4N4GA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
209
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
total genus 63
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4gA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4gA02
4QSQA 4QR3A 4Z02A 5ENFA 1WUGA 3TLPA 2WACA 5DLXA 3H8ZA 3QBYA 2L5EA 4O7EA 2N9GA 5KCHA 4QBMA 5E9MA 4B9WA 1N27A 3UVDA 4A9FA 5EICA 5IAYA 2MWPA 5IGLA 2FHDA 2VYTA 5FE0A 3SVGA 3UT1A 5AD3A 4YYKA 3O8VA 5IIDA 3LQIA 5I83A 3G0LA 5FE1A 1MHNA 4AKNA 2D9EA 3MB4A 5J39A 2M0OA 4WHUA 5A83A 5K29A 3MP8A 4QC3A 5KCOA 3OS0A 4J0SA 4TT6A 4N4IA 4J1PA 5C87A 4O71A 2CKKA 3MQMA 5HM0A 4BDYA 3P5OA 3P1FA 4Z93A 4LDFA 2L8DA 3UW9A 5HFQA 4HXRA 4C5GA 4A4FA 5F63A 5LJ2A 4WIVA 2G4AA 4O76A 3JVMA 2WP1A 4A9LA 4QQGA 3OB9A 4NQMA 2R10A 3SVHA 2HQXA 2DVQA 4YATA 4N4GA 4UYFB 4QQ6A 3L2RA 3U5OA 4NR6A 4A9JA 4QSUA 4II1A 3O34A 4YBMA 5CQ8A 5KTXA 4BD3A 4MR5A 4BJXA 2RS9B 4UYFA 2HQEA 2LCCA 4UC4A 5HCLA 5FRNA 1KHCA 5LVRA 5F62A 2BKDN 4LYWA 4QSWA 2RO0A 3C4SA 4FLPA 5CUAA 5D0CA 3QZSA 2RI7A 4YBTA 3Q1JA 5DLZA 3S92A 4QC1A 4TQNA 5D24A 5FRMA 3NXBA 3PMTA 5E9LA 2EFIA 4PLIA 2DATA 3UVYA 4IUUA 4FL6A 4NR4A 5D25A 3QZVA 2X4YA 5ENCA 4YY6A 2EKOA 5II2A 3ASKA 4PY6A 4UIWA 3OS2A 4BW2A 2OSSA 5FE5A 5ENJA 4IUVA 4E7LA 3LH0A 1WUMA 3OYCA 4RG2A 5DFBA 1WJRA 4EDUA 2GRCA 5G4SA 5FG6A 4NRCA 5A5NA 5D3TA 5CUBA 3K2JA 4BE2A 4ZC9A 4Q5WA 3F70A 5HRXA 4NQNA 4GPJA 4YBSA 4QNSA 5EM3A 4CURA 4XYAA 4BW1A 4CLBA 5CRZA 3JVLA 4HXNA 2DVRA 2DIGA 5KTUA 4YYHA 3RCWA 4O70A 2DAQA 5D3JA 2YRVA 3HMFA 5G4RA 3ONIA 5KH6A 4UYHA 4XY8A 4C5HA 5E9YA 4ALHA 5LVQA 2E6NA 4NYVA 3OYIA 5FB0A 3MXFA 2EQMA 2E5QA 2L3RA 3U5KA 3QJ6A 5M9OA 4YK0A 5I40A 5IGNA 3MUKA 5I7XA 5HEMA 2RJCA 3D7CA 3QKJA 4BDZA 5CQ5A 3P1DA 3UWNA 2F6JA 1E6IA 4XUAA 3UVWA 3S3NA 3OYKA 4YABA 2RHXA 2YYNA 2OO1A 4TU6A 5KE2A 5JI8A 5CTLA 4NUEA 4QR4A 5DKDA 2H60A 2YDWA 5EWWA 4NXJA 5EU1A 4OUFA 2WP2A 5IBNA 4KV4A 4CUQA 3OQ5A 5CUEA 3LX7A 5BT5A 4E7HA 3FEOA 4ZW1A 5D6WA 4YYNA 5H1TA 5A5PA 4BW4A 4PKLA 5KE3A 5LKXA 5ETDA 5I89A 3OYLA 5LKTA 5KO4A 4E7JA 2QQRA 4IUPA 4QSTA 5CPEA 4UIZA 5IN1A 4A9KA 2L85A 4OVAA 4O75A 5L97A 5FE6A 5HLSA 5D3SA 3OYFA 2YEMA 4YYMA 3JVJA 3LGFA 2O4XA 3S6WA 3OYNA 5DBMA 3OYBA 3OMCA 2F5KA 5HQ7A 5E3GA 2X35A 5AMEA 5L8UA 5IGMA 3E9FA 3MULA 5FE3A 5F60A 3AADA 4A9IA 3MP1A 3OYEA 5EP7A 2NXBA 3DB4A 4TT2A 2RFJA 4A9HA 3H6ZA 5EWVA 4PCEA 5FH7A 4NYXA 4QSXA 5FFYA 3OYDA 4TS8A 5HELA 5D3NA 5FE9A 5LJ1A 4HCZA 5DFCA 4LZRA 4LZSA 4QYLA 5IG6A 2EQJA 4BW3A 5E9VA 2PQWA 3OA6A 2EQUA 5D3PA 4QSSA 5F5ZA 3KUFA 3P1EA 5CY9A 5J26A 1WJSA 4PTBA 4CUTA 2F6NA 3GG3A 4TZ8A 3FC3A 5I7YA 2X4WA 5C4QA 4A4EA 5CZGA 5CP5A 4QY4A 5DFDA 4NUCA 4HXOA 4QSRA 4ZTFA 1X0JA 5EK9A 2D9TA 4L59A 5I86A 4X34A 2DVVA 3P8HA 5EPSA 5FDZA 4NRAA 5C7NA 4IORA 4HXPA 4YAXA 4O78A 2BIVA 5EPBA 3LQHA 3OY9A 3LQJA 3Q2EA 2E7NA 4CFKA 5FE8A 4QQDA 3OYHA 4YY4A 1JM4B 4TTEA 4PS5A 3MEAA 2R0YA 5LUUA 5A5QA 4YYJA 4HBYA 4NR9A 3S3OA 3U5MA 1WGSA 4J0RA 5HJCA 5JWMA 5H85A 2K3YA 4QB3A 3ME9A 4O7BA 1EQFA 3HMHA 4UYDA 3LYIA 5EVAA 4Q0OA 5CQAA 4BHWA 5LKUA 5ACYA 4CUSA 5F2PA 2R5MA 4XUBA 4CUUA 1H3ZA 2DKWA 1N72A 1F68A 5CUGA 5IGKA 2IG0A 2XK0A 5F3AA 5CQ4A 4UYGA 3U5LA 2YELA 5I88A 4UIVA 4TT4A 4UYEA 2LSPB 5KU3A 3MP6A 4BE1A 3JVKA 5E9KA 2RI2A 4QEWA 5A85A 3UV4A 4IR6A 5I29A 5AD2A 4MEPA 4RVRA 5C89A 5CIUA 5DKHA 4A9EA 5L99A 5E7DA 5LJ0A 4NR5A 5EGUA 5L98A 4J3IA 4A9NA 4QW2A 3E9GA 4CFLA 5ETBA 3UV5A 2B8AA 2RI5A 2LDMA 5E3DA 3NTKA 5DX4A 4QUTA 2DWWA 4TZ2A 1OZ2A 3BDLA 2E7OA 2EQKA 4MENA 4MEOA 4O7AA 1WJQA 4MR3A 4YYIA 2RJDA 5C0MA 5F1LA 3QIIA 5DY7A 2LVMA 1JSPB 3META 5FBXA 2YQDA 4IR3A 5A81A 5FE2A 3O35A 2JTFA 4O74A 3O37A 5H1VA 2P0KA 5A5OA 4FU6A 5E0RA 3O33A 4MR4A 5EPRA 1XNIA 5ENBA 4KV1A 5FE4A 3S3MA 3DAIA 2RNYA 3OYAA 3S91A 2MJVB 3LJWA 5KHMA 4Y03A 4YH4A 4ZQLA 5CQ7A 1G5VA 5D3HA 3MB3A 4Z6IA 5DW1A 5CS8A 2R57A 4IOOA 4LR6A 1OZ3A 4LZ2A 5E74A 4CL9A 3L2WA 5D3RA 3MO8A 3MEWA 5A5SA 5ENEA 5HFRA 2R0SA 5L96A 5F1HA 2M1HA 3PFSA 5DYUA 2R58A 4YADA 5FG4A 4A9MA 4KCXA 4QEVA 3LXJA 4UIYA 3MEUA 5C8GA 3LGLA 4IUQA 4YYGA 4N4FA 5CUDA 3P8DA 5EISA 2YEKA 5ENGA 5DKCA 4CRIA 2RNXA 3FLGA 5FB1A 4QYDA 5DW2A 3U5PA 4OGJA 2LRQA 2RHYA 3GOXA 5EV9A 5AMFA 4OGIA 1RI0A 2RI3A 5BT4A 4YYDA 4C5IA 4E96A 2K3XA 4N4HA 3CEYA 3UVXA 4N3WA 4NUDA 4GY5A 4X2IA 5BT3A 2YW5A 4NS5A 5CQ3A 4YH3A 2X4XA 4MR6A 2DIQA 3OYMA 2QQSA 5ENHA 3UV2A 5CUCA 2NLUA 4UITA 5CU8A 5CGPA 3NTIA 3ZYUA 4O7FA 4E7KA 4Q0NA 4IR4A 5D3LA 4O72A 4LD6A 5C85A 4QSVA 5D7XA 5L8TA 2R5AA 3FKMX 4QR5A 4XY9A 4UIXA 5E73A 1OI1A 1ZS5A 5F36A 4O7CA 2L89A 2R0VA 3U5JA 3EAEA 3LLRA 3OMGA 4NYWA 5HRVA 2KTBB 3DLMA 3IU6A 4IR5A 1OYXA 5C6SA 4MEQA 3AQAA 3HMEA 4QEUA 5KTWA 3OYGA 5EWCA 3Q2FA 4TU4A 5FG5A 4IKFA 3P1CA 2GFUA 5FH8A 5A7CA 3ZEHA 4PCIA 2FSAA 4NR7A 2JZ2A 2RJFA 4DONA 3NTHA 4BACA 4QVZA 4HXSA 4NRBA 4ZTJA 4QSPA 4A9OA 3PNWC 3QZTA 3SD4A 4O77A 3I3JA 3L42A 2M16A 5DYAA 2RNWA 4HBVA 2GF7A 4C5EA 4NR8A 3IU5A 5D6YA 4C66A 5I1QA 4IUTA 4UIUA 4Z1QA 4E7IA 5FFVA 4ALGA 5D6XA 2RHUA 5EQ1A 5E9IA 3OS1A 2L84A 5CRMA 5FROA 3G0JA 5EWHA 5FFWA 5CFWA 5A5RA 3FDRA 5CQTA 4QZSA 4PLLA 5CQ6A 2GFAA 2RO1A 2RHIA 3SVFA 4CUPA 3L2VA 4IURA 4PL6A 2DVSA 2LTOA 5I80A 4A4HA 2OUOA 4HBWA 5H1UA 3L2QA 3PMIA 5HRWA 2RJEA 2XDPA 4Z6HA 5EWDA 5A82A 5FH6A 4HBXA 4YC9A 5DYCA 3U5NA 2BUDA 2G3RA 3MEVA 3DWYA 4QUUA 5HENA 4A4GA 5J0DA 4IOQA 1SSFA 2D82A 4LYIA 5II1A 2O4XB 5ENIA 5EA1A 5EI4A 4F3IA 4Z1SA 5LKZA 5DYXA 5TCMA 4B9XA 5F61A 2I8NA 4LYSA 4C67A 5F25A 4HXLA 3M9QA 4HXMA 3L2UA 4LC2A 5HQ5A 4LRGA 5D26A 2RHZA 5TB6A 5FE7A 3DB3A 2MWOA 3OYJA 4WHWA 5COIA 5HQ6A 2E3KA 3O36A 4TYLA 4HXKA 4BE0A 2I7KA
chains in the Genus database with same CATH superfamily
