK A;  1PKT A;  2EGC A;  2CSQ A;  2LQW A;  5GJV B;  2JN0 A;  2X9H A;  4F04 B;  2EQK A;  3CC4 Q;  5EPS A;  4X2I A;  4M7A E;  4OMO A;  4O78 A;  1HD3 A;  4O5V A;  1I5L A;  3PMT A;  4M75 D;  2EWN A;  2DNU A;  2COZ A;  4O6J A;  3DKM A;  2OUO A;  4UIT A;  4HXS A;  2L8D A;  5D3S A;  1X75 C;  1JXO A;  3C4S A;  4JJC A;  4EMK A;  1PUO A;  2OI3 A;  3A8H B;  4YAX A;  1KG1 A;  2VAS A;  3HRS A;  2D9E A;  4CUS A;  5DY7 A;  3A8O B;  2L3R A;  4XAX B;  5D7U A;  5IHI A;  1M1G A;  5ENC A;  4Q5W A;  4DOV A;  1VQ8 T;  4HXO A;  2DVJ A;  3SVG A;  3FLG A;  4L6V 5;  4JDS A;  4Z02 A;  5LJ3 h;  3TCJ A;  2X35 A;  3V8K A;  2GQV A;  2DYB A;  3NXB A;  4FSS A;  2DER A;  2M51 A;  4YAD A;  3OYH A;  2CP6 A;  3C94 A;  1BKB A;  1QW1 A;  1SG5 A;  3JCM J;  3UVY A;  5ENI A;  4M77 E;  4HXR A;  3JCM V;  1WQ7 A;  3V7R A;  3A8G B;  3CCR T;  2EYZ A;  2E4H A;  3H0F A;  5DLQ E;  4QST A;  5GAM d;  3NTH A;  3OQ5 A;  3LXJ A;  2ECZ A;  1JJ2 A;  3JSC A;  1GBQ A;  2JM8 A;  5EP7 A;  1VQM T;  3V8J A;  4XY9 A;  1M90 U;  3PT9 A;  2F2W A;  1I1J A;  1W2B P;  1Y07 A;  3D1B A;  4O77 A;  4XTY A;  1K8A U;  2X51 A;  1JO8 A;  4PK4 A;  4DA4 A;  3EAE A;  5ENE A;  2QDY B;  1FMK A;  5HQ6 A;  2CT3 A;  3SEM A;  5EWC A;  3OYL A;  1VQL T;  8ATC B;  4DBH A;  4EIK A;  4O7C A;  1QWF A;  1I81 A;  2F5K A;  5KYU B;  2DL7 A;  3NFC A;  2FO0 A;  3MET A;  4PJJ A;  2PVG B;  4XU2 A;  3SWN B;  4AMC A;  4BW2 A;  2MOX A;  5CQY A;  1VQ8 A;  3EFR A;  2MK5 A;  3ZFJ A;  3Q2E A;  4O70 A;  5FU7 B;  3LQJ A;  1GCQ A;  3DLM A;  2YT6 A;  4IUT A;  2X3X D;  4XTW A;  2QGF B;  1KD1 C;  1Y96 A;  5FWC A;  5KYY A;  1PNJ A;  4PJO F;  3OMG A;  5LVQ A;  1W70 A;  2JW4 A;  3JCM c;  3RES A;  5ENJ A;  3M55 A;  1UEB A;  4IIO A;  1WHJ A;  4BE0 A;  2DL3 A;  1UDL A;  2CP7 A;  3JB9 I;  4FW2 A;  4M75 C;  5E74 A;  4MZT A;  3VS7 A;  3VS1 A;  1RL2 A;  1JB0 E;  2RQR A;  1ZKR A;  1NLO C;  2L3S A;  2AKL A;  5KE2 A;  2NWM A;  3OA6 A;  1I0C A;  3SB2 A;  2L0A A;  1SEM A;  1WFW A;  3OB9 A;  3UVX A;  4ZW1 A;  4J3I A;  4YYI A;  4E2F B;  5KO4 A;  1VQL A;  1BI2 A;  5FE6 A;  1G5V A;  4MR6 A;  1VQO T;  3O33 A;  3M53 A;  1N8R R;  2BTT A;  1VQK T;  1UB4 A;  2CP2 A;  3VUB A;  1XOV A;  2EGE A;  4J7I A;  2F6N A;  1VIE A;  2G4A A;  4M7A A;  2YDL A;  1M9S A;  2EYQ A;  2DM1 A;  4A9H A;  3EFO A;  3UVW A;  3FEO A;  3M57 A;  3U5L A;  5F1H A;  2DXC A;  4UYF A;  2E6Z A;  4ELY C;  1G8X A;  2DK3 A;  3R6N A;  3I55 A;  2VVK A;  5GAN 5;  5CS8 A;  4J8O A;  4RTV A;  2EPD A;  3Q2F A;  2E3H A;  1LPL A;  3X20 B;  4Z1Q A;  4QQG A;  4BY6 C;  3LX7 A;  5HLS A;  2FPF A;  4N0A C;  3ZL7 C;  4A4K A;  1K9M U;  4PJO B;  4QC3 A;  1EX4 A;  5E9V A;  2LP5 A;  4AFQ C;  4QR4 A;  3OW2 A;  3CCM Q;  3O37 A;  4QR5 A;  4V2S A;  1VQP Q;  4Z6I A;  4QSU A;  1Y57 A;  1UE9 A;  2C06 A;  4LD9 K;  5D3N A;  1ZBJ A;  1OOT A;  4A9J A;  5I2S A;  4KH0 B;  1H3H A;  4BW3 A;  4OB2 B;  4A4H A;  4JPB W;  4LUE A;  2OTJ Q;  5G4R A;  4E47 A;  5GAN f;  5CIU A;  3A8M B;  3CCQ T;  4CC3 A;  1AZG B;  5GMK l;  1E6G A;  4TZ8 A;  1VQO A;  3CCL T;  4HBX A;  2G3R A;  3CCU Q;  1VQK A;  1FMW A;  5D25 A;  5GAO m;  4BAC A;  3JV3 A;  3CC7 T;  1RI0 A;  5C85 A;  5F61 A;  2FZK B;  2G6F X;  3SHW A;  2CZ0 B;  4C92 G;  3A8L B;  1H92 A;  2DTI A;  1YWP A;  1YP5 