3UPUA 3CCVT 4QR3A 2VB6A 2WACA 3H8ZA 3G6EQ 2PTKA 5KCHA 4QBMA 2OTLT 5EICA 5GAN2 1HYOA 4PJMA 1ZUKA 5AT1B 3HSBA 3X26B 2VYTA 3SVGA 1YJWQ 4YYKA 4WF2A 1TUDA 3G0LA 4XU3A 1VQMA 1YHQT 2LT1A 1CKAA 2LP5A 2D9EA 2M0OA 3ZBDA 5K29A 1CKBA 1XQHA 3CCRT 3OS0A 3RESA 4N4IA 3N5BB 1YJ9A 5KYNA 4ZN3A 2JTMA 4Z88A 1V1CA 3HTRA 1KG1A 1IO6A 5F63A 1T0JA 4O76A 2LJ0A 4A9LA 4AKHA 1BIBA 2NUPA 2CUDA 2DLPA 3OB9A 5CKEA 4NQMA 2R10A 1X27A 3U5OA 1EX4A 1QP3A 2DVJA 4QSUA 4OB2B 3O34A 4YBMA 4MR5A 1H92A 4UC4A 1H3HA 5FRNA 3M53A 3HP9A 4JJDA 4LYWA 2F5TX 4QSWA 4D8KA 1PG5B 3C4SA 4DEXA 3D7SB 3QZSA 2O9VA 4YBTA 3S92A 5CO7A 5E9LA 1UEBA 4IUUA 1Q7YU 2X4YA 2EKOA 2YT6A 4AMCA 2DX1A 1W6XA 5ENJA 2OX7A 2M02A 4IUVA 4E7LA 2FEIA 3VS6A 1WUMA 2EJNA 1UGQB 1OPLA 3P8BB 5FG6A 4NRCA 2KAFA 4BE2A 4XQ3A 1VQ6T 2PNIA 4FT4A 1Q82U 1GXIE 5HRXA 3I55Q 4YBSA 2AHJB 3GBQA 3J80E 4CURA 4XYAA 5HKCA 4YYHA 3RCWA 1TSFA 1KQSA 2JUFA 3HMFA 3ONIA 4XY8A 2HL3A 2FRWA 2M0YA 3CCMT 2E6NA 4NYVA 1K9MC 3MXFA 1RAIB 2E5QA 3E19A 5GANh 5M9OA 4WCIA 5CKDA 2XMFA 2KSSA 5I7XA 1QCOA 2NYSA 2V8IA 4E7SA 2J6FA 1NJIC 4C0GA 2RH2A 4BDZA 5CQ5A 3UWNA 1E6IA 4RCCA 1WHLA 4M77B 3CMAQ 5FU7C 2O9SA 2JW4A 2OO1A 1U8RA 4TU6A 2FPEA 4EPCA 5DKDA 1I81A 2ROTA 3LH5A 4DBHA 4FCYA 1LCKA 2JN0A 2WP2A 2C0OA 4KV4A 3RERA 3PTAA 1VQ7A 3FEOA 5L8RE 3KXTA 1VQ6Q 5H1TA 3H0HA 4PKLA 2FZKB 3G6ET 3OYLA 5I89A 1M2OA 2JVVA 1WLPB 1GBQA 2CGHA 2KXCA 1M2VA 3OW2S 4OMPA 3I55A 4O75A 2ZPIB 5LJ5g 1KJWA 3OYBA 1R0BG 5HQ7A 2BZ8A 3I9QA 4LNPA 4GLMA 5GAMj 4PJLA 1BKBA 4J6WA 1WFWA 3M56A 5IH2A 2NXBA 3ZL7C 4TT2A 3G7ZA 3I55T 2CYZB 1YJ9Q 1D1CA 2CP7A 2KYBA 1B34B 2LQKA 1Q82R 3OYDA 3CCUA 5HELA 4M77G 4RKUE 3GP8A 1WQWA 3LWHA 5DFCA 2DD4A 2K5IA 4LZRA 3EH2A 1M9SA 2E41A 1OPKA 1RACB 4ZGEB 2EQUA 2OTLA 1K0XA 4QSSA 5F5ZA 3JCMb 5J26A 3URGA 3EHQA 3FC3A 5HY6A 5CZGA 4QY4A 4XTXA 3M58A 5DFDA 4NUCA 4HXOA 4PJOB 3CC4Q 1X0JA 5EK9A 1TUGB 4L59A 4XAXB 3UA6A 4ME7A 3V7CA 2DVVA 4RG8A 5FDZA 3EFSA 1Q86R 5C7NA 4O78A 2BIVA 3JV3A 3LQJA 5GAMg 2E7NA 4CFKA 5FE8A 2GQVA 2J6KA 5GAOm 1MMNA 4YY4A 3O5ZA 1VQ9Q 5FWCA 4OB3B 2RK2A 2K4YA 4YYJA 4HBYA 1Y71A 3S3OA 3U5MA 4E2FB 1KK7A 2CUBA 1AZEA 5JWMA 2K3YA 2DXCA 4QB3A 4EMKB 1EQFA 3HMHA 1S1NA 4M77F 5ACYA 2E6ZA 5KYUB 1MGQA 3M0UA 1N72A 6AT1B 5CUGA 2CP3A 4M7DA 2DEQA 4UYGA 2YELA 2DO3A 3VS4A 3CCST 3MP6A 4BE1A 3EG9B 4AFZC 2RI2A 4OGCA 1YITT 5A85A 2GNCA 2A37A 4RTXA 4RVRA 2RQVA 5DKHA 4O6JA 4ESRA 5L98A 3CC4T 4J3IA 1QQJA 5HCKA 3UV5A 2PZ1A 3JCMe 1BI1A 4F7UE 3CMEA 4QUTA 4EMHA 2HNIA 4TZ2A 3BDLA 2EQKA 1C0MA 4MENA 1UHCA 1UHFA 3FJPA 5C0MA 5DLQE 3CCSA 2DBKA 3AHUA 3NHNA 3JCMV 1JSPB 2YQDA 3FB9A 5L23A 3O35A 5H1VA 2L5QA 4M75F 4LUEA 3L1AA 2DL3A 5FE4A 3S3MA 3OYAA 3EGUA 3S91A 1W2BS 1N8RC 5KHMA 4GBQA 4ZQLA 2EJGA 5CQ7A 1NPPA 5D3HA 3MB3A 5DW1A 1VQNA 2R57A 5GANj 2DFUA 3JCMW 4LZ2A 4CL9A 3L2WA 1J3TA 5D3RA 2GGRA 2W0ZA 3G4SQ 1C1AA 1LOJA 3QG1A 3MEWA 8ATCB 3M59A 5A5SA 5ENEA 2CP5A 2LT4A 2MOXA 1UDLA 4PJOG 5FG4A 4KCXA 3LXJA 4UIYA 3CCLQ 1RAGB 2XKOC 5C8GA 4IUQA 1UGPB 2LJ1A 5DKCA 1P92A 3V7RA 4M77E 3U5PA 2LRQA 2YXYA 3VS3A 1UG1A 3GOXA 1PUOA 5GAMd 4AT1B 2K7AA 5GAMe 4E7ZA 4C8QC 4NUDA 2CSQA 4X2IA 2KK4A 1Q7YC 2DJZA 3OYMA 1ZSZC 1M90C 5CUCA 5CU8A 5CGPA 3NTIA 4E7KA 4Q0NA 1QCNA 3A8OB 5D7XA 2X3XD 5L8TA 5GMKj 2HDAA 4XY9A 2VV5A 2BZXA 1ZS5A 2O2OA 1JBMA 1IGQA 4J6YA 1K8AC 2EWNA 3A98A 4DOVA 5C6SA 4MEQA 4QEUA 4TU4A 2FPDA 4ZN1A 3P1CA 1AWXA 1W2BP 1YCSB 2JZ2A 1VQNQ 1JRIA 2KE9A 4A9OA 3QZTA 4O77A 3I5SA 3L42A 3SWNA 4LE9A 2M16A 1Q81C 2QGGA 2RNWA 1VQOQ 2JNGA 2MCNA 4C66A 3CXCS 2FL7A 4Z1QA 4E7IA 4ALGA 1ARKA 3M0TA 2RHUA 5EQ1A 1G3SA 4M7AG 2L84A 1NEBA 3G0JA 5FFWA 2V8JA 5CFWA 4QZSA 2DK3A 1MMAA 2XHCA 3HHTB 3KBGA 2NWMA 4PL6A 5I80A 1D1AA 1SPKA 5H1UA 3PMIA 1TH7A 5FLXE 4Z6HA 5EWDA 5A82A 4HBXA 1UFFA 4A4KA 4HVWA 2COZA 1FMKA 3RMQA 1SEMA 2D82A 4J9BA 5LJ5h 1NG2A 5EA1A 4M78C 4BUGA 2E3HA 3SFMA 5TCMA 4BI4A 3JAME 4XU1A 5DM7R 4LC2A 2D1XA 4LRGA 3CCLT 4C92D 4RMOA 4R0KA 2DMOA 2MWOA 5COIA 1NPRA 5HQ6A 1K73U 1I8FA 3CBPA 4TYLA 4AG2C 1BB9A 3Q1JA 1W4SA 2K3BA 5IHIA 4VUBA 3KFVA 5A0GA 1NBEB 3TLPA 2A28A 2L5EA 2N9GA 3AT1B 2LCSA 3CC2T 3QYHB 1VYTA 1K4US 4Y91A 4A9FA 1X43A 5IGLA 2XG8D 4KUIA 2O88A 1N9RA 1WHHA 1VQOA 5AD3A 2QQAA 3O8VA 5IIDA 1MNDA 2AKKA 2QEXQ 2EPDA 5FE1A 5J39A 1FMVA 3A8GB 1Q81R 1IXDA 3MP8A 4QC3A 4TT6A 2EJ9A 2JJ9A 3PT9A 2DYBA 2DXTA 5CKHA 2CKKA 1K73R 1M4ZA 3MPUB 2AZSA 3MHXA 4AFSC 1K9MR 1RLPC 4DBQA 4A4FA 4J9FA 2G4AA 2WP1A 1M2VB 2CT4A 3H0IA 4YATA 4N4GA 4UYFB 2YUQA 4QQ6A 3L2RA 3CCJQ 4II1A 1JB0E 5KTXA 1IGUA 1VQLQ 2RS9B 4UYFA 2LCCA 3CCQA 1H641 1KHCA 1BYMA 1JQQA 2RO0A 4FLPA 5CUAA 5D0CA 4E47A 3H0FA 5DLZA 2EFIA 2E3IA 3EGXA 1W70A 3T9NA 3UVYA 1EZZB 4FL6A 4PNOA 4PKCC 2OJ2A 3M54A 7AT1B 5D25A 1T3LA 3QZVA 4Y28E 3G71Q 5ENCA 1SF9A 3M0RA 5II2A 3ASKA 4PY6A 4PJOF 3OS2A 3CC4A 1PWTA 4BW2A 2OSSA 5FE5A 4RCBA 3D1BA 3OYCA 1UGSB 2KYMA 4EDUA 2GTOA 5G4SA 5D3TA 3A8MB 1JJ2S 3CCQT 4ZC9A 1JU5C 2A0FB 3F70A 4Q5WA 4A54A 5GMKi 3X20B 1ABOA 4J9HA 1VQPT 5CRZA 1QKXA 2DVRA 5KTUA 5GAMf 4M7AE 2DPPB 2QTVA 3MKDA 1OQKA 1E6HA 2L3RA 2EQMA 3U5KA 2QGFB 4JZ4A 5GJWB 3QO3A 1WNLA 3CD6T 2K57A 1SRLA 3MUKA 3UDCA 2ATCB 3P1DA 1ZA1B 1VQOT 2FYKA 2ESWA 2DVEA 3OYKA 4M7AA 2KRNA 2EGAA 5KE2A 1M8MA 1VIFA 4QR4A 1R0CB 4V2SA 1YN8A 2YDWA 1OX9A 5EWWA 1TTHB 4AI6A 1QW1A 1PKTA 5BT5A 3GNGA 2ED0A 2JMCA 4ZW1A 4DBRA 2OTJQ 5CQYA 5A5PA 5KE3A 2LQ8A 1VQLA 1K8AR 5LKXA 4J9GA 1VQMT 4E7JA 4IIOA 2OAWA 2CSIA 3M5AA 3HKSA 1G2BA 4IUPA 5IN1A 2QEXA 2P84A 2L85A 5HLSA 2AIRB 3LGFA 5GANe 3S6WA 1IHWA 3OYNA 1UB4A 2PUOB 1B3QA 2X35A 4J8OA 5L8UA 2AKLA 3E9FA 2P4RA 5F60A 4CC4B 2KEAA 1D3BA 2XDDA 2PVDB 3OYEA 2PVOB 4LDWA 1M3BA 3EH1A 5EWVA 5FH7A 4L6V5 3VKIA 1KQSS 1PD1A 4HXJA 1KQSP 3CCET 1M30A 5IHKA 2VWFA 3FIFA 5IG6A 2V1QA 2J06A 2JS0A 3OA6A 4OMFB 1PD0A 2GTJA 3TU4K 4L5GA 2HAXA 1VQ5A 3KUFA 5CY9A 2L2PA 3QPHA 1GFDA 4PTBA 2P0PA 3QXEB 2F6NA 3LWIA 2RK1A 5C4QA 2ZPBB 4HA8A 5IT9E 4X9DA 3TSWA 3JCMd 4QSRA 2L3SA 2CZ7B 4ZTFA 4HT9A 5A2QE 1YFNA 5GJVB 5I86A 4ZGJB 2LX9A 4KH0B 4HCCA 3BFMA 4NOYA 1G3WA 2G6FX 4M7AC 3CCJT 5EPBA 5CKBA 1AWWA 1D3BB 1YJWT 2KGTA 5LUUA 2RD1A 5A5QA 1YWOA 4M77D 4J0RA 4MMLA 3CCMA 3TREA 2DILA 1GCPA 5LJ5d 5H85A 4O7BA 1I5OB 4UYDA 2QYZA 4Q0OA 4BHWA 2R5MA 4ELZC 1H3ZA 1Q81U 5CKFA 4KULA 1VUBA 2MYSA 1N5ZA 2CH4A 5CQ4A 3U5LA 4D6WA 4EIKA 4UIVA 2XIDA 3I56A 4UYEA 2LSPB 1TOVA 5DY9A 2LNHB 4M75G 1M3AA 2RQUA 4JRKA 5I29A 4J7FA 4MEPA 1ZHIA 5GAOn 3TEEA 5L99A 1M3CA 4DBFA 5E7DA 3BW1A 3ZFJA 3E9GA 3QWXX 2L3PA 4CFLA 5ETBA 2ED1A 2C0TA 4M7AF 1Y7XA 1OOTA 1WA7A 3SEMA 5HK0A 3PGGA 2DWWA 3M0QA 1OZ2A 4J9EA 2E7OA 1KHIA 2VVKA 1M90U 4PJOC 4A63B 2RJDA 5DY7A 1X2QA 2E10A 4M75D 2V8KA 5KYXA 4JUVA 4AG1C 3M4YA 4KT0E 2WSCE 1NLPC 2X4JA 1G3TA 2JTFA 4FYYB 4Y92A 4O74A 4YTLA 4JJNK 3V7SA 5E0RA 4MR4A 5EPRA 4MZTA 1QVGP 4MMKA 4KV1A 2RNYA 4KH1B 4RTVA 1VQNT 3EGXB 4QT7A 2MJVB 5KYUA 3FJ5A 1HJDA 4Z6IA 4DEYA 1WHMA 2ROLA 5E74A 1PRMC 1WPYA 1AWJA 4MDWA 1WHGA 1X6OA 3BDUA 2Y90A 5HFRA 1VQPA 5L96A 5F1HA 4J6XA 1SKUB 3PFSA 2FG0A 3HL8A 4A9MA 3C94A 2EGEA 3VKHA 4OMLA 3VRZA 3LGLA 4YYGA 1ZUUA 2MPXC 3CMAA 5ENGA 3HRUA 1QVFP 2RNXA 2Z0WA 4D8DA 4C92F 5FB1A 3CCVA 2DL7A 4QYDA 4OGJA 3ULRB 3D1DA 1QVPA 1I1JA 2RI3A 4JJCA 2K3XA 2RQRA 3JCMJ 3UVXA 1YCYA 2DZ9A 4N3WA 2YW5A 4FYWB 4RTWA 4MR6A 4ELYC 1S72T 2QQSA 1WHJA 4O5VA 2NLUA 4UITA 1SHGA 3R6NA 4B6MA 2CREA 3ZYUA 2EKHA 1MV0B 3OW2P 3MCAB 1G83A 2YUNA 1PRLC 3PVLA 4LD6A 3FKMX 2XU8A 5A0LA 1X01A 2KQWA 3U5JA 4ATOA 4DA4A 2KTBB 1SSHA 2DJQA 3CCUQ 1TU0B 4HCBA 3IU6A 2QXFA 2JS2A 2KI7A 2JMAA 2EYXA 2GFUA 3ZEHA 2ZPEB 2RJFA 4DONA 4BACA 1RAAB 2QAZA 2W10A 4RTTA 4PFZA 3QDFA 