A;  2HMA A;  5DKD A;  1NPR A;  1X0J A;  2RHY A;  1ZSZ C;  2VB6 A;  5E7D A;  1X69 A;  5DYA A;  1WI7 A;  4XTV A;  1CKA A;  3PIP A;  1VIF A;  2XID A;  1KHI A;  3F70 A;  4D8K A;  5CK9 A;  1JSP B;  2NUT A;  5KYX B;  5K29 A;  4M77 D;  4QW2 A;  3HME A;  4RVR A;  3QBY A;  2Y4Y A;  3P1D A;  1Q81 C;  5F63 A;  5GMK j;  2RI5 A;  4C5G A;  1MV0 B;  4F16 A;  4M78 C;  5LJ5 d;  2IVW A;  1G83 A;  5DM7 R;  4JJD A;  5DBM A;  2QI2 A;  3L2W A;  2CDT A;  3CXC P;  4QC1 A;  5EM3 A;  4M75 B;  1VQ7 T;  2JM9 A;  5D3L A;  1UTI A;  3DAI A;  4QUU A;  4A4F A;  4DEX A;  3V7S A;  5I7X A;  4HT8 A;  5C4Q A;  3CCQ A;  1O75 A;  3G4S T;  1NPP A;  5J26 A;  3CCL A;  3D7C A;  3I56 T;  2HKN A;  5HEL A;  1PHT A;  2RJE A;  5F3A A;  3CC7 A;  3JCM P;  2DF6 A;  2KK4 A;  2I8N A;  3J7A F;  3E2U A;  5FE2 A;  3MJX A;  1X6O A;  1Q82 U;  2A36 A;  2L3Q A;  5FE1 A;  5GAM h;  4QKU A;  1ABQ A;  2LMJ A;  1KC8 R;  4GLM A;  5FDZ A;  3UVD A;  5AD3 A;  4KCX A;  2ZAE A;  2YUN A;  3CCV Q;  2MJV B;  5D3H A;  2RD1 A;  2GCX A;  3GG3 A;  4PCE A;  1N6A A;  4YY4 A;  5DY9 A;  2RQT A;  2JS0 A;  3JAM E;  3NHN A;  1G2B A;  5GAN j;  4ELZ C;  1AWW A;  2OTL A;  5GAO r;  5LKT A;  1UGP B;  5IHK A;  1G3T A;  3L2U A;  3MEU A;  4BY6 B;  4O72 A;  2XDB A;  2EQJ A;  1DJ7 B;  1HXD A;  5E3G A;  1FWZ A;  3JVK A;  1R0C B;  3BFM A;  2HQH A;  2KR3 A;  1Q86 C;  1VQ7 A;  1GCP A;  2FRY A;  2AK5 A;  2QAZ A;  1QP3 A;  1QWE A;  5GJW B;  1C1A A;  3JRZ A;  4NRB A;  3G4S A;  3JCM f;  5A83 A;  1AEY A;  4J9G A;  4J6Y A;  5EWV A;  3O36 A;  3I56 A;  5D3T A;  5DYU A;  3R6O A;  5CCA A;  2KRN A;  3CCJ T;  2ZGW A;  4R55 A;  5GAO p;  4ZGD B;  1QCN A;  4A63 B;  2VV5 A;  4X9D A;  1ZUK A;  5CQX A;  1VYU A;  5KYN A;  3QO3 A;  4OGE A;  2E5Q A;  1FMV A;  2HBW A;  4A9K A;  4M77 C;  3G0L A;  4C92 F;  2R0Y A;  5AME A;  1K8A C;  5EWW A;  1VQ4 T;  1ZSZ B;  4FL6 A;  4PLL A;  5FE5 A;  1MMG A;  3X26 B;  4J9C A;  5IT9 E;  2CP0 A;  1K4U S;  4ESR A;  5EIC A;  5CUE A;  4LXC A;  3E19 A;  1K9A A;  2L85 A;  2CKK A;  4PTB A;  1N72 A;  1IO6 A;  2DKW A;  1BI0 A;  1YWO A;  5L8R E;  1VQL Q;  4HA8 A;  5KYU A;  4FT2 A;  1VQ6 Q;  1RLQ C;  2JNG A;  2HQX A;  2HBP A;  1XJW B;  2FHD A;  5LJ1 A;  3LH0 A;  5L8T A;  3SWN A;  3SD4 A;  4M78 B;  1SSH A;  2JJ9 A;  3EHR A;  5LJ3 d;  1VQ9 T;  1Y71 A;  5HRW A;  1KFZ A;  4CC7 A;  1ZLM A;  1U8R A;  2EAY A;  5GAN 6;  5HEN A;  4RTZ A;  1PD0 A;  2DLP A;  5FE4 A;  4A4G A;  3CCJ A;  3HRU A;  3D7S B;  3I55 Q;  2D0Q B;  4M75 E;  3QZT A;  4LE9 A;  4O7A A;  5LJ5 j;  3MB3 A;  4CUT A;  1N9S A;  2DE0 X;  2EJG A;  2R5M A;  3LYI A;  2MF2 A;  5CKH A;  1GRI A;  3X25 B;  2DRK A;  4QSQ A;  2GFU A;  3HRT A;  2RNW A;  3IU6 A;  2BZ8 A;  4DQ2 A;  3CD6 T;  2LJ3 A;  2C0T A;  4KUI A;  4XY8 A;  5IGK A;  5CUG A;  2F1L A;  3EG2 A;  4A9L A;  1VQ4 A;  4NYW A;  1SRM A;  1ZA2 B;  2GFA A;  2AT1 B;  2RI2 A;  4EDU A;  5E9M A;  2BUD A;  2QXF A;  3HP9 A;  1S72 T;  1WGS A;  2O9S A;  5LJ2 A;  2QYZ A;  1OX9 A;  3MB4 A;  4M7D G;  3S3N A;  3VU3 C;  1AZE A;  2Y90 A;  2YRD A;  3REA B;  1Q7Y U;  2KXD A;  4ME7 A;  2AZS A;  3VRY A;  2YYN A;  5LJ3 f;  4FIB A;  1MMA A;  4BE1 A;  1WXB A;  2RHX A;  2RNY A;  3C95 A;  4RKU E;  5EGU A;  2NUP B;  1JJ2 S;  3VS6 A;  5E3D A;  2FZG B;  2OAW A;  4DBQ A;  1VQ9 A;  2DRM A;  1EQF A;  4NL2 A;  4WHU A;  1YIT Q;  5BT4 A;  2LRQ A;  1W2B S;  2VXF A;  2DVR A;  4E7S A;  4C0D B;  5FLX E;  1YIJ A;  2KEA A;  3L2R A;  1ABO A;  3RKX A;  2NYS A;  2E1H A;  2K4Y A;  2M0O A;  1K9M C;  5BT5 A;  4YTL A;  3M56 A;  1NLP C;  1QP2 A;  2JTM A;  5CQA A;  1O9S A;  3CD6 A;  4YBM A;  1YI2 Q;  3INZ A;  1UGS B;  3RMQ A;  1WNL A;  1RAH B;  3P1E A;  4HVW A;  1M3C A;  1UHF A;  1SKU B;  4FYW B;  4NR5 A;  1X2K A;  4IKF A;  3EGX A;  1BCO A;  5CO7 A;  3VJP A;  3X28 B;  4N4G A;  2AIR B;  2HCK A;  2KT1 A;  2KNB B;  1M3A A;  4YYH A;  1KD1 R;  3M0T A;  3QWX X;  2EQI A;  4GBQ A;  3EH2 A;  2EYW A;  5KTW A;  1TH7 A;  2L89 A;  4PJO D;  5E9L A;  4BW4 A;  5KHM A;  1GXI E;  2BE9 B;  1R77 A;  4RG8 A;  5CUA A;  4LYW A;  2E70 A;  5CPE A;  1YCY A;  1Z9Q A;  1UEC A;  4BI4 A;  1QLY A;  3JCM Q;  5LJ0 A;  4D6W A;  4MR3 A;  2N9G A;  2EJF A;  1VQN T;  4LR6 A;  3WXM B;  3G71 Q;  1WHH A;  3EG3 A;  5CZG A;  4EPC A;  2XK0 A;  3ERR A;  1WPY A;  4NR4 A;  3BDU A;  4M78 E;  4JJN K;  4O75 A;  5HY6 A;  4IUV A;  2DA9 A;  3PVL A;  3O8V A;  1LJO A;  1ZHI A;  2K5I A;  1VQ5 T;  1Q81 U;  3L42 A;  3CCE T;  4EMH A;  5FU7 C;  1OI1 A;  1WDX A;  4C8Q G;  2OTL Q;  5LJ3 j;  2VGN A;  4C0Z A;  4MEN A;  3JB9 D;  1K0S A;  2MI6 A;  5CRM A;  5H1V A;  1M3B A;  4OGI A;  1PWT A;  4MDW A;  1I8F A;  3VS3 A;  5GMK e;  3HSB A;  3NGP A;  3KXT A;  5F62 A;  3UV5 A;  1X43 A;  2DIG A;  5IID A;  2YUO A;  4KUL A;  4M75 A;  3QPH A;  4OUF A;  4GPJ A;  3UA6 A;  2KAF A;  4TT4 A;  1M1K R;  1BIB A;  2KGT A;  3M54 A;  3G4S Q;  1MNE A;  2PTK A;  4Z89 A;  2M0Y A;  5DFC A;  4LC2 A;  4M4Z A;  4VUB A;  4NUD A;  5FG5 A;  5CKB A;  4M7D F;  1PM3 A;  4J9E A;  4TS8 A;  4YK0 A;  5FFV A;  1KSW A;  1PSF A;  4PL6 A;  4FSX A;  4Z8A A;  2J6O A;  1KQS A;  4Z93 A;  3M0P A;  4YBT A;  1VQN A;  4YYG A;  5CUC A;  2QDL A;  3RMS A;  2RI7 A;  1I07 A;  4Y91 A;  2DKG A;  3L2Z A;  4ZN1 A;  1VA7 A;  5HFR A;  4RTT A;  5EVA A;  2QEX T;  1RAC B;  5LL6 S;  3SVF A;  1JM4 B;  5HKC A;  3SDZ A;  5CTL A;  2DVS A;  2X4J A;  3CQT A;  1IHW A;  1I5O B;  3EH1 A;  4J9F A;  3CCS T;  3CCE A;  4CUP A;  3CME T;  2D6F A;  2AZV A;  4XUB A;  5GAN e;  1WJQ A;  2VGM A;  2RI3 A;  5E0R A;  5D0C A;  3P1F A;  1SHG A;  4LZR A;  4E6R A;  1G3W A;  4ZTJ A;  5EIS A;  4N0A A;  4IUP A;  4C5E A;  1Q86 U;  2ED1 A;  2LZ6 B;  1YJN A;  5IXF A;  2D0N A;  4OGJ A;  3KFV A;  5CFW A;  2EIF A;  4EMG A;  4NRA A;  1X6B A;  4YAB A;  4PJO C;  4TZ2 A;  3RNJ A;  2PU9 B;  1X01 A;  1WHG A;  4NUC A;  1YJW A;  3L2Q A;  4F14 A;  1F1B B;  2PVO B;  1B34 B;  5ETD A;  2DL4 A;  3H0I A;  1V1C A;  4BDY A;  4J6W A;  3GIB A;  4UYD A;  4QVD A;  1JJ2 P;  2M02 A;  1TS9 A;  2CH4 W;  4IR4 A;  5GMK i;  4CLB A;  4BI3 A;  1OEB A;  3CXC S;  3JVL A;  1UG1 A;  4OB3 B;  4NOY A;  3ASK A;  5LKZ A;  1U1S A;  3V7C A;  3RR6 A;  1ZSZ A;  2JS2 A;  2ZZD A;  2DXU A;  3OYC A;  1LVK A;  3U5N A;  4XTZ A;  3CCS A;  4FYV B;  4UIW A;  1R8O B;  3CME A;  4FLP A;  4ALH A;  3VKG A;  4AKH A;  5I21 A;  3GLX A;  2J6K A;  4NR7 A;  2BIV A;  2EYY A;  2FSA A;  5HFQ A;  5DFB A;  3ONI A;  3GOX A;  3RER A;  3G0J A;  4BB7 A;  2EVR A;  3RDV A;  2DPP B;  5HEM A;  4C8Q F;  4M78 A;  5CRZ A;  1YJ9 T;  5IH2 A;  4UC4 A;  2QQS A;  3HL8 A;  2HL3 A;  3RIR A;  4NR9 A;  2GRC A;  4C67 A;  5D6X A;  3G6E Q;  1G3Y A;  1N27 A;  2D1X A;  2RK2 A;  4OP0 A;  6AT1 B;  3HKS A;  5GAM f;  4JRQ A;  3M0S A;  2YEL A;  1SPK A;  1YIJ Q;  2KY9 A;  3CCR A;  4NQN A;  4HBV A;  4WHW A;  1ZQ1 A;  4OMF B;  3OMC A;  3I3J A;  2HL5 C;  3BE3 A;  5A5O A;  3LWH A;  2RO0 A;  3HMH A;  4E7H A;  4N4F A;  1VQM A;  3BDL A;  4NL3 A;  4F7U A; 
#chains in the Genus database with same CATH homology
 3CPW A;  2XDP A;  2GF7 A;  4M78 D;  3OYG A;  4XU3 A;  1BYM A;  3OYN A;  2XD0 A;  5LKU A;  2X4W A;  4TT2 A;  1NZ9 A;  5C89 A;  2E12 A;  4O74 A;  3OYY A;  3LWI A;  1Q7Y C;  4LZ2 A;  3H8Z A;  3QJ6 A;  3AAD A;  5LKX A;  3O34 A;  4L59 A;  3TEE A;  5L96 A;  1M8V A;  4OGC A;  3JCM e;  4QVC A;  4A9M A;  2LCL A;  2D9T A;  4QZS A;  3E9F A;  2K5L A;  4HBW A;  2WP1 A;  2ZPB B;  5A5Q A;  5IN1 A;  5E9Y A;  2HAX A;  5F60 A;  3CC2 T;  2DVQ A;  3FRN A;  3Q1J A;  5E9K A;  4O7F A;  2QQR A;  5AD2 A;  3MEV A;  3QDR B;  1NJI U;  2E65 A;  5JWM A;  2DVE A;  3ZBD A;  1M4Z A;  1JBM A;  3OYD A;  2RJF A;  2E6N A;  3VUZ A;  4JS5 A;  4RMO A;  4JUV A;  5JI8 A;  5A82 A;  4HXL A;  2QA4 T;  5AMF A;  4M77 A;  5CVI A;  5FRN A;  2RA2 A;  4QSV A;  5GAM j;  3CBP A;  2JOY A;  4F7U G;  1D3B B;  3MEA A;  5II2 A;  1N9R A;  1QVG A;  4WIV A;  5GAN g;  5D3P A;  1IRE B;  3UWN A;  4QSS A;  5EPB A;  5F5Z A;  4IOO A;  4ALG A;  3OYA A;  2F69 A;  1WUG A;  1ZS5 A;  3CC2 A;  4OVA A;  4YYK A;  5LUU A;  5FG4 A;  2LC4 A;  3QII A;  4C66 A;  1WJS A;  4M7A G;  4CUQ A;  5COI A;  2O01 E;  3QZV A;  3VYG A;  2I7K A;  2A3L A;  1MGQ A;  1KQ2 A;  4QB3 A;  2DXB A;  4DOW A;  4CUR A;  2PQW A;  4JRI A;  4YH3 A;  2KDS A;  5LJ3 e;  3MHX A;  2H3J A;  2QA4 A;  2P4T A;  4HKE A;  1UGR B;  5FG6 A;  2JVV A;  5I83 A;  3DWY A;  1YHQ T;  1QVP A;  5D3J A;  2KMT A;  2DWW A;  3LW5 E;  2DD4 A;  3JB9 J;  4QSP A;  2L5Q A;  5II1 A;  2R10 A;  4C92 C;  4F3I A;  3S92 A;  3GNG A;  5GAO l;  4YYJ A;  3OYF A;  5LJ5 f;  5G4S A;  3O35 A;  4TTE A;  2F6J A;  3P5O A;  1HK9 A;  2K3X A;  3OBW A;  5CUB A;  5DKH A;  2EQU A;  5EWH A;  4BDZ A;  4C0D C;  4EMK B;  4PJO E;  2FB7 A;  2QQA A;  5C0M A;  4MMK A;  2OSS A;  2DTO A;  4A9F A;  5LJ5 g;  5CKD A;  3JVJ A;  1F68 A;  2JTF A;  4O76 A;  2X4Y A;  4XQ3 A;  2ZPF B;  4LDV A;  2R58 A;  2DXT A;  5H1T A;  3X24 B;  2CZ7 B;  1I4K 1;  3M4Y A;  4ZN3 A;  5I7Y A;  2X4X A;  5D26 A;  4QYD A;  4YYM A;  1B34 A;  4IR3 A;  1OZ2 A;  2RM4 A;  4YAT A;  4LDX A;  5J0D A;  3S3M A;  3JCM g;  2WP2 A;  4F7U F;  3OYE A;  4RCB A;  3OS2 A;  5HRX A;  3OYB A;  4LDF A;  4A9N A;  2B8A A;  5GAN 8;  1SSF A;  3JVM A;  3VKI A;  1UGQ B;  3P8B B;  3P8H A;  3N5B B;  2P0Q A;  4M7A F;  3T9N A;  1M1F A;  1KQS S;  4A54 A;  2QQB A;  4NS5 A;  4M7D D;  4Q0O A;  2DVV A;  1M5Q 1;  2DAQ A;  4LDY A;  3M58 A;  2LT4 A;  2CZ1 B;  3OSS C;  4RG2 A;  4JS4 A;  3UV4 A;  3CEY A;  5TB6 A;  5DLX A;  1NE8 A;  5DKC A;  5A7C A;  5EI4 A;  3L2V A;  4C92 B;  3ZYU A;  4N4I A;  3FDR A;  5CQT A;  2FVU A;  5EWD A;  3NTI A;  3JCM b;  5EU1 A;  2WSE E;  3J80 E;  4NQM A;  4TVR A;  5IGM A;  5C6S A;  5CY9 A;  1FXX A;  4M7A B;  5I86 A;  5DFD A;  5FE9 A;  2VYT A;  5CQ4 A;  5C87 A;  3ZEH A;  3LQI A;  3MXF A;  3OS5 A;  4UYF B;  5LJ3 g;  5A5P A;  4O7B A;  3SFM A;  