1MUZA 1T3SA 4EMGA 2VXEA 3U23A 5DYAA 2VGNA 3HFNA 2K5LA 3SWNC 3VS0A 1VQPQ 1KQ2A 4UIUA 2A08A 2DF6A 4KGZB 3OSSC 3OS1A 1Q82C 9ATCB 5AYFA 4XTYA 5FROA 1Q7YR 5A5RA 2BE9B 2RHIA 1B34A 4CUPA 2F2WA 3QUIA 2KVQG 4IURA 2DXUA 1M5Q1 3QSUA 4A4HA 3CBMA 1B07A 2IIMA 2OUOA 2YWWA 4M75E 1S72Q 2K5FA 4C0FA 2QA4T 4C0ZA 2QDLA 3EHRA 3M0SA 4YC9A 4KRTA 2G3RA 3PIPA 1JO8A 2IPOB 4IOQA 1SSFA 1N6AA 4M75A 4Z8AA 4LYIA 1VQ5Q 5ENIA 2WSFE 4OMOA 4F3IA 5LKZA 2XI9A 3CC2Q 5F61A 4LYSA 4HXLA 2DKGA 4C0DC 1KC8C 1YHQA 5TB6A 3RIRA 1U3OA 2RM4A 5FE7A 3OYJA 8AT1B 3JCMh 1NYFA 2EVRA 1JJ2A 1EIFA 2E64A 4BE0A 2I7KA 4M7AD 1N8RU 1ZBJA 5ENFA 1WUGA 3QBYA 1WIEA 2M9UA 3H41A 1UTIA 4B9WA 1N27A 4XTZA 3RDVA 2FHDA 3EG2A 5FE0A 4QVDA 3UT1A 1AOJA 1X6BA 5I83A 5GMKh 2AT1B 1MHNA 1LPLA 5KYXB 1QVFA 3MB4A 2PU9B 5A83A 5EC7A 1D1BA 5GANf 5C87A 4O71A 1WQ7A 3MQMA 5HM0A 4BDYA 3P5OA 1QWEA 4C92B 1RAFB 3UW9A 2LCLA 3M0PA 4HXRA 3G4ST 4C5GA 3CXCA 4WIVA 3WVEB 2E5KA 3CMEQ 2CZ6B 3CCEQ 1WZOA 1VQKT 3V8KA 2DVQA 1GFCA 4R56A 5CQ8A 4BD3A 4BJXA 2CDTA 4M75B 2J7IA 2HQEA 1VQ4T 5HCLA 2HBWA 4FYVB 4J9DA 2JM9A 3CCEA 5LVRA 5F62A 3BE3A 4LDUA 5CQXA 2RI7A 4TQNA 5D24A 1M90R 3NXBA 1I07A 5GANd 4PLIA 1ZBXA 3A1PA 3G4SA 2IVWA 2YRCA 4YY6A 2BTTA 4UIWA 3JB9H 1SRMA 2VUBA 4OMNA 2ZAEA 4JLGA 3LH0A 3PE0A 2E70A 4RG2A 1WJRA 4J7IA 4X1VA 2D0QB 3V8JA 5CUBA 1RL2A 5CAIA 3QJYA 2LQWA 1TUCA 1VQ9A 1GCQA 2EAYA 4C92E 1IHVA 4HVUA 4BW1A 4HKEA 3JVLA 4M7DF 4KBMB 2RN8A 4O70A 5D3JA 5G4RA 5KH6A 3A8HB 5FU7B 5E9YA 2PVGB 3TQ7P 2MAMA 3OYIA 2L0AA 1QVGS 3QJ6A 4YK0A 1TWBA 1ZQ1A 1VQ9T 4BI3A 1QCFA 5IGNA 5HEMA 2KDSA 1M8VA 1HK9A 2RJCA 1OEBA 3D7CA 3QKJA 2F6JA 4M7DB 2BE7D 3EGDB 2WSEE 3I56T 2DRKA 1UJ0A 2P0QA 2YUPA 3LW5E 1QVGA 5JI8A 2D8HA 2GQIA 2QASA 1S72A 2MIOA 1WHKA 1K9AA 4AKGA 2LX7A 1BCMA 2O31A 5IBNA 4LD9K 1R8OB 4C8QG 5CUEA 1YHQQ 4YYNA 4BW4A 3HFOA 1X69A 1YBYA 4ANJA 1IB8A 5LKTA 2A36A 1H8KA 1RABB 4QSTA 1U5SA 3JB9D 5GAN8 4UIZA 2HBPA 1VQ4A 1VQKA 4AFQC 1T0HA 4M77A 2DRMA 5FE6A 1ZX6A 5D3SA 3OYFA 4YYMA 2O4XA 1O9SA 5CR2A 1NJIU 2PUKB 3RBBB 1KFZA 1MV3A 5DBMA 4QKUA 1XJWB 2F5KA 4MZPA 2NUPB 5IGMA 3OS5A 4P5NA 1UUEA 2GCXA 1YIJT 4FYXB 2KR3A 5IHNA 4A9IA 1PKSA 1TS9A 3MP1A 5EP7A 4E6RA 3OW2A 3DB4A 1K0SA 5LJ3e 5FFYA 3RKWA 2KBTA 4JRQA 4TS8A 4C92C 5FE9A 2KT8A 3CMAT 4PJOA 4QYLA 3WXMB 2QA4Q 2EQJA 1K76A 1MMDA 5E9VA 2PQWA 5D3PA 3EFRA 5GAN6 2DNUA 1WJSA 3HRTA 1VQ5T 4CUTA 4TZ8A 5CP5A 2NUTA 3VV0A 5KYWA 1ZUYA 2KMTA 2VC8A 5GMKm 2D9TA 1Y07A 1SHFA 1OU9A 3RUXA 1A0NB 5EPSA 2ZPGB 2QQ9A 4IORA 3ER0A 1IREB 4YAXA 2EQIA 3LQHA 1BBZA 2YLCA 3Q2EA 3CC7A 3OYHA 3I56Q 1JM4B 2C06A 1KIKA 4TTEA 4PS5A 1G8XA 4J5YA 5LJ3j 3CC2A 1PSEA 3JB9I 4QVCA 3OBWA 1WGSA 1ZSGA 5HJCA 1YWPA 2HCKA 5IXFA 1K1ZA 3VYHB 2OTJA 3MJXA 5CQAA 5LKUA 4OF1A 1YJ9T 2DKWA 1F68A 1X6GA 2J05A 2KT1A 3JCMg 1OX8A 2F2XA 2IG0A 2XK0A 5F3AA 1Y57A 5I88A 2XICA 1BI0A 1V76A 2RA2A 4M77C 3GF5A 1IRXA 3L2ZA 2FB7A 1WXBA 1FMWA 3VUBA 5E9KA 4FM4B 3GNFB 5J3BA 1DJ7B 4QEWA 4DQ2A 3UV4A 3NPFA 4XTWA 5HK3A 5AD2A 5C89A 1K73C 4A9EA 5LJ0A 4NR5A 4ZNXA 2A7YA 4A9NA 1RI9A 3VYGA 2J6OA 1VA7A 2LDMA 5E3DA 3NTKA 3VS5A 1VQMQ 1ZKRA 1NZ9A 3G71T 2FRYA 4JS4A 3CBOA 4O7AA 1WJQA 1QLYA 4YYIA 4F7UA 4JZ3A 4BI8B 1KQ1A 1D09B 1RAHB 2LVMA 4LDYA 5FBXA 1X75C 4IR3A 2FO0A 3VS2A 1KD1U 1VQKQ 3O37A 3CMET 2D6FA 4FU6A 1XNIA 5ENBA 2K2VA 4OB1B 1YI2T 3LJWA 3HPWA 4Y03A 4FW2A 2HMAA 1G5VA 1X2KA 2K79A 5CS8A 2LJ3A 1U06A 4LR6A 1G3YA 1VOMA 2K6DA 1VQ8A 1D0YA 3JB9F 2DERA 3V8LA 3IQLA 3OYYA 2R0SA 4JPBW 4M7DD 5DYUA 2R58A 2RNAA 1N9SA 3SWNB 1W1FA 1ACMB 1GCQC 1W2BA 1E6GA 4N4FA 5CUDA 3P8DA 1ZA2B 4OGEA 3RKYA 2CP2A 3FLGA 5LJ5e 4PFPA 2RHYA 1D0ZA 4OGIA 1RI0A 2YLBA 4YYDA 2QI2A 4C5IA 5GAOl 2HZYA 1AT1B 4PK4A 5DLOA 2X4XA 4NS5A 5CQ3A 2HL5C 2DIQA 1AHJB 1FWZA 5ENHA 3UV2A 1YNZA 2DETA 4IR4A 1FYNA 5D3LA 4LDXA 4O72A 1UGVA 4QSVA 1BIAA 2R5AA 1U1SA 3NGPA 4QR5A 3VJPA 4UIXA 4XU2A 1QWFA 5F36A 4O7CA 1F1BB 2R0VA 2CS7A 2MMPA 3OMGA 1VQ7Q 2H3JA 4NYWA 1C6VX 5HRVA 4F17A 2EBPA 3JB9J 1OYXA 1CSKA 3HMEA 1Q86U 3JSCA 1M1KR 5KTWA 1VQLT 5EWCA 4KGXB 4IKFA 5FH8A 2C0IA 2RB6A 4NR7A 2L3QA 4QVZA 4NRBA 4ZTJA 4QSPA 2QDYB 2JXBA 3SD4A 3I3JA 2GF7A 4C5EA 2KROA 4NR8A 3IU5A 1V29B 5D6YA 4IUTA 3SB2A 1Q86C 4F7UG 5GAOp 2D0NA 3M4GA 1ZLMA 3RNJA 5EWHA 5CQTA 5CQ6A 3SVFA 3L2VA 3PIOA 3SDZA 2DVSA 5FU6B 1R77A 2XDBA 1GBRA 2RJEA 2XDPA 1VQ8Q 5FH6A 3U5NA 2BUDA 3MEVA 2QA4A 3DWYA 4QUUA 1Y96A 3CPFA 2QQBA 5FWBA 2X51A 4BY6B 3E2UA 4RTYA 1I4K1 5EI4A 5DYXA 5GAN5 4B9XA 2I8NA 4C67A 5F25A 3HRSA 3M9QA 1YIJQ 1LJOA 1JJ2P 4JS5A 5I11A 1JEGA 2VASA 2E3KA 3O36A 4M78F 2NUZA 3QYGB 2P4TA 4M7DE 1PC0A 4QSQA 1YJNQ 1AVZC 4Z02A 3EFOA 2DYIA 5DLXA 2AZVA 2HD0A 4O7EA 2CT3A 5E9MA 3QWYA 4ORZA 3FRNA 1YI2Q 4KUDK 3UVDA 2DL8A 3JCMf 4EMKC 5IAYA 2MWPA 1WXTA 2MF2A 2K2MA 3J7AF 2YHTA 3LQIA 3REBB 3OBYA 5GAN4 3CC7Q 4AKNA 2FVUA 2NUTB 2QK0A 2KRMA 4WHUA 5KCOA 4J0SA 4K11A 4J1PA 1UECA 1NYGA 4LDVA 3P1FA 2LZ6B 4Z93A 1QKWA 4LDFA 2L8DA 4XK8E 3SHWA 5HFQA 1EFNA 3X28B 5LJ2A 3JVMA 3VS7A 2MI6A 1VIEA 4QQGA 4M7DC 2DBMA 2HQXA 3SVHA 2ENMA 4NR6A 4A9JA 4Z89A 2YUOA 2F2VA 2QEXT 2E12A 3I35A 2LMJA 3CCUT 2BKDN 3G71A 1BK2A 3UA7A 3G6EA 4XU0A 4QC1A 2DD5A 4C0DB 5FRMA 3PMTA 1MMGA 2DATA 3JCMc 4J9IA 4NR4A 2B86A 4TVRA 1MNEA 4PJJA 2VGMA 5DFBA 2GRCA 4LXCA 4XTUA 3VU3C 4C92A 2H8HA 5A5NA 2LC4A 4PJOE 3K2JA 1PM3A 4M7AB 4NQNA 4GPJA 1VQ6A 4ZGDB 4QNSA 5EM3A 5KYWB 4FT2A 4CLBA 4HXNA 1UE9A 3CCSQ 1KC8U 2DIGA 2JTEA 1AWOA 2DAQA 2CH4W 4CC7A 2OTJT 3CCVQ 1AEYA 2YRVA 1M1KC 4JDSA 4M4ZA 4UYHA 1Z9ZA 4C5HA 2HKNA 4ALHA 5LVQA 1SG5A 1RUWA 5FB0A 4MZMA 3C12A 1QVFS 5I40A 1YJWA 3VKGA 2AK5A 3NFCA 4M75C 3CCJA 4PJOD 2E1HA 1IZ6A 4XUAA 1GL5A 3UVWA 3S3NA 3VUZA 3OSVA 4YABA 2RHXA 2YYNA 3CCRQ 2V26A 2EIFA 4M78G 5LJ3h 5CTLA 1I5LA 4F04B 4NUEA 2HQHA 4WTOB 2H60A 1FX7A 4NXJA 2ZPHB 3J81E 2RF0A 5EU1A 4OUFA 2LNVA 3RMSA 4CUQA 2Y4YA 3OQ5A 3LX7A 4HVVA 4E7HA 1NE8A 2YSQA 1OULA 5I21A 5GAOq 5D6WA 1BI2A 3JB9G 1HXDA 1YITA 2E4HA 2EGCA 3CQTA 5ETDA 3INZA 5KO4A 4C92G 2RQTA 2QQRA 2DXBA 5GMKl 4M78D 1K9MU 5KYYB 4HT8A 5CPEA 3CD6Q 4C8QF 4A9KA 5LJ5f 4OVAA 5L97A 2SEMA 4OB0B 2YEMA 2Y4XA 3JVJA 1BI3A 4OMQA 3X24B 4F16A 3OMCA 4RTZA 1M1FA 4F7UF 5E3GA 5AMEA 1KD1R 3MULA 1B7TA 5FE3A 3EG3A 3AADA 1M1KU 2RMOA 5LJ5j 2RFJA 4A9HA 3H6ZA 4F7UB 2CP0A 3GPLA 5LJ3f 4PCEA 1QP2A 4NYXA 4QSXA 1WI7A 2D8JA 1JXOA 3M57A 4FW1A 2V1RA 1NJIR 2XD0A 5D3NA 5LJ1A 4BY6C 4HCZA 2FPFA 4LZSA 2DTOA 2EYWA 2KXDA 2X3WD 4CI0C 4BW3A 1U1TA 5GAN3 4C8QE 1PNJA 4M7DG 3P1EA 1NM7A 3REAB 1XTDA 3GG3A 3DKMA 1WYXA 5I7YA 2X4WA 4A4EA 1M1GA 3A8LB 3EG9A 1WX6A 3JCMQ 1PSFA 2H3EB 2HSEB 3UATA 4JJBA 3H9NA 3CCLA 4F14A 3JCMX 2ECZA 3EG1A 4X34A 2ZZDA 3P8HA 1AZGB 1OV3A 4X9CA 4NRAA 4NL3A 1VYUA 3CC7T 1XOVA 4HXPA 2COWA 3OY9A 3TVTA 4QQDA 3CD6A 2YDLA 2HKQB 2DL5A 2ZCFB 1VYVA 5CCAA 3MEAA 1VQ7T 2R0YA 4NR9A 4C8QD 1LNXA 1YJNA 3WVDB 4JRIA 2CP6A 2FZCB 1PCXA 2DTIA 3ME9A 1ZSZA 3LYIA 1UGRB 4A53A 5EVAA 2DA9A 1E7OA 2GBQA 4RUGA 4J83A 1K8AU 4CUSA 5F2PA 1M27C 4XUBA 4CUUA 5I22A 5D7UA 3CCMQ 5IGKA 1FXXA 5EG2A 2X9HA 4JLIA 1I0CA 3THKA 4TT4A 2DM1A 1RAEB 5KU3A 5I2SA 4HCKA 3JVKA 5FU6C 3TSZA 1WXUA 5ECAA 4IR6A 4CC3A 2I2LA 5CIUA 2DTHA 1ABQA 2DZCA 3BY7A 4PJNA 4KGVB 4JRPA 2KRSA 5EGUA 4M78E 4QW2A 4IIMA 2RI5A 2B8AA 2O01E 5DX4A 3CCRA 2ZPFB 4DOWA 2EYZA 3GIBA 4M78A 2ZGWA 3EFOB 3CPWP 5LJ3d 4MEOA 5GAN7 4MR3A 3PVQA 4FSSA 1Q95G 2DE0X 4R55A 5F1LA 3QIIA 2OAUA 5GMKe 3META 4XTVA 5GANg 1YP5A 1QMCA 2LQNA 4PFOA 1KC8R 2CZ1B 5A81A 5FE2A 2A3LA 3CPWS 2P0KA 5A5OA 2F69A 3O33A 1RLQC 3QZ9B 3DAIA 3RKXA 4BB7A 4LUDA 2VKNA 3JRZA 4YH4A 4GLKA 4IOOA 1OZ3A 1YI2A 3C0CA 2JOYA 1JXMA 4N0AC 2ABLA 2RPNA 1ZSZB 2SRCA 3MO8A 5CK9A 3TCJA 3CCQQ 1Z9QA 3CPWA 1N8RR 3UF4A 2VXFA 1D0XA 2M1HA 4RTUA 4YADA 2EYQA 1TG0A 3ERRA 4QEVA 3MEUA 3I5RA 3R6OA 3X25B 2QG9B 2CZ0B 5KYYA 5EISA 2YEKA 3QZ5B 1TXQA 4CRIA 2K9GA 5DW2A 2EJFA 3E1SA 5EV9A 5AMFA 1KD1C 5BT4A 1LVKA 4E96A 1HSQA 1YJNT 4N4HA 3CEYA 3QHSA 4GY5A 5BT3A 4EMKA 4YH3A 4LN2A 4OMMA 3A5ZB 1UJYA 4O7FA 4AFUC 3DLLA 1RADB 3C95A 3M55A 1GRIA 4FIBA 1AD5A 5C85A 3EG0A 4M78B 1NLOC 5E73A 1OI1A 2YRDA 3EAEA 2L89A 3LLRA 2EYYA 1BCOA 1Y0MA 3DLMA 4IR5A 2F1LA 3NMZC 3AQAA 2I0NA 3OYGA 3Q2FA 5FG5A 3RR6A 5A7CA 2BZYA 4J9CA 4PCIA 2FSAA 2KNBB 2MK5A 1VQ4Q 1NEGA 2E65A 3NTHA 4HXSA 5LJ3g 1KSWA 4C8QA 3PNWC 2HEQA 3G1JA 4OP0A 4AKIA 4HBVA 5I1QA 2OTLQ 5FFVA 5D6XA 5E9IA 5A0DA 1Y96B 5CRMA 3FDRA 5CVIA 2KY9A 1YIJA 4PLLA 2DL4A 2GFAA 2RO1A 3VRYA 5IXBA 2LTOA 3QDRB 4HBWA 3L2QA 1YITQ 2JM8A 5HRWA 3VS1A 3JCMP 2EW3A 1BU1A 1PHTA 2FZGB 5GAMh 5DYCA 4NL2A 5HENA 4A4GA 2OI3A 5J0DA 3EGDA 1WDXA 5II1A 2O4XB 4N0AA 1HD3A 2COYA 2QTXA 4Z1SA 2JT4A 2DEUA 4FSXA 3L2UA 4CC2A 4HXMA 1OU8A 5HQ5A 2RHZA 5D26A 5I2MA 5GAOr 3CXCP 5FW9A 1O75A 4C8QB 5LL6S 1VQ8T 3DB3A 2RQWA 3GLXA 4WHWA 4MDXA 4HXKA 2HSPA 2M51A
chains in the Genus database with same CATH topology
3UPUA 3CCVT 4QR3A 2WACA 3H8ZA 5KCHA 4QBMA 2OTLT 5EICA 5GAN2 3HSBA 3X26B 2VYTA 3SVGA 4YYKA 4WF2A 3G0LA 4XU3A 1VQMA 1YHQT 2LT1A 2D9EA 2M0OA 3ZBDA 5K29A 1XQHA 3CCRT 3OS0A 3RESA 4N4IA 3N5BB 1YJ9A 4ZN3A 2JTMA 1KG1A 5F63A 4O76A 4A9LA 1BIBA 3OB9A 5CKEA 4NQMA 2R10A 3U5OA 1QP3A 4OB2B 4QSUA 3O34A 4YBMA 4MR5A 4UC4A 5FRNA 3M53A 3HP9A 4LYWA 2F5TX 4QSWA 3C4SA 3QZSA 4YBTA 3S92A 5CO7A 5E9LA 1UEBA 4IUUA 1Q7YU 2X4YA 2EKOA 5ENJA 4IUVA 4E7LA 1WUMA 1UGQB 3P8BB 5FG6A 4NRCA 2KAFA 4BE2A 4XQ3A 1VQ6T 1Q82U 4FT4A 1GXIE 5HRXA 4YBSA 2AHJB 3J80E 4CURA 4XYAA 5HKCA 4YYHA 3RCWA 1KQSA 2JUFA 3HMFA 3ONIA 4XY8A 3CCMT 2E6NA 4NYVA 1K9MC 3MXFA 2E5QA 3E19A 5GANh 5M9OA 5CKDA 2KSSA 5I7XA 2V8IA 1NJIC 4C0GA 2RH2A 4BDZA 5CQ5A 3UWNA 1E6IA 4RCCA 4M77B 5FU7C 2OO1A 1U8RA 4TU6A 4EPCA 5DKDA 1I81A 2JN0A 2WP2A 4KV4A 3RERA 3PTAA 1VQ7A 3FEOA 5L8RE 3KXTA 5H1TA 4PKLA 3G6ET 3OYLA 5I89A 2JVVA 2CGHA 3OW2S 3I55A 4O75A 2ZPIB 5LJ5g 3OYBA 5HQ7A 5GAMj 1BKBA 4J6WA 3M56A 2NXBA 4TT2A 3G7ZA 3I55T 2CYZB 1B34B 2LQKA 3OYDA 3CCUA 5HELA 4M77G 4RKUE 3GP8A 1WQWA 3LWHA 5DFCA 2DD4A 2K5IA 4LZRA 1M9SA 2E41A 4ZGEB 2EQUA 2OTLA 4QSSA 5F5ZA 3JCMb 5J26A 3URGA 3FC3A 5HY6A 5CZGA 4QY4A 4XTXA 3M58A 5DFDA 4NUCA 4HXOA 4PJOB 1X0JA 5EK9A 4L59A 4XAXB 4ME7A 3V7CA 2DVVA 4RG8A 5FDZA 3EFSA 5C7NA 4O78A 2BIVA 5GAMg 3LQJA 2E7NA 4CFKA 5FE8A 2GQVA 5GAOm 4YY4A 4OB3B 2RK2A 2K4YA 4YYJA 4HBYA 1Y71A 3S3OA 3U5MA 5JWMA 2K3YA 2DXCA 4QB3A 4EMKB 1EQFA 3HMHA 4M77F 5ACYA 2E6ZA 1MGQA 1N72A 5CUGA 4M7DA 2DEQA 4UYGA 2YELA 2DO3A 3CCST 3MP6A 4BE1A 2RI2A 4OGCA 1YITT 5A85A 4RVRA 5DKHA 4O6JA 5L98A 3CC4T 4J3IA 3UV5A 3JCMe 1BI1A 4F7UE 3CMEA 4QUTA 4EMHA 2HNIA 4TZ2A 3BDLA 2EQKA 4MENA 3FJPA 5C0MA 5DLQE 3CCSA 3AHUA 3JCMV 1JSPB 2YQDA 3FB9A 3O35A 5H1VA 2L5QA 4M75F 3L1AA 5FE4A 3S3MA 3OYAA 3S91A 1W2BS 1N8RC 5KHMA 4ZQLA 2EJGA 5CQ7A 1NPPA 5D3HA 3MB3A 5DW1A 1VQNA 2R57A 5GANj 3JCMW 4LZ2A 4CL9A 3L2WA 5D3RA 1LOJA 3QG1A 3MEWA 3M59A 5A5SA 5ENEA 2LT4A 4PJOG 5FG4A 4KCXA 3LXJA 4UIYA 2XKOC 5C8GA 4IUQA 1UGPB 5DKCA 1P92A 3V7RA 4M77E 3U5PA 2LRQA 3GOXA 5GAMd 5GAMe 4C8QC 4NUDA 4X2IA 2KK4A 1Q7YC 2DJZA 3OYMA 1M90C 5CUCA 5CU8A 5CGPA 3NTIA 4E7KA 4Q0NA 3A8OB 5D7XA 5L8TA 5GMKj 4XY9A 2VV5A 1ZS5A 1JBMA 4J6YA 1K8AC 2EWNA 4DOVA 5C6SA 4MEQA 4QEUA 4TU4A 4ZN1A 3P1CA 2JZ2A 1JRIA 4A9OA 3QZTA 4O77A 3L42A 3SWNA 2M16A 1Q81C 2RNWA 2JNGA 4C66A 3CXCS 2FL7A 4Z1QA 4E7IA 4ALGA 2RHUA 5EQ1A 1G3SA 4M7AG 2L84A 3G0JA 5FFWA 2V8JA 5CFWA 4QZSA 2DK3A 2XHCA 3HHTB 3KBGA 4PL6A 5I80A 5H1UA 3PMIA 1TH7A 5FLXE 4Z6HA 5EWDA 5A82A 4HBXA 4A4KA 3RMQA 2D82A 5LJ5h 5EA1A 4M78C 4BUGA 3SFMA 5TCMA 4BI4A 3JAME 4XU1A 5DM7R 4LC2A 4LRGA 3CCLT 4C92D 4RMOA 2MWOA 5COIA 1NPRA 5HQ6A 1K73U 1I8FA 3CBPA 4TYLA 3Q1JA 1W4SA 4VUBA 5A0GA 3TLPA 2L5EA 2N9GA 3CC2T 3QYHB 4Y91A 4A9FA 5IGLA 2XG8D 4KUIA 1N9RA 1VQOA 5AD3A 2QQAA 3O8VA 5IIDA 5FE1A 5J39A 3A8GB 3MP8A 4QC3A 4TT6A 2EJ9A 3PT9A 2DXTA 5CKHA 2CKKA 1M4ZA 3MHXA 4A4FA 2G4AA 2WP1A 4YATA 4N4GA 4UYFB 4QQ6A 3L2RA 4II1A 1JB0E 5KTXA 2RS9B 4UYFA 2LCCA 3CCQA 1H641 1KHCA 1BYMA 2RO0A 4FLPA 5CUAA 5D0CA 4E47A 5DLZA 2EFIA 3T9NA 3UVYA 4PNOA 4FL6A 4PKCC 3M54A 5D25A 3QZVA 4Y28E 5ENCA 5II2A 3ASKA 4PY6A 4PJOF 3OS2A 3CC4A 4BW2A 2OSSA 5FE5A 4RCBA 3OYCA 1UGSB 4EDUA 5G4SA 5D3TA 3A8MB 1JJ2S 3CCQT 4ZC9A 4Q5WA 3F70A 4A54A 5GMKi 3X20B 1VQPT 5CRZA 2DVRA 5KTUA 5GAMf 4M7AE 2DPPB 2L3RA 2EQMA 3U5KA 3QO3A 1WNLA 3CD6T 2K57A 3MUKA 3UDCA 3P1DA 1VQOT 2FYKA 2DVEA 3OYKA 4M7AA 5KE2A 1VIFA 4QR4A 4V2SA 2YDWA 5EWWA 1QW1A 5BT5A 3GNGA 4ZW1A 5CQYA 5A5PA 5KE3A 2LQ8A 1VQLA 5LKXA 1VQMT 4E7JA 3M5AA 3HKSA 4IUPA 5IN1A 2QEXA 2L85A 5HLSA 5GANe 3LGFA 3S6WA 3OYNA 1UB4A 2PUOB 2X35A 4J8OA 5L8UA 3E9FA 5F60A 1D3BA 2XDDA 2PVDB 3OYEA 2PVOB 4LDWA 5EWVA 5FH7A 4L6V5 3VKIA 1KQSS 3CCET 3FIFA 5IG6A 3OA6A 4OMFB 3TU4K 4L5GA 2HAXA 1VQ5A 3KUFA 5CY9A 3QPHA 4PTBA 2P0PA 3QXEB 2F6NA 3LWIA 2RK1A 5C4QA 2ZPBB 4HA8A 5IT9E 4X9DA 3JCMd 4QSRA 2CZ7B 4ZTFA 4HT9A 5A2QE 4ZGJB 5I86A 2LX9A 4HCCA 3BFMA 4NOYA 1G3WA 4M7AC 3CCJT 5EPBA 5CKBA 1D3BB 1YJWT 5LUUA 2RD1A 5A5QA 4M77D 4J0RA 4MMLA 3CCMA 3TREA 5LJ5d 5H85A 4O7BA 4UYDA 4Q0OA 4BHWA 2R5MA 4ELZC 1H3ZA 1Q81U 5CKFA 4KULA 1VUBA 5CQ4A 3U5LA 4D6WA 4UIVA 2XIDA 3I56A 4UYEA 2LSPB 5DY9A 4M75G 4JRKA 5I29A 4J7FA 4MEPA 1ZHIA 5GAOn 3TEEA 5L99A 5E7DA 3BW1A 3ZFJA 3E9GA 4CFLA 5ETBA 4M7AF 1Y7XA 5HK0A 3PGGA 2DWWA 1OZ2A 2E7OA 1KHIA 1M90U 4PJOC 2RJDA 5DY7A 4M75D 2E10A 2V8KA 4JUVA 3M4YA 4KT0E 2WSCE 2X4JA 