2RJD A;  4YYD A;  1NJI C;  3E1S A;  4J0S A;  4PJO A;  5CP5 A;  1WJR A;  2ZPE B;  2YDW A;  1K73 U;  5IAY A;  4BUG A;  4XU1 A;  3CCM T;  1S72 A;  2RS9 B;  3DB4 A;  3OYK A;  4MZP A;  5HCL A;  5ETB A;  1VQP T;  1KC8 C;  2LSP B;  5TCM A;  4Z1S A;  5KCO A;  3M4G A;  4C0G A;  2K2V A;  2NXB A;  4P5N A;  3M5A A;  4CFL A;  4PKL A;  2OTJ T;  3U5J A;  4M7D C;  3QUI A;  3CCU T;  4E7J A;  1D3B A;  3GNF B;  5GAM e;  3C12 A;  5ENF A;  2RNX A;  3UPU A;  2XIC A;  4A9I A;  4C5H A;  5E9I A;  4OB0 B;  4II1 A;  1EIF A;  3UV2 A;  2YLC A;  5FE3 A;  3QHS A;  5CQ6 A;  2MMP A;  1G3S A;  4GLK A;  4YBS A;  4AKN A;  5I29 A;  4IR6 A;  2K3Y A;  4IUR A;  3OYI A;  2YEK A;  5EK9 A;  2RO1 A;  4QSR A;  5EG2 A;  3CCM A;  4ATO A;  5A0D A;  1BI1 A;  1VQP A;  5A5S A;  2XDD A;  4LD6 A;  4FT4 A;  5IGN A;  2ZCF B;  4ZTF A;  2DTH A;  2OTJ A;  4TQN A;  3CBO A;  3QYG B;  4HXP A;  2E10 A;  2E7O A;  4IUU A;  4C92 E;  3OW2 S;  3MP8 A;  2ZPH B;  1H64 1;  3M59 A;  4MEQ A;  3U5O A;  2HD0 A;  4HXK A;  4QR3 A;  3GF5 A;  1QVF A;  3S91 A;  4NR6 A;  3PIO A;  3CCV T;  5F2P A;  1VQ5 A;  3RUX A;  4KUD K;  2LDM A;  4A53 A;  5ENH A;  5CAI A;  1OYX A;  4LDU A;  5A5R A;  5CQ8 A;  2A7Y A;  1W4S A;  3JB9 G;  4HCC A;  3QJY A;  2FYK A;  2E41 A;  4CL9 A;  4NUE A;  1E6I A;  1QVG S;  1KQ1 A;  3QXE B;  4C8Q C;  2MAM A;  3FIF A;  2M1H A;  3QZ5 B;  5E73 A;  5CQ3 A;  2XKO C;  4XUA A;  4QEU A;  5F25 A;  2PVD B;  5IG6 A;  5FE0 A;  4O7E A;  3MUK A;  4E96 A;  4J7F A;  4B9X A;  2RK1 A;  1N8R U;  3HFN A;  4M75 G;  3LGL A;  4M7D B;  4B9W A;  4OF1 A;  2V8K A;  2QEX A;  1KHC A;  3MO8 A;  3CCV A;  2YQD A;  4L5G A;  4IR5 A;  2RJC A;  3LQH A;  3P1C A;  4UIV A;  2LVM A;  3MP1 A;  4N4H A;  5CQ7 A;  2O4X B;  1W2B A;  3TLP A;  2XI9 A;  3U5K A;  2RHZ A;  4MZM A;  4BE2 A;  3TU4 K;  3LLR A;  3MCA B;  4XTX A;  1VQ6 T;  3CPF A;  1AHJ B;  4QSW A;  2NLU A;  2KSS A;  4E7K A;  4HCB A;  5EV9 A;  4YC9 A;  5D6Y A;  5ENG A;  1VUB A;  3HFO A;  2L5E A;  2KQW A;  2L84 A;  3PGG A;  5I1Q A;  3I55 T;  2YHT A;  5LJ5 e;  3OY9 A;  5GAO n;  2HNI A;  5C8G A;  3P8D A;  4YH4 A;  3WVE B;  2M16 A;  4LRG A;  1MHN A;  5GAM g;  5HRV A;  1U1T A;  4MEO A;  2LX9 A;  5GMK m;  5FH8 A;  5ENB A;  3FJP A;  4TU4 A;  4C92 A;  3FB9 A;  3UDC A;  4J0R A;  3PFS A;  2QTX A;  3LJW A;  2QQ9 A;  2JZ2 A;  4BW1 A;  4R56 A;  1WUM A;  3BY7 A;  2P0P A;  5CGP A;  4MEP A;  1VQ6 A;  2WAC A;  1YJ9 A;  2YEM A;  2V8I A;  3JB9 F;  1P92 A;  3U5P A;  4ZQL A;  2KVQ G;  5I80 A;  5GAN d;  3E9G A;  1XTD A;  5FB0 A;  4DON A;  3QKJ A;  2YLB A;  4J6X A;  4C8Q B;  4C92 D;  1YIT T;  5A85 A;  5L97 A;  4EMK C;  3VV0 A;  5DLZ A;  2R0S A;  2E3K A;  4PLI A;  4WF2 A;  4KT0 E;  1M1K C;  1K73 C;  5HQ7 A;  4M78 G;  4Y03 A;  2IG0 A;  4UYH A;  5F1L A;  4MML A;  4NRC A;  4RCC A;  4QY4 A;  3IU5 A;  3BW1 A;  4TYL A;  1YI2 T;  1WQW A;  4M7A D;  4PY6 A;  4Y28 E;  2CGH A;  1KC8 U;  4M75 F;  4XYA A;  5CKE A;  2DAT A;  4XTU A;  3KBG A;  4M7D E;  3OBY A;  3OS1 A;  5FFY A;  2MWP A;  4Q0N A;  2RHU A;  3VYH B;  2XU8 A;  3PNW C;  4QSX A;  4JRP A;  2E64 A;  5KH6 A;  5GAO q;  4QEW A;  2VUB A;  2F5T X;  5FE7 A;  5H85 A;  3GPL A;  4UYG A;  4NXJ A;  5EPR A;  3HPW A;  1YIT A;  2DZC A;  5DW2 A;  3U5M A;  1JRI A;  4CFK A;  1IZ6 A;  