1G3TA 2JTFA 4O74A 4YTLA 4JJNK 3V7SA 5E0RA 4MR4A 4MZTA 5EPRA 4MMKA 4KV1A 2RNYA 1VQNT 2MJVB 4Z6IA 5E74A 1WPYA 4MDWA 1X6OA 3BDUA 2Y90A 5HFRA 1VQPA 5L96A 5F1HA 4J6XA 3PFSA 3HL8A 4A9MA 3C94A 3LGLA 4YYGA 3CMAA 5ENGA 3HRUA 2RNXA 4C92F 5FB1A 3CCVA 4QYDA 4OGJA 1QVPA 2RI3A 2K3XA 3JCMJ 3UVXA 1YCYA 4N3WA 2DZ9A 2YW5A 4MR6A 4ELYC 1S72T 2QQSA 4O5VA 2NLUA 4UITA 3ZYUA 3MCAB 4LD6A 3FKMX 2XU8A 5A0LA 1X01A 2KQWA 3U5JA 4ATOA 4DA4A 2KTBB 4HCBA 3IU6A 2QXFA 2GFUA 3ZEHA 2ZPEB 2RJFA 4DONA 4BACA 4EMGA 2VXEA 5DYAA 3HFNA 2VGNA 2K5LA 3SWNC 1KQ2A 4UIUA 3OSSC 3OS1A 1Q82C 5FROA 5AYFA 4XTYA 5A5RA 2RHIA 1B34A 4CUPA 3QUIA 2KVQG 4IURA 2DXUA 1M5Q1 3QSUA 4A4HA 3CBMA 2OUOA 4M75E 2K5FA 4C0FA 2QA4T 4C0ZA 4YC9A 2G3RA 3PIPA 4IOQA 1SSFA 1N6AA 4M75A 4LYIA 5ENIA 2WSFE 4F3IA 5LKZA 2XI9A 5F61A 4LYSA 4HXLA 2DKGA 4C0DC 1KC8C 1YHQA 5TB6A 3RIRA 2RM4A 5FE7A 3OYJA 3JCMh 1JJ2A 2E64A 1EIFA 4BE0A 2I7KA 4M7AD 1N8RU 5ENFA 1WUGA 3QBYA 2M9UA 4B9WA 1N27A 4XTZA 2FHDA 5FE0A 4QVDA 3UT1A 5I83A 5GMKh 1MHNA 1QVFA 3MB4A 2PU9B 5A83A 5GANf 5C87A 4O71A 1WQ7A 3MQMA 5HM0A 4BDYA 3P5OA 4C92B 3UW9A 2LCLA 4HXRA 3G4ST 4C5GA 3CXCA 4WIVA 3WVEB 2CZ6B 1VQKT 3V8KA 2DVQA 4R56A 5CQ8A 4BD3A 4BJXA 4M75B 2HQEA 1VQ4T 5HCLA 3CCEA 5LVRA 5F62A 4LDUA 5CQXA 2RI7A 4TQNA 5D24A 3NXBA 5GANd 4PLIA 1ZBXA 3G4SA 2IVWA 4YY6A 4UIWA 3JB9H 2VUBA 4JLGA 3LH0A 2E70A 4RG2A 1WJRA 4J7IA 2D0QB 3V8JA 5CUBA 1RL2A 5CAIA 3QJYA 1VQ9A 2EAYA 4C92E 4BW1A 4HKEA 3JVLA 4M7DF 4KBMB 4O70A 5D3JA 5G4RA 5KH6A 3A8HB 5FU7B 5E9YA 2PVGB 3OYIA 2MAMA 1QVGS 3QJ6A 4YK0A 1ZQ1A 1VQ9T 4BI3A 5IGNA 5HEMA 2KDSA 1M8VA 1HK9A 2RJCA 3D7CA 3QKJA 2F6JA 4M7DB 2WSEE 3I56T 2P0QA 3LW5E 1QVGA 5JI8A 1S72A 4LD9K 5IBNA 4C8QG 1R8OB 5CUEA 4YYNA 4BW4A 3HFOA 1YBYA 5LKTA 4QSTA 3JB9D 1VQ4A 5GAN8 4UIZA 2HBPA 1VQKA 4M77A 5FE6A 5D3SA 3OYFA 4YYMA 2O4XA 1O9SA 5CR2A 1NJIU 2PUKB 5DBMA 2F5KA 4MZPA 3OS5A 5IGMA 4P5NA 2GCXA 1YIJT 4A9IA 3MP1A 5EP7A 3OW2A 3DB4A 5LJ3e 5FFYA 3RKWA 4JRQA 4TS8A 4C92C 5FE9A 3CMAT 4PJOA 4QYLA 3WXMB 2EQJA 5E9VA 2PQWA 5D3PA 3EFRA 5GAN6 3HRTA 1WJSA 1VQ5T 4CUTA 4TZ8A 5CP5A 3VV0A 2KMTA 2VC8A 5GMKm 2D9TA 1Y07A 3RUXA 5EPSA 2ZPGB 2QQ9A 4IORA 3ER0A 1IREB 4YAXA 3LQHA 2YLCA 3Q2EA 3CC7A 3OYHA 2C06A 1JM4B 4TTEA 4PS5A 4J5YA 5LJ3j 3CC2A 1PSEA 3JB9I 4QVCA 3OBWA 1WGSA 5HJCA 3VYHB 2OTJA 5CQAA 5LKUA 4OF1A 1YJ9T 2DKWA 1F68A 3JCMg 2IG0A 2XK0A 5F3AA 5I88A 2XICA 1BI0A 2RA2A 4M77C 3GF5A 3L2ZA 2FB7A 3VUBA 5E9KA 4FM4B 3GNFB 5J3BA 1DJ7B 4QEWA 4DQ2A 3UV4A 4XTWA 5HK3A 5AD2A 5C89A 1K73C 4A9EA 5LJ0A 4NR5A 2A7YA 4A9NA 3VYGA 2LDMA 5E3DA 3NTKA 1NZ9A 3G71T 4JS4A 3CBOA 4O7AA 1WJQA 4YYIA 4F7UA 4BI8B 1KQ1A 2LVMA 4LDYA 5FBXA 1X75C 4IR3A 1KD1U 3O37A 3CMET 2D6FA 4FU6A 1XNIA 5ENBA 2K2VA 4OB1B 1YI2T 3LJWA 3HPWA 4Y03A 1G5VA 5CS8A 4LR6A 1G3YA 1VQ8A 3JB9F 3V8LA 3OYYA 2R0SA 4M7DD 5DYUA 2R58A 1N9SA 3SWNB 1W2BA 4N4FA 5CUDA 3P8DA 4OGEA 3RKYA 3FLGA 5LJ5e 2RHYA 4OGIA 1RI0A 2YLBA 4YYDA 2QI2A 4C5IA 5GAOl 5DLOA 2X4XA 4NS5A 5CQ3A 2DIQA 1AHJB 1FWZA 5ENHA 3UV2A 4IR4A 4LDXA 5D3LA 4O72A 4QSVA 1BIAA 2R5AA 1U1SA 4QR5A 3VJPA 4UIXA 4XU2A 5F36A 4O7CA 2CS7A 2R0VA 2MMPA 3OMGA 2H3JA 4NYWA 5HRVA 3JB9J 1OYXA 3HMEA 1Q86U 3JSCA 5KTWA 1VQLT 5EWCA 4IKFA 5FH8A 2RB6A 4NR7A 4QVZA 4NRBA 4ZTJA 4QSPA 2QDYB 3SD4A 3I3JA 2GF7A 4C5EA 4NR8A 3IU5A 1V29B 5D6YA 4IUTA 3SB2A 1Q86C 4F7UG 5GAOp 3M4GA 5EWHA 5CQTA 5CQ6A 3SVFA 3L2VA 3PIOA 3SDZA 2DVSA 5FU6B 2XDBA 2RJEA 2XDPA 5FH6A 3U5NA 2BUDA 3MEVA 2QA4A 3DWYA 4QUUA 1Y96A 3CPFA 2QQBA 4BY6B 1I4K1 5EI4A 5DYXA 5GAN5 4B9XA 2I8NA 4C67A 5F25A 3HRSA 3M9QA 1LJOA 4JS5A 2E3KA 3O36A 4M78F 3QYGB 2P4TA 4M7DE 4QSQA 4Z02A 5DLXA 2HD0A 4O7EA 5E9MA 3FRNA 4KUDK 3UVDA 3JCMf 4EMKC 5IAYA 2MWPA 2MF2A 3J7AF 2YHTA 3LQIA 5GAN4 3OBYA 4AKNA 2FVUA 4WHUA 5KCOA 4J0SA 4J1PA 4LDVA 3P1FA 4Z93A 4LDFA 2L8DA 4XK8E 5HFQA 3X28B 5LJ2A 3JVMA 2MI6A 1VIEA 4QQGA 4M7DC 2HQXA 3SVHA 4NR6A 4A9JA 2QEXT 2E12A 3CCUT 2BKDN 3G71A 3G6EA 4XU0A 4QC1A 2DD5A 4C0DB 5FRMA 3PMTA 2DATA 3JCMc 4NR4A 4TVRA 2VGMA 5DFBA 2GRCA 4XTUA 4C92A 3VU3C 2LC4A 5A5NA 4PJOE 3K2JA 4M7AB 4NQNA 4GPJA 1VQ6A 4ZGDB 4QNSA 5EM3A 4FT2A 4CLBA 4HXNA 1KC8U 2DIGA 2DAQA 2OTJT 2YRVA 1M1KC 4JDSA 4UYHA 4C5HA 4ALHA 5LVQA 5FB0A 4MZMA 3C12A 1QVFS 5I40A 1YJWA 3NFCA 4M75C 3CCJA 4PJOD 2E1HA 1IZ6A 4XUAA 3UVWA 3S3NA 3VUZA 3OSVA 4YABA 2RHXA 2YYNA 2EIFA 4M78G 5LJ3h 5CTLA 1I5LA 4NUEA 2H60A 1FX7A 4NXJA 2ZPHB 3J81E 5EU1A 4OUFA 2LNVA 3RMSA 4CUQA 2Y4YA 3OQ5A 3LX7A 4E7HA 1NE8A 5GAOq 5I21A 5D6WA 1BI2A 3JB9G 1HXDA 1YITA 5ETDA 3INZA 5KO4A 4C92G 2QQRA 2DXBA 5GMKl 4M78D 1K9MU 4HT8A 5CPEA 4C8QF 4A9KA 5LJ5f 4OVAA 5L97A 4OB0B 2YEMA 2Y4XA 3JVJA 1BI3A 3X24B 3OMCA 1M1FA 4F7UF 5E3GA 5AMEA 3MULA 5FE3A 3AADA 1M1KU 5LJ5j 2RFJA 4A9HA 3H6ZA 4F7UB 3GPLA 5LJ3f 4PCEA 1QP2A 4NYXA 4QSXA 3M57A 2XD0A 5D3NA 5LJ1A 4BY6C 4HCZA 4LZSA 2DTOA 4CI0C 4BW3A 1U1TA 5GAN3 4C8QE 4M7DG 3P1EA 1XTDA 3GG3A 3DKMA 5I7YA 2X4WA 4A4EA 1M1GA 3A8LB 3JCMQ 1PSFA 3CCLA 3JCMX 4X34A 2ZZDA 3P8HA 4X9CA 4NRAA 4NL3A 3CC7T 1XOVA 4HXPA 3OY9A 4QQDA 3CD6A 2ZCFB 5CCAA 3MEAA 1VQ7T 2R0YA 4NR9A 4C8QD 1LNXA 1YJNA 3WVDB 4JRIA 2DTIA 3ME9A 3LYIA 1UGRB 4A53A 5EVAA 1K8AU 4J83A 4CUSA 5F2PA 4XUBA 4CUUA 5IGKA 1FXXA 5EG2A 4JLIA 4TT4A 5KU3A 5I2SA 3JVKA 5FU6C 4IR6A 2I2LA 5CIUA 2DTHA 3BY7A 2DZCA 4JRPA 5EGUA 4M78E 4QW2A 2B8AA 2RI5A 2O01E 5DX4A 3CCRA 2ZPFB 4DOWA 3GIBA 4M78A 2ZGWA 5LJ3d 4MEOA 5GAN7 4MR3A 4R55A 5F1LA 3QIIA 2OAUA 5GMKe 3META 4XTVA 5GANg 2CZ1B 5A81A 5FE2A 2A3LA 3CPWS 2P0KA 5A5OA 2F69A 3O33A 3QZ9B 3DAIA 3RKXA 4BB7A 3JRZA 4YH4A 4GLKA 4IOOA 1OZ3A 1YI2A 2JOYA 4N0AC 5CK9A 3MO8A 3TCJA 3CPWA 2VXFA 2M1HA 4YADA 2EYQA 3MEUA 4QEVA 3R6OA 3X25B 2CZ0B 5EISA 2YEKA 3QZ5B 4CRIA 5DW2A 2EJFA 3E1SA 5EV9A 5AMFA 1KD1C 5BT4A 4E96A 1YJNT 4N4HA 3CEYA 3QHSA 4GY5A 5BT3A 4EMKA 4YH3A 3A5ZB 4O7FA 3DLLA 3C95A 3M55A 4FIBA 5C85A 4M78B 5E73A 1OI1A 3EAEA 3LLRA 2L89A 3DLMA 4IR5A 3AQAA 3OYGA 3Q2FA 5FG5A 5A7CA 4PCIA 2FSAA 2E65A 3NTHA 4HXSA 5LJ3g 4C8QA 3PNWC 4OP0A 4HBVA 5I1QA 5FFVA 5D6XA 5E9IA 5A0DA 1Y96B 5CRMA 5CVIA 3FDRA 2KY9A 1YIJA 4PLLA 2GFAA 2RO1A 2LTOA 3QDRB 4HBWA 3L2QA 5HRWA 3JCMP 5GAMh 5DYCA 4NL2A 5HENA 4A4GA 5J0DA 5II1A 2O4XB 4N0AA 2QTXA 4Z1SA 4FSXA 3L2UA 4HXMA 5HQ5A 2RHZA 5D26A 5I2MA 5GAOr 1O75A 4C8QB 5LL6S 1VQ8T 3DB3A 3GLXA 4WHWA 4MDXA 4HXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSQ A;  4QR3 A;  4Z02 A;  5ENF A;  1WUG A;  3TLP A;  2WAC A;  5DLX A;  3H8Z A;  3QBY A;  2L5E A;  4O7E A;  2N9G A;  5KCH A;  4QBM A;  5E9M A;  4B9W A;  1N27 A;  3UVD A;  4A9F A;  5EIC A;  5IAY A;  2MWP A;  5IGL A;  2FHD A;  2VYT A;  5FE0 A;  3SVG A;  3UT1 A;  5AD3 A;  4YYK A;  3O8V A;  5IID A;  3LQI A;  5I83 A;  3G0L A;  5FE1 A;  1MHN A;  4AKN A;  2D9E A;  3MB4 A;  5J39 A;  2M0O A;  4WHU A;  5A83 A;  5K29 A;  3MP8 A;  4QC3 A;  5KCO A;  3OS0 A;  4J0S A;  4TT6 A;  4N4I A;  4J1P A;  5C87 A;  4O71 A;  2CKK A;  3MQM A;  5HM0 A;  4BDY A;  3P5O A;  3P1F A;  4Z93 A;  4LDF A;  2L8D A;  3UW9 A;  5HFQ A;  4HXR A;  4C5G A;  4A4F A;  5F63 A;  5LJ2 A;  4WIV A;  2G4A A;  4O76 A;  3JVM A;  2WP1 A;  4A9L A;  4QQG A;  3OB9 A;  4NQM A;  2R10 A;  3SVH A;  2HQX A;  2DVQ A;  4YAT A;  4N4G A;  4UYF B;  4QQ6 A;  3L2R A;  3U5O A;  4NR6 A;  4A9J A;  4QSU A;  4II1 A;  3O34 A;  4YBM A;  5CQ8 A;  5KTX A;  4BD3 A;  4MR5 A;  4BJX A;  2RS9 B;  4UYF A;  2HQE A;  2LCC A;  4UC4 A;  5HCL A;  5FRN A;  1KHC A;  5LVR A;  5F62 A;  2BKD N;  4LYW A;  4QSW A;  2RO0 A;  3C4S A;  4FLP A;  5CUA A;  5D0C A;  3QZS A;  2RI7 A;  4YBT A;  3Q1J A;  5DLZ A;  3S92 A;  4QC1 A;  4TQN A;  5D24 A;  5FRM A;  3NXB A;  3PMT A;  5E9L A;  2EFI A;  4PLI A;  2DAT A;  3UVY A;  4IUU A;  4FL6 A;  4NR4 A;  5D25 A;  3QZV A;  2X4Y A;  5ENC A;  4YY6 A;  2EKO A;  5II2 A;  3ASK A;  4PY6 A;  4UIW A;  3OS2 A;  4BW2 A;  2OSS A;  5FE5 A;  5ENJ A;  4IUV A;  4E7L A;  3LH0 A;  1WUM A;  3OYC A;  4RG2 A;  5DFB A;  1WJR A;  4EDU A;  2GRC A;  5G4S A;  5FG6 A;  4NRC A;  5A5N A;  5D3T A;  5CUB A;  3K2J A;  4BE2 A;  4ZC9 A;  4Q5W A;  3F70 A;  5HRX A;  4NQN A;  4GPJ A;  4YBS A;  4QNS A;  5EM3 A;  4CUR A;  4XYA A;  4BW1 A;  4CLB A;  5CRZ A;  3JVL A;  4HXN A;  2DVR A;  2DIG A;  5KTU A;  4YYH A;  3RCW A;  4O70 A;  2DAQ A;  5D3J A;  2YRV A;  3HMF A;  5G4R A;  3ONI A;  5KH6 A;  4UYH A;  4XY8 A;  4C5H A;  5E9Y A;  4ALH A;  5LVQ A;  2E6N A;  4NYV A;  3OYI A;  5FB0 A;  3MXF A;  2EQM A;  2E5Q A;  2L3R A;  3U5K A;  3QJ6 A;  5M9O A;  4YK0 A;  5I40 A;  5IGN A;  3MUK A;  5I7X A;  5HEM A;  2RJC A;  3D7C A;  3QKJ A;  4BDZ A;  5CQ5 A;  3P1D A;  3UWN A;  2F6J A;  1E6I A;  4XUA A;  3UVW A;  3S3N A;  3OYK A;  4YAB A;  2RHX A;  2YYN A;  2OO1 A;  4TU6 A;  5KE2 A;  5JI8 A;  5CTL A;  4NUE A;  4QR4 A;  5DKD A;  2H60 A;  2YDW A;  5EWW A;  4NXJ A;  5EU1 A;  4OUF A;  2WP2 A;  5IBN A;  4KV4 A;  4CUQ A;  3OQ5 A;  5CUE A;  3LX7 A;  5BT5 A;  4E7H A;  3FEO A;  4ZW1 A;  5D6W A;  4YYN A;  5H1T A;  5A5P A;  4BW4 A;  4PKL A;  5KE3 A;  5LKX A;  5ETD A;  5I89 A;  3OYL A;  5LKT A;  5KO4 A;  4E7J A;  2QQR A;  4IUP A;  4QST A;  5CPE A;  4UIZ A;  5IN1 A;  4A9K A;  2L85 A;  4OVA A;  4O75 A;  5L97 A;  5FE6 A;  5HLS A;  5D3S A;  3OYF A;  2YEM A;  4YYM A;  3JVJ A;  3LGF A;  2O4X A;  3S6W A;  3OYN A;  5DBM A;  3OYB A;  3OMC A;  2F5K A;  5HQ7 A;  5E3G A;  2X35 A;  5AME A;  5L8U A;  5IGM A;  3E9F A;  3MUL A;  5FE3 A;  5F60 A;  3AAD A;  4A9I A;  3MP1 A;  3OYE A;  5EP7 A;  2NXB A;  3DB4 A;  4TT2 A;  2RFJ A;  4A9H A;  3H6Z A;  5EWV A;  4PCE A;  5FH7 A;  4NYX A;  4QSX A;  5FFY A;  3OYD A;  4TS8 A;  5HEL A;  5D3N A;  5FE9 A;  5LJ1 A;  4HCZ A;  5DFC A;  4LZR A;  4LZS A;  4QYL A;  5IG6 A;  2EQJ A;  4BW3 A;  5E9V A;  2PQW A;  3OA6 A;  2EQU A;  5D3P A;  4QSS A;  5F5Z A;  3KUF A;  3P1E A;  5CY9 A;  5J26 A;  1WJS A;  4PTB A;  4CUT A;  2F6N A;  3GG3 A;  4TZ8 A;  3FC3 A;  5I7Y A;  2X4W A;  5C4Q A;  4A4E A;  5CZG A;  5CP5 A;  4QY4 A;  5DFD A;  4NUC A;  4HXO A;  4QSR A;  4ZTF A;  1X0J A;  5EK9 A;  2D9T A;  4L59 A;  5I86 A;  4X34 A;  2DVV A;  3P8H A;  5EPS A;  5FDZ A;  4NRA A;  5C7N A;  4IOR A;  4HXP A;  4YAX A;  4O78 A;  2BIV A;  5EPB A;  3LQH A;  3OY9 A;  3LQJ A;  3Q2E A;  2E7N A;  4CFK A;  5FE8 A;  4QQD A;  3OYH A;  4YY4 A;  1JM4 B;  4TTE A;  4PS5 A;  3MEA A;  2R0Y A;  5LUU A;  5A5Q A;  4YYJ A;  4HBY A;  4NR9 A;  3S3O A;  3U5M A;  1WGS A;  4J0R A;  5HJC A;  5JWM A;  5H85 A;  2K3Y A;  4QB3 A;  3ME9 A;  4O7B A;  1EQF A;  3HMH A;  4UYD A;  3LYI A;  5EVA A;  4Q0O A;  5CQA A;  4BHW A;  5LKU A;  5ACY A;  4CUS A;  5F2P A;  2R5M A;  4XUB A;  4CUU A;  1H3Z A;  2DKW A;  1N72 A;  1F68 A;  5CUG A;  5IGK A;  2IG0 A;  2XK0 A;  5F3A A;  5CQ4 A;  4UYG A;  3U5L A;  2YEL A;  5I88 A;  4UIV A;  4TT4 A;  4UYE A;  2LSP B;  5KU3 A;  3MP6 A;  4BE1 A;  3JVK A;  5E9K A;  2RI2 A;  4QEW A;  5A85 A;  3UV4 A;  4IR6 A;  5I29 A;  5AD2 A;  4MEP A;  4RVR A;  5C89 A;  5CIU A;  5DKH A;  4A9E A;  5L99 A;  5E7D A;  5LJ0 A;  4NR5 A;  5EGU A;  5L98 A;  4J3I A;  4A9N A;  4QW2 A;  3E9G A;  4CFL A;  5ETB A;  3UV5 A;  2B8A A;  2RI5 A;  2LDM A;  5E3D A;  3NTK A;  5DX4 A;  4QUT A;  2DWW A;  4TZ2 A;  1OZ2 A;  3BDL A;  2E7O A;  2EQK A;  4MEN A;  4MEO A;  4O7A A;  1WJQ A;  4MR3 A;  4YYI A;  2RJD A;  5C0M A;  5F1L A;  3QII A;  5DY7 A;  2LVM A;  1JSP B;  3MET A;  5FBX A;  2YQD A;  4IR3 A;  5A81 A;  5FE2 A;  3O35 A;  2JTF A;  4O74 A;  3O37 A;  5H1V A;  2P0K A;  5A5O A;  4FU6 A;  5E0R A;  3O33 A;  4MR4 A;  5EPR A;  1XNI A;  5ENB A;  4KV1 A;  5FE4 A;  3S3M A;  3DAI A;  2RNY A;  3OYA A;  3S91 A;  2MJV B;  3LJW A;  5KHM A;  4Y03 A;  4YH4 A;  4ZQL A;  5CQ7 A;  1G5V A;  5D3H A;  3MB3 A;  4Z6I A;  5DW1 A;  5CS8 A;  2R57 A;  4IOO A;  4LR6 A;  1OZ3 A;  4LZ2 A;  5E74 A;  4CL9 A;  3L2W A;  5D3R A;  3MO8 A;  3MEW A;  5A5S A;  5ENE A;  5HFR A;  2R0S A;  5L96 A;  5F1H A;  2M1H A;  3PFS A;  5DYU A;  2R58 A;  4YAD A;  5FG4 A;  4A9M A;  4KCX A;  4QEV A;  3LXJ A;  4UIY A;  3MEU A;  5C8G A;  3LGL A;  4IUQ A;  4YYG A;  4N4F A;  5CUD A;  3P8D A;  5EIS A;  2YEK A;  5ENG A;  5DKC A;  4CRI A;  2RNX A;  3FLG A;  5FB1 A;  4QYD A;  5DW2 A;  3U5P A;  4OGJ A;  2LRQ A;  2RHY A;  3GOX A;  5EV9 A;  5AMF A;  4OGI A;  1RI0 A;  2RI3 A;  5BT4 A;  4YYD A;  4C5I A;  4E96 A;  2K3X A;  4N4H A;  3CEY A;  3UVX A;  4N3W A;  4NUD A;  4GY5 A;  4X2I A;  5BT3 A;  2YW5 A;  4NS5 A;  5CQ3 A;  4YH3 A;  2X4X A;  4MR6 A;  2DIQ A;  3OYM A;  2QQS A;  5ENH A;  3UV2 A;  5CUC A;  2NLU A;  4UIT A;  5CU8 A;  5CGP A;  3NTI A;  3ZYU A;  4O7F A;  4E7K A;  4Q0N A;  4IR4 A;  5D3L A;  4O72 A;  4LD6 A;  5C85 A;  4QSV A;  5D7X A;  5L8T A;  2R5A A;  3FKM X;  4QR5 A;  4XY9 A;  4UIX A;  5E73 A;  1OI1 A;  1ZS5 A;  5F36 A;  4O7C A;  2L89 A;  2R0V A;  3U5J A;  3EAE A;  3LLR A;  3OMG A;  4NYW A;  5HRV A;  2KTB B;  3DLM A;  3IU6 A;  4IR5 A;  1OYX A;  5C6S A;  4MEQ A;  3AQA A;  3HME A;  4QEU A;  5KTW A;  3OYG A;  5EWC A;  3Q2F A;  4TU4 A;  5FG5 A;  4IKF A;  3P1C A;  2GFU A;  5FH8 A;  5A7C A;  3ZEH A;  4PCI A;  2FSA A;  4NR7 A;  2JZ2 A;  2RJF A;  4DON A;  3NTH A;  4BAC A;  4QVZ A;  4HXS A;  4NRB A;  4ZTJ A;  4QSP A;  4A9O A;  3PNW C;  3QZT A;  3SD4 A;  4O77 A;  3I3J A;  3L42 A;  2M16 A;  