3G71 T;  4UYE A;  4UIZ A;  1PSE A;  4JLG A;  5ACY A;  5GAN 4;  5L99 A;  3JCM X;  5BT3 A;  2LNV A;  1YI2 A;  2OTL T;  4LZS A;  3QZS A;  2XHC A;  5GAN 2;  4NYV A;  3H6Z A;  4X34 A;  5D24 A;  4C5I A;  5GAN 7;  2RH2 A;  3NTK A;  3DLL A;  2DIQ A;  3CXC A;  2PUO B;  4QNS A;  2DJZ A;  4QQ6 A;  2DZ9 A;  4LDW A;  2V8J A;  4BJX A;  5I89 A;  2LT1 A;  3G7Z A;  4BI8 B;  2LQK A;  2R57 A;  4M77 G;  5HK0 A;  3JCM d;  4MDX A;  3CC4 T;  2EJ9 A;  4CRI A;  5EQ1 A;  5LVR A;  5CUD A;  5A2Q E;  3G71 A;  5HK3 A;  1BI3 A;  5A5N A;  4HXM A;  4C8Q E;  5DW1 A;  4HCZ A;  4M7A C;  3RKW A;  4ZC9 A;  5D3R A;  1YBY A;  2YW5 A;  2JUF A;  4ZGJ B;  3QG1 A;  4M78 F;  4QYL A;  2EQM A;  1FX7 A;  5GMK h;  4A4E A;  4X9C A;  5DYC A;  5C7N A;  1YHQ A;  2ZPI B;  2KTB B;  4TT6 A;  3MUL A;  5A81 A;  2D82 A;  4E7I A;  5FRM A;  4HBY A;  2HQE A;  1N8R C;  4XK8 E;  4ZGE B;  3URG A;  4MR5 A;  2K5F A;  5A0L A;  3M9Q A;  3QZ9 B;  4N3W A;  4PKC C;  1XNI A;  3CC4 A;  4BHW A;  4M7D A;  1ZBX A;  2PUK B;  4CI0 C;  1M90 C;  4Z6H A;  3CBM A;  4A9E A;  2OAU A;  5J39 A;  2DD5 A;  2O4X A;  4PS5 A;  4QUT A;  1QVF S;  3LGF A;  4A9O A;  5GAN h;  3RKY A;  1LOJ A;  4YYN A;  2DO3 A;  3OYJ A;  3OSV A;  3JB9 H;  2DEQ A;  3TRE A;  5FU6 C;  2WSC E;  5FE8 A;  4NR8 A;  5CR2 A;  5HM0 A;  2LQ8 A;  5CQ5 A;  1Y96 B;  3G6E T;  5GAN 3;  5FFW A;  4FM4 B;  5H1U A;  3L1A A;  1KD1 U;  3JCM W;  3AHU A;  3DB3 A;  1YIJ T;  5EA1 A;  2RB6 A;  4O71 A;  4F7U B;  5CKF A;  3QSU A;  4M77 F;  5FH6 A;  3S6W A;  4C0F A;  5KTU A;  2WSF E;  5I40 A;  1V29 B;  2E7N A;  4IOR A;  2RFJ A;  2CYZ B;  2H60 A;  3K2J A;  2RHI A;  2Y4X A;  5FRO A;  3A5Z B;  4KV1 A;  4QBM A;  3RCW A;  4J83 A;  5DX4 A;  5D7X A;  1H3Z A;  5DYX A;  3SVH A;  4C8Q A;  3G6E A;  4CUU A;  4KV4 A;  5IBN A;  5KE3 A;  5L98 A;  2MWO A;  5IGL A;  4UIX A;  5KTX A;  5DLO A;  1M1K U;  4KBM B;  2I2L A;  4XU0 A;  5L8U A;  3CMA T;  5KCH A;  5M9O A;  2YRV A;  5FH7 A;  4QQD A;  2CS7 A;  2LTO A;  2ZPG B;  5LJ5 h;  4UIU A;  3S3O A;  2R0V A;  4J5Y A;  4E7L A;  4C8Q D;  2EKO A;  3KUF A;  4GY5 A;  4M77 B;  3CPW S;  1LNX A;  5CU8 A;  3QYH B;  2CZ6 B;  2K57 A;  3JCM h;  4PNO A;  4NYX A;  4JLI A;  3GP8 A;  3V8L A;  2OO1 A;  5I88 A;  5KU3 A;  4IUQ A;  4TU6 A;  4UIY A;  4MR4 A;  3HHT B;  5I2M A;  2XG8 D;  5D6W A;  4QEV A;  5FU6 B;  3J81 E;  3CMA A;  5FBX A;  5HJC A;  3OYM A;  2R5A A;  4FU6 A;  3UW9 A;  3SWN C;  1Y7X A;  3OS0 A;  2AHJ B;  3HMF A;  3MP6 A;  3MQM A;  4YY6 A;  4HXN A;  5J3B A;  2BKD N;  1XQH A;  3FC3 A;  3PMI A;  2LCC A;  4LYI A;  3MEW A;  3FKM X;  5F36 A;  4PJO G;  4IOQ A;  2P0K A;  4QVZ A;  2M9U A;  3AQA A;  3EFS A;  4J1P A;  1BIA A;  4F7U E;  4LYS A;  3WVD B;  3CCU A;  2VC8 A;  1YJN T;  3ME9 A;  2VXE A;  4JRK A;  3PTA A;  4PCI A;  2EFI A;  4OB1 B;  5AYF A;  5HQ5 A;  2FL7 A;  1OZ3 A;  1YJW T;  3ER0 A;  3UT1 A;  5A0G A;  5FB1 A;  4BD3 A;  4HT9 A;  1Q82 C;  2JN0 A;  2EQK A;  5EPS A;  4X2I A;  4M7A E;  4O78 A;  4O5V A;  1I5L A;  3PMT A;  4M75 D;  2EWN A;  4O6J A;  3DKM A;  2OUO A;  4UIT A;  4HXS A;  2L8D A;  5D3S A;  1X75 C;  4EMK A;  3C4S A;  3A8H B;  4YAX A;  1KG1 A;  3HRS A;  2D9E A;  4CUS A;  5DY7 A;  3A8O B;  2L3R A;  4XAX B;  1M1G A;  5ENC A;  4Q5W A;  4DOV A;  1VQ8 T;  4HXO A;  