5DYA A;  2RNW A;  4HBV A;  2GF7 A;  4C5E A;  4NR8 A;  3IU5 A;  5D6Y A;  4C66 A;  5I1Q A;  4IUT A;  4UIU A;  4Z1Q A;  4E7I A;  5FFV A;  4ALG A;  5D6X A;  2RHU A;  5EQ1 A;  5E9I A;  3OS1 A;  2L84 A;  5CRM A;  5FRO A;  3G0J A;  5EWH A;  5FFW A;  5CFW A;  5A5R A;  3FDR A;  5CQT A;  4QZS A;  4PLL A;  5CQ6 A;  2GFA A;  2RO1 A;  2RHI A;  3SVF A;  4CUP A;  3L2V A;  4IUR A;  4PL6 A;  2DVS A;  2LTO A;  5I80 A;  4A4H A;  2OUO A;  4HBW A;  5H1U A;  3L2Q A;  3PMI A;  5HRW A;  2RJE A;  2XDP A;  4Z6H A;  5EWD A;  5A82 A;  5FH6 A;  4HBX A;  4YC9 A;  5DYC A;  3U5N A;  2BUD A;  2G3R A;  3MEV A;  3DWY A;  4QUU A;  5HEN A;  4A4G A;  5J0D A;  4IOQ A;  1SSF A;  2D82 A;  4LYI A;  5II1 A;  2O4X B;  5ENI A;  5EA1 A;  5EI4 A;  4F3I A;  4Z1S A;  5LKZ A;  5DYX A;  5TCM A;  4B9X A;  5F61 A;  2I8N A;  4LYS A;  4C67 A;  5F25 A;  4HXL A;  3M9Q A;  4HXM A;  3L2U A;  4LC2 A;  5HQ5 A;  4LRG A;  5D26 A;  2RHZ A;  5TB6 A;  5FE7 A;  3DB3 A;  2MWO A;  3OYJ A;  4WHW A;  5COI A;  5HQ6 A;  2E3K A;  3O36 A;  4TYL A;  4HXK A;  4BE0 A;  2I7K A; 
#chains in the Genus database with same CATH topology
 3UPU A;  3CCV T;  4QR3 A;  2VB6 A;  2WAC A;  3H8Z A;  3G6E Q;  2PTK A;  5KCH A;  4QBM A;  2OTL T;  5EIC A;  5GAN 2;  1HYO A;  4PJM A;  1ZUK A;  5AT1 B;  3HSB A;  3X26 B;  2VYT A;  3SVG A;  1YJW Q;  4YYK A;  4WF2 A;  1TUD A;  3G0L A;  4XU3 A;  1VQM A;  1YHQ T;  2LT1 A;  1CKA A;  2LP5 A;  2D9E A;  2M0O A;  3ZBD A;  5K29 A;  1CKB A;  1XQH A;  3CCR T;  3OS0 A;  3RES A;  4N4I A;  3N5B B;  1YJ9 A;  5KYN A;  4ZN3 A;  2JTM A;  4Z88 A;  1V1C A;  3HTR A;  1KG1 A;  1IO6 A;  5F63 A;  1T0J A;  4O76 A;  2LJ0 A;  4A9L A;  4AKH A;  1BIB A;  2NUP A;  2CUD A;  2DLP A;  3OB9 A;  5CKE A;  4NQM A;  2R10 A;  1X27 A;  3U5O A;  1EX4 A;  1QP3 A;  2DVJ A;  4QSU A;  4OB2 B;  3O34 A;  4YBM A;  4MR5 A;  1H92 A;  4UC4 A;  1H3H A;  5FRN A;  3M53 A;  3HP9 A;  4JJD A;  4LYW A;  2F5T X;  4QSW A;  4D8K A;  1PG5 B;  3C4S A;  4DEX A;  3D7S B;  3QZS A;  2O9V A;  4YBT A;  3S92 A;  5CO7 A;  5E9L A;  1UEB A;  4IUU A;  1Q7Y U;  2X4Y A;  2EKO A;  2YT6 A;  4AMC A;  2DX1 A;  1W6X A;  5ENJ A;  2OX7 A;  2M02 A;  4IUV A;  4E7L A;  2FEI A;  3VS6 A;  1WUM A;  2EJN A;  1UGQ B;  1OPL A;  3P8B B;  5FG6 A;  4NRC A;  2KAF A;  4BE2 A;  4XQ3 A;  1VQ6 T;  2PNI A;  4FT4 A;  1Q82 U;  1GXI E;  5HRX A;  3I55 Q;  4YBS A;  2AHJ B;  3GBQ A;  3J80 E;  4CUR A;  4XYA A;  5HKC A;  4YYH A;  3RCW A;  1TSF A;  1KQS A;  2JUF A;  3HMF A;  3ONI A;  4XY8 A;  2HL3 A;  2FRW A;  2M0Y A;  3CCM T;  2E6N A;  4NYV A;  1K9M C;  3MXF A;  1RAI B;  2E5Q A;  3E19 A;  5GAN h;  5M9O A;  4WCI A;  5CKD A;  2XMF A;  2KSS A;  5I7X A;  1QCO A;  2NYS A;  2V8I A;  4E7S A;  2J6F A;  1NJI C;  4C0G A;  2RH2 A;  4BDZ A;  5CQ5 A;  3UWN A;  1E6I A;  4RCC A;  1WHL A;  4M77 B;  3CMA Q;  5FU7 C;  2O9S A;  2JW4 A;  2OO1 A;  1U8R A;  4TU6 A;  2FPE A;  4EPC A;  5DKD A;  1I81 A;  2ROT A;  3LH5 A;  4DBH A;  4FCY A;  1LCK A;  2JN0 A;  2WP2 A;  2C0O A;  4KV4 A;  3RER A;  3PTA A;  1VQ7 A;  3FEO A;  5L8R E;  3KXT A;  1VQ6 Q;  5H1T A;  3H0H A;  4PKL A;  2FZK B;  3G6E T;  3OYL A;  5I89 A;  1M2O A;  2JVV A;  1WLP B;  1GBQ A;  2CGH A;  2KXC A;  1M2V A;  3OW2 S;  4OMP A;  3I55 A;  4O75 A;  2ZPI B;  5LJ5 g;  1KJW A;  3OYB A;  1R0B G;  5HQ7 A;  2BZ8 A;  3I9Q A;  4LNP A;  4GLM A;  5GAM j;  4PJL A;  1BKB A;  4J6W A;  1WFW A;  3M56 A;  5IH2 A;  2NXB A;  3ZL7 C;  4TT2 A;  3G7Z A;  3I55 T;  2CYZ B;  1YJ9 Q;  1D1C A;  2CP7 A;  2KYB A;  1B34 B;  2LQK A;  1Q82 R;  3OYD A;  3CCU A;  5HEL A;  4M77 G;  4RKU E;  3GP8 A;  1WQW A;  3LWH A;  5DFC A;  2DD4 A;  2K5I A;  4LZR A;  3EH2 A;  1M9S A;  2E41 A;  1OPK A;  1RAC B;  4ZGE B;  2EQU A;  2OTL A;  1K0X A;  4QSS A;  5F5Z A;  3JCM b;  5J26 A;  3URG A;  3EHQ A;  3FC3 A;  5HY6 A;  5CZG A;  4QY4 A;  4XTX A;  3M58 A;  5DFD A;  4NUC A;  4HXO A;  4PJO B;  3CC4 Q;  1X0J A;  5EK9 A;  1TUG B;  4L59 A;  4XAX B;  3UA6 A;  4ME7 A;  3V7C A;  2DVV A;  4RG8 A;  5FDZ A;  3EFS A;  1Q86 R;  5C7N A;  4O78 A;  2BIV A;  3JV3 A;  3LQJ A;  5GAM g;  2E7N A;  4CFK A;  5FE8 A;  2GQV A;  2J6K A;  5GAO m;  1MMN A;  4YY4 A;  3O5Z A;  1VQ9 Q;  5FWC A;  4OB3 B;  2RK2 A;  2K4Y A;  4YYJ A;  4HBY A;  1Y71 A;  3S3O A;  3U5M A;  4E2F B;  1KK7 A;  2CUB A;  1AZE A;  5JWM A;  2K3Y A;  2DXC A;  4QB3 A;  4EMK B;  1EQF A;  3HMH A;  1S1N A;  4M77 F;  5ACY A;  2E6Z A;  5KYU B;  1MGQ A;  3M0U A;  1N72 A;  6AT1 B;  5CUG A;  2CP3 A;  4M7D A;  2DEQ A;  4UYG A;  2YEL A;  2DO3 A;  3VS4 A;  3CCS T;  3MP6 A;  4BE1 A;  3EG9 B;  4AFZ C;  2RI2 A;  4OGC A;  1YIT T;  5A85 A;  2GNC A;  2A37 A;  4RTX A;  4RVR A;  2RQV A;  5DKH A;  4O6J A;  4ESR A;  5L98 A;  3CC4 T;  4J3I A;  1QQJ A;  5HCK A;  3UV5 A;  2PZ1 A;  3JCM e;  1BI1 A;  4F7U E;  3CME A;  4QUT A;  4EMH A;  2HNI A;  4TZ2 A;  3BDL A;  2EQK A;  1C0M A;  4MEN A;  1UHC A;  1UHF A;  3FJP A;  5C0M A;  5DLQ E;  3CCS A;  2DBK A;  3AHU A;  3NHN A;  3JCM V;  1JSP B;  2YQD A;  3FB9 A;  5L23 A;  3O35 A;  5H1V A;  2L5Q A;  4M75 F;  4LUE A;  3L1A A;  2DL3 A;  5FE4 A;  3S3M A;  3OYA A;  3EGU A;  3S91 A;  1W2B S;  1N8R C;  5KHM A;  4GBQ A;  4ZQL A;  2EJG A;  5CQ7 A;  1NPP A;  5D3H A;  3MB3 A;  5DW1 A;  1VQN A;  2R57 A;  5GAN j;  2DFU A;  3JCM W;  4LZ2 A;  4CL9 A;  3L2W A;  1J3T A;  5D3R A;  2GGR A;  2W0Z A;  3G4S Q;  1C1A A;  1LOJ A;  3QG1 A;  3MEW A;  8ATC B;  3M59 A;  5A5S A;  5ENE A;  2CP5 A;  2LT4 A;  2MOX A;  1UDL A;  4PJO G;  5FG4 A;  4KCX A;  3LXJ A;  4UIY A;  3CCL Q;  1RAG B;  2XKO C;  5C8G A;  4IUQ A;  1UGP B;  2LJ1 A;  5DKC A;  1P92 A;  3V7R A;  4M77 E;  3U5P A;  2LRQ A;  2YXY A;  3VS3 A;  1UG1 A;  3GOX A;  1PUO A;  5GAM d;  4AT1 B;  2K7A A;  5GAM e;  4E7Z A;  4C8Q C;  4NUD A;  2CSQ A;  4X2I A;  2KK4 A;  1Q7Y C;  2DJZ A;  3OYM A;  1ZSZ C;  1M90 C;  5CUC A;  5CU8 A;  5CGP A;  3NTI A;  4E7K A;  4Q0N A;  1QCN A;  3A8O B;  5D7X A;  2X3X D;  5L8T A;  5GMK j;  2HDA A;  4XY9 A;  2VV5 A;  2BZX A;  1ZS5 A;  2O2O A;  1JBM A;  1IGQ A;  4J6Y A;  1K8A C;  2EWN A;  3A98 A;  4DOV A;  5C6S A;  4MEQ A;  4QEU A;  4TU4 A;  2FPD A;  4ZN1 A;  3P1C A;  1AWX A;  1W2B P;  1YCS B;  2JZ2 A;  1VQN Q;  1JRI A;  2KE9 A;  4A9O A;  3QZT A;  4O77 A;  3I5S A;  3L42 A;  3SWN A;  4LE9 A;  2M16 A;  1Q81 C;  2QGG A;  2RNW A;  1VQO Q;  2JNG A;  2MCN A;  4C66 A;  3CXC S;  2FL7 A;  4Z1Q A;  4E7I A;  4ALG A;  1ARK A;  3M0T A;  2RHU A;  5EQ1 A;  1G3S A;  4M7A G;  2L84 A;  1NEB A;  3G0J A;  5FFW A;  2V8J A;  5CFW A;  4QZS A;  2DK3 A;  1MMA