3SVG A;  3FLG A;  4L6V 5;  4JDS A;  4Z02 A;  5LJ3 h;  3TCJ A;  2X35 A;  3V8K A;  2GQV A;  3NXB A;  4YAD A;  3OYH A;  3C94 A;  1BKB A;  1QW1 A;  3JCM J;  3UVY A;  5ENI A;  4M77 E;  4HXR A;  3JCM V;  1WQ7 A;  3V7R A;  3A8G B;  3CCR T;  5DLQ E;  4QST A;  5GAM d;  3NTH A;  3OQ5 A;  3LXJ A;  1JJ2 A;  3JSC A;  5EP7 A;  1VQM T;  3V8J A;  4XY9 A;  1M90 U;  3PT9 A;  1Y07 A;  4O77 A;  4XTY A;  1K8A U;  4DA4 A;  3EAE A;  5ENE A;  2QDY B;  5HQ6 A;  5EWC A;  3OYL A;  1VQL T;  4O7C A;  1I81 A;  2F5K A;  3NFC A;  3MET A;  2PVG B;  4XU2 A;  3SWN B;  4BW2 A;  5CQY A;  1VQ8 A;  3EFR A;  3ZFJ A;  3Q2E A;  4O70 A;  5FU7 B;  3LQJ A;  3DLM A;  4IUT A;  4XTW A;  1KD1 C;  1Y96 A;  4PJO F;  3OMG A;  5LVQ A;  3JCM c;  3RES A;  5ENJ A;  3M55 A;  1UEB A;  4BE0 A;  3JB9 I;  4M75 C;  5E74 A;  4MZT A;  1RL2 A;  1JB0 E;  5KE2 A;  3OA6 A;  3SB2 A;  3OB9 A;  3UVX A;  4ZW1 A;  4J3I A;  4YYI A;  1VQL A;  5KO4 A;  1BI2 A;  5FE6 A;  1G5V A;  4MR6 A;  1VQO T;  3O33 A;  3M53 A;  1VQK T;  1UB4 A;  3VUB A;  1XOV A;  4J7I A;  2F6N A;  1VIE A;  2G4A A;  4M7A A;  1M9S A;  2EYQ A;  4A9H A;  3UVW A;  3FEO A;  3M57 A;  3U5L A;  5F1H A;  2DXC A;  4UYF A;  2E6Z A;  4ELY C;  2DK3 A;  3I55 A;  5GAN 5;  5CS8 A;  4J8O A;  3Q2F A;  3X20 B;  4Z1Q A;  4QQG A;  4BY6 C;  3LX7 A;  5HLS A;  4N0A C;  4A4K A;  1K9M U;  4PJO B;  4QC3 A;  5E9V A;  4QR4 A;  3OW2 A;  3O37 A;  4QR5 A;  4V2S A;  4Z6I A;  4QSU A;  2C06 A;  4LD9 K;  5D3N A;  4A9J A;  5I2S A;  4BW3 A;  4OB2 B;  4A4H A;  5G4R A;  4E47 A;  5GAN f;  5CIU A;  3A8M B;  3CCQ T;  5GMK l;  4TZ8 A;  1VQO A;  3CCL T;  4HBX A;  2G3R A;  1VQK A;  5D25 A;  5GAO m;  4BAC A;  3CC7 T;  1RI0 A;  5C85 A;  5F61 A;  2CZ0 B;  4C92 G;  3A8L B;  2DTI A;  5DKD A;  1NPR A;  1X0J A;  2RHY A;  5E7D A;  5DYA A;  4XTV A;  3PIP A;  1VIF A;  2XID A;  1KHI A;  3F70 A;  5CK9 A;  1JSP B;  5K29 A;  4M77 D;  4QW2 A;  3HME A;  4RVR A;  3QBY A;  2Y4Y A;  3P1D A;  1Q81 C;  5F63 A;  5GMK j;  2RI5 A;  4C5G A;  4M78 C;  5LJ5 d;  2IVW A;  5DM7 R;  5DBM A;  2QI2 A;  3L2W A;  4QC1 A;  5EM3 A;  4M75 B;  1VQ7 T;  5D3L A;  3DAI A;  4QUU A;  4A4F A;  4HT8 A;  3V7S A;  5I7X A;  5C4Q A;  3CCQ A;  1O75 A;  3G4S T;  1NPP A;  5J26 A;  3CCL A;  3D7C A;  3I56 T;  5HEL A;  2RJE A;  5F3A A;  3CC7 A;  3JCM P;  2KK4 A;  2I8N A;  3J7A F;  5FE2 A;  1X6O A;  1Q82 U;  5GAM h;  5FE1 A;  5FDZ A;  3UVD A;  5AD3 A;  4KCX A;  2MJV B;  5D3H A;  2RD1 A;  2GCX A;  3GG3 A;  4PCE A;  1N6A A;  4YY4 A;  5DY9 A;  3JAM E;  5GAN j;  4ELZ C;  2OTL A;  5GAO r;  5LKT A;  1UGP B;  1G3T A;  3L2U A;  3MEU A;  4BY6 B;  4O72 A;  2XDB A;  2EQJ A;  1DJ7 B;  1HXD A;  5E3G A;  1FWZ A;  3JVK A;  3BFM A;  1Q86 C;  1VQ7 A;  1QP3 A;  3JRZ A;  4NRB A;  3G4S A;  3JCM f;  5A83 A;  4J6Y A;  5EWV A;  3O36 A;  3I56 A;  5D3T A;  5DYU A;  3R6O A;  5CCA A;  3CCJ T;  2ZGW A;  4R55 A;  5GAO p;  4ZGD B;  2VV5 A;  4X9D A;  5CQX A;  3QO3 A;  4OGE A;  2E5Q A;  4A9K A;  4M77 C;  3G0L A;  4C92 F;  2R0Y A;  5AME A;  1K8A C;  5EWW A;  1VQ4 T;  4FL6 A;  4PLL A;  5FE5 A;  3X26 B;  5IT9 E;  5EIC A;  5CUE A;  3E19 A;  2L85 A;  2CKK A;  4PTB A;  1N72 A;  2DKW A;  1BI0 A;  5L8R E;  4HA8 A;  4FT2 A;  2JNG A;  2HQX A;  2HBP A;  2FHD A;  5LJ1 A;  3LH0 A;  5L8T A;  3SWN A;  3SD4 A;  4M78 B;  5LJ3 d;  1VQ9 T;  1Y71 A;  5HRW A;  1U8R A;  2EAY A;  5GAN 6;  5HEN A;  5FE4 A;  4A4G A;  3CCJ A;  3HRU A;  2D0Q B;  4M75 E;  3QZT A;  4O7A A;  5LJ5 j;  3MB3 A;  4CUT A;  1N9S A;  2EJG A;  2R5M A;  3LYI A;  2MF2 A;  5CKH A;  3X25 B;  4QSQ A;  2GFU A;  3HRT A;  2RNW A;  3IU6 A;  4DQ2 A;  3CD6 T;  4KUI A;  4XY8 A;  5IGK A;  5CUG A;  4A9L A;  1VQ4 A;  4NYW A;  2GFA A;  2RI2 A;  4EDU A;  5E9M A;  2BUD A;  2QXF A;  3HP9 A;  1S72 T;  1WGS A;  5LJ2 A;  3MB4 A;  4M7D G;  3S3N A;  3VU3 C;  2Y90 A;  1Q7Y U;  4ME7 A;  2YYN A;  5LJ3 f;  4FIB A;  4BE1 A;  2RHX A;  2RNY A;  3C95 A;  4RKU E;  5EGU A;  1JJ2 S;  5E3D A;  1VQ9 A;  1EQF A;  4NL2 A;  4WHU A;  5BT4 A;  2LRQ A;  1W2B S;  2VXF A;  2DVR A;  4C0D B;  5FLX E;  1YIJ A;  3L2R A;  3RKX A;  2E1H A;  2K4Y A;  2M0O A;  1K9M C;  5BT5 A;  4YTL A;  3M56 A;  1QP2 A;  2JTM A;  5CQA A;  1O9S A;  3CD6 A;  4YBM A;  3INZ A;  1UGS B;  3RMQ A;  1WNL A;  3P1E A;  4NR5 A;  4IKF A;  5CO7 A;  3VJP A;  3X28 B;  4N4G A;  4YYH A;  5KTW A;  1TH7 A;  2L89 A;  4PJO D;  5E9L A;  4BW4 A;  5KHM A;  1GXI E;  4RG8 A;  5CUA A;  4LYW A;  5CPE A;  1YCY A;  2E70 A;  4BI4 A;  3JCM Q;  5LJ0 A;  4D6W A;  4MR3 A;  2N9G A;  2EJF A;  1VQN T;  4LR6 A;  3WXM B;  5CZG A;  4EPC A;  2XK0 A;  1WPY A;  4NR4 A;  3BDU A;  4M78 E;  4JJN K;  4O75 A;  5HY6 A;  4IUV A;  3O8V A;  1LJO A;  1ZHI A;  2K5I A;  1VQ5 T;  1Q81 U;  3L42 A;  3CCE T;  4EMH A;  5FU7 C;  1OI1 A;  4C8Q G;  5LJ3 j;  2VGN A;  4C0Z A;  4MEN A;  3JB9 D;  2MI6 A;  5CRM A;  5H1V A;  4OGI A;  4MDW A;  1I8F A;  5GMK e;  3HSB A;  3KXT A;  5F62 A;  3UV5 A;  2DIG A;  5IID A;  4KUL A;  4M75 A;  3QPH A;  4OUF A;  4GPJ A;  2KAF A;  4TT4 A;  1BIB A;  3M54 A;  5DFC A;  4LC2 A;  4VUB A;  4NUD A;  5FG5 A;  5CKB A;  4M7D F;  4TS8 A;  4YK0 A;  5FFV A;  1PSF A;  4PL6 A;  4FSX A;  1KQS A;  4Z93 A;  4YBT A;  1VQN A;  4YYG A;  5CUC A;  3RMS A;  2RI7 A;  4Y91 A;  2DKG A;  3L2Z A;  4ZN1 A;  5HFR A;  5EVA A;  2QEX T;  5LL6 S;  5HKC A;  3SVF A;  1JM4 B;  3SDZ A;  5CTL A;  2DVS A;  2X4J A;  3CCS T;  3CCE A;  4CUP A;  3CME T;  2D6F A;  4XUB A;  5GAN e;  1WJQ A;  2VGM A;  2RI3 A;  5E0R A;  5D0C A;  3P1F A;  4ZTJ A;  4LZR A;  1G3W A;  5EIS A;  4N0A A;  4IUP A;  4C5E A;  1Q86 U;  1YJN A;  4OGJ A;  5CFW A;  2EIF A;  4EMG A;  4NRA A;  4YAB A;  4PJO C;  4TZ2 A;  2PU9 B;  1X01 A;  1YJW A;  4NUC A;  3L2Q A;  2PVO B;  1B34 B;  5ETD A;  4BDY A;  4J6W A;  3GIB A;  4UYD A;  4QVD A;  4IR4 A;  5GMK i;  4CLB A;  4BI3 A;  3CXC S;  3JVL A;  4OB3 B;  4NOY A;  3ASK A;  5LKZ A;  1U1S A;  3V7C A;  2ZZD A;  2DXU A;  3OYC A;  3U5N A;  4XTZ A;  3CCS A;  4UIW A;  1R8O B;  3CME A;  4FLP A;  4ALH A;  5I21 A;  3GLX A;  4NR7 A;  2BIV A;  2FSA A;  5HFQ A;  5DFB A;  3ONI A;  3GOX A;  3RER A;  3G0J A;  4BB7 A;  2DPP B;  5HEM A;  4C8Q F;  4M78 A;  5CRZ A;  1YJ9 T;  4UC4 A;  2QQS A;  3HL8 A;  3RIR A;  4NR9 A;  2GRC A;  4C67 A;  5D6X A;  1G3Y A;  1N27 A;  2RK2 A;  4OP0 A;  3HKS A;  5GAM f;  4JRQ A;  2YEL A;  2KY9 A;  3CCR A;  4NQN A;  4HBV A;  4WHW A;  1ZQ1 A;  4OMF B;  3OMC A;  3I3J A;  5A5O A;  3LWH A;  2RO0 A;  3HMH A;  4E7H A;  4N4F A;  1VQM A;  3BDL A;  4NL3 A;  4F7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...