A;  2XHC A;  3HHT B;  3KBG A;  2NWM A;  4PL6 A;  5I80 A;  1D1A A;  1SPK A;  5H1U A;  3PMI A;  1TH7 A;  5FLX E;  4Z6H A;  5EWD A;  5A82 A;  4HBX A;  1UFF A;  4A4K A;  4HVW A;  2COZ A;  1FMK A;  3RMQ A;  1SEM A;  2D82 A;  4J9B A;  5LJ5 h;  1NG2 A;  5EA1 A;  4M78 C;  4BUG A;  2E3H A;  3SFM A;  5TCM A;  4BI4 A;  3JAM E;  4XU1 A;  5DM7 R;  4LC2 A;  2D1X A;  4LRG A;  3CCL T;  4C92 D;  4RMO A;  4R0K A;  2DMO A;  2MWO A;  5COI A;  1NPR A;  5HQ6 A;  1K73 U;  1I8F A;  3CBP A;  4TYL A;  4AG2 C;  1BB9 A;  3Q1J A;  1W4S A;  2K3B A;  5IHI A;  4VUB A;  3KFV A;  5A0G A;  1NBE B;  3TLP A;  2A28 A;  2L5E A;  2N9G A;  3AT1 B;  2LCS A;  3CC2 T;  3QYH B;  1VYT A;  1K4U S;  4Y91 A;  4A9F A;  1X43 A;  5IGL A;  2XG8 D;  4KUI A;  2O88 A;  1N9R A;  1WHH A;  1VQO A;  5AD3 A;  2QQA A;  3O8V A;  5IID A;  1MND A;  2AKK A;  2QEX Q;  2EPD A;  5FE1 A;  5J39 A;  1FMV A;  3A8G B;  1Q81 R;  1IXD A;  3MP8 A;  4QC3 A;  4TT6 A;  2EJ9 A;  2JJ9 A;  3PT9 A;  2DYB A;  2DXT A;  5CKH A;  2CKK A;  1K73 R;  1M4Z A;  3MPU B;  2AZS A;  3MHX A;  4AFS C;  1K9M R;  1RLP C;  4DBQ A;  4A4F A;  4J9F A;  2G4A A;  2WP1 A;  1M2V B;  2CT4 A;  3H0I A;  4YAT A;  4N4G A;  4UYF B;  2YUQ A;  4QQ6 A;  3L2R A;  3CCJ Q;  4II1 A;  1JB0 E;  5KTX A;  1IGU A;  1VQL Q;  2RS9 B;  4UYF A;  2LCC A;  3CCQ A;  1H64 1;  1KHC A;  1BYM A;  1JQQ A;  2RO0 A;  4FLP A;  5CUA A;  5D0C A;  4E47 A;  3H0F A;  5DLZ A;  2EFI A;  2E3I A;  3EGX A;  1W70 A;  3T9N A;  3UVY A;  1EZZ B;  4FL6 A;  4PNO A;  4PKC C;  2OJ2 A;  3M54 A;  7AT1 B;  5D25 A;  1T3L A;  3QZV A;  4Y28 E;  3G71 Q;  5ENC A;  1SF9 A;  3M0R A;  5II2 A;  3ASK A;  4PY6 A;  4PJO F;  3OS2 A;  3CC4 A;  1PWT A;  4BW2 A;  2OSS A;  5FE5 A;  4RCB A;  3D1B A;  3OYC A;  1UGS B;  2KYM A;  4EDU A;  2GTO A;  5G4S A;  5D3T A;  3A8M B;  1JJ2 S;  3CCQ T;  4ZC9 A;  1JU5 C;  2A0F B;  3F70 A;  4Q5W A;  4A54 A;  5GMK i;  3X20 B;  1ABO A;  4J9H A;  1VQP T;  5CRZ A;  1QKX A;  2DVR A;  5KTU A;  5GAM f;  4M7A E;  2DPP B;  2QTV A;  3MKD A;  1OQK A;  1E6H A;  2L3R A;  2EQM A;  3U5K A;  2QGF B;  4JZ4 A;  5GJW B;  3QO3 A;  1WNL A;  3CD6 T;  2K57 A;  1SRL A;  3MUK A;  3UDC A;  2ATC B;  3P1D A;  1ZA1 B;  1VQO T;  2FYK A;  2ESW A;  2DVE A;  3OYK A;  4M7A A;  2KRN A;  2EGA A;  5KE2 A;  1M8M A;  1VIF A;  4QR4 A;  1R0C B;  4V2S A;  1YN8 A;  2YDW A;  1OX9 A;  5EWW A;  1TTH B;  4AI6 A;  1QW1 A;  1PKT A;  5BT5 A;  3GNG A;  2ED0 A;  2JMC A;  4ZW1 A;  4DBR A;  2OTJ Q;  5CQY A;  5A5P A;  5KE3 A;  2LQ8 A;  1VQL A;  1K8A R;  5LKX A;  4J9G A;  1VQM T;  4E7J A;  4IIO A;  2OAW A;  2CSI A;  3M5A A;  3HKS A;  1G2B A;  4IUP A;  5IN1 A;  2QEX A;  2P84 A;  2L85 A;  5HLS A;  2AIR B;  3LGF A;  5GAN e;  3S6W A;  1IHW A;  3OYN A;  1UB4 A;  2PUO B;  1B3Q A;  2X35 A;  4J8O A;  5L8U A;  2AKL A;  3E9F A;  2P4R A;  5F60 A;  4CC4 B;  2KEA A;  1D3B A;  2XDD A;  2PVD B;  3OYE A;  2PVO B;  4LDW A;  1M3B A;  3EH1 A;  5EWV A;  5FH7 A;  4L6V 5;  3VKI A;  1KQS S;  1PD1 A;  4HXJ A;  1KQS P;  3CCE T;  1M30 A;  5IHK A;  2VWF A;  3FIF A;  5IG6 A;  2V1Q A;  2J06 A;  2JS0 A;  3OA6 A;  4OMF B;  1PD0 A;  2GTJ A;  3TU4 K;  4L5G A;  2HAX A;  1VQ5 A;  3KUF A;  5CY9 A;  2L2P A;  3QPH A;  1GFD A;  4PTB A;  2P0P A;  3QXE B;  2F6N A;  3LWI A;  2RK1 A;  5C4Q A;  2ZPB B;  4HA8 A;  5IT9 E;  4X9D A;  3TSW A;  3JCM d;  4QSR A;  2L3S A;  2CZ7 B;  4ZTF A;  4HT9 A;  5A2Q E;  1YFN A;  5GJV B;  5I86 A;  4ZGJ B;  2LX9 A;  4KH0 B;  4HCC A;  3BFM A;  4NOY A;  1G3W A;  2G6F X;  4M7A C;  3CCJ T;  5EPB A;  5CKB A;  1AWW A;  1D3B B;  1YJW T;  2KGT A;  5LUU A;  2RD1 A;  5A5Q A;  1YWO A;  4M77 D;  4J0R A;  4MML A;  3CCM A;  3TRE A;  2DIL A;  1GCP A;  5LJ5 d;  5H85 A;  4O7B A;  1I5O B;  4UYD A;  2QYZ A;  4Q0O A;  4BHW A;  2R5M A;  4ELZ C;  1H3Z A;  1Q81 U;  5CKF A;  4KUL A;  1VUB A;  2MYS A;  1N5Z A;  2CH4 A;  5CQ4 A;  3U5L A;  4D6W A;  4EIK A;  4UIV A;  2XID A;  3I56 A;  4UYE A;  2LSP B;  1TOV A;  5DY9 A;  2LNH B;  4M75 G;  1M3A A;  2RQU A;  4JRK A;  5I29 A;  4J7F A;  4MEP A;  1ZHI A;  5GAO n;  3TEE A;  5L99 A;  1M3C A;  4DBF A;  5E7D A;  3BW1 A;  3ZFJ A;  3E9G A;  3QWX X;  2L3P A;  4CFL A;  5ETB A;  2ED1 A;  2C0T A;  4M7A F;  1Y7X A;  1OOT A;  1WA7 A;  3SEM A;  5HK0 A;  3PGG A;  2DWW A;  3M0Q A;  1OZ2 A;  4J9E A;  2E7O A;  1KHI A;  2VVK A;  1M90 U;  4PJO C;  4A63 B;  2RJD A;  5DY7 A;  1X2Q A;  2E10 A;  4M75 D;  2V8K A;  5KYX A;  4JUV A;  4AG1 C;  3M4Y A;  4KT0 E;  2WSC E;  1NLP C;  2X4J A;  1G3T A;  2JTF A;  4FYY B;  4Y92 A;  4O74 A;  4YTL A;  4JJN K;  3V7S A;  5E0R A;  4MR4 A;  5EPR A;  4MZT A;  1QVG P;  4MMK A;  4KV1 A;  2RNY A;  4KH1 B;  4RTV A;  1VQN T;  3EGX B;  4QT7 A;  2MJV B;  5KYU A;  3FJ5 A;  1HJD A;  4Z6I A;  4DEY A;  1WHM A;  2ROL A;  5E74 A;  1PRM C;  1WPY A;  1AWJ A;  4MDW A;  1WHG A;  1X6O A;  3BDU A;  2Y90 A;  5HFR A;  1VQP A;  5L96 A;  5F1H A;  4J6X A;  1SKU B;  3PFS A;  2FG0 A;  3HL8 A;  4A9M A;  3C94 A;  2EGE A;  3VKH A;  4OML A;  3VRZ A;  3LGL A;  4YYG A;  1ZUU A;  2MPX C;  3CMA A;  5ENG A;  3HRU A;  1QVF P;  2RNX A;  2Z0W A;  4D8D A;  4C92 F;  5FB1 A;  3CCV A;  2DL7 A;  4QYD A;  4OGJ A;  3ULR B;  3D1D A;  1QVP A;  1I1J A;  2RI3 A;  4JJC A;  2K3X A;  2RQR A;  3JCM J;  3UVX A;  1YCY A;  2DZ9 A;  4N3W A;  2YW5 A;  4FYW B;  4RTW A;  4MR6 A;  4ELY C;  1S72 T;  2QQS A;  1WHJ A;  4O5V A;  2NLU A;  4UIT A;  1SHG A;  3R6N A;  4B6M A;  2CRE A;  3ZYU A;  2EKH A;  1MV0 B;  3OW2 P;  3MCA B;  1G83 A;  2YUN A;  1PRL C;  3PVL A;  4LD6 A;  3FKM X;  2XU8 A;  5A0L A;  1X01 A;  2KQW A;  3U5J A;  4ATO A;  4DA4 A;  2KTB B;  1SSH A;  2DJQ A;  3CCU Q;  1TU0 B;  4HCB A;  3IU6 A;  2QXF A;  2JS2 A;  2KI7 A;  2JMA A;  2EYX A;  2GFU A;  3ZEH A;  2ZPE B;  2RJF A;  4DON A;  4BAC A;  1RAA B;  2QAZ A;  2W10 A;  4RTT A;  4PFZ A;  3QDF A;  1MUZ A;  1T3S A;  4EMG A;  2VXE A;  3U23 A;  5DYA A;  2VGN A;  3HFN A;  2K5L A;  3SWN C;  3VS0 A;  1VQP Q;  1KQ2 A;  4UIU A;  2A08 A;  2DF6 A;  4KGZ B;  3OSS C;  3OS1 A;  1Q82 C;  9ATC B;  5AYF A;  4XTY A;  5FRO A;  1Q7Y R;  5A5R A;  2BE9 B;  2RHI A;  1B34 A;  4CUP A;  2F2W A;  3QUI A;  2KVQ G;  4IUR A;  2DXU A;  1M5Q 1;  3QSU A;  4A4H A;  3CBM A;  1B07 A;  2IIM A;  2OUO A;  2YWW A;  4M75 E;  1S72 Q;  2K5F A;  4C0F A;  2QA4 T;  4C0Z A;  2QDL A;  3EHR A;  3M0S A;  4YC9 A;  4KRT A;  2G3R A;  3PIP A;  1JO8 A;  2IPO B;  4IOQ A;  1SSF A;  1N6A A;  4M75 A;  4Z8A A;  4LYI A;  1VQ5 Q;  5ENI A;  2WSF E;  4OMO A;  4F3I A;  5LKZ A;  2XI9 A;  3CC2 Q;  5F61 A;  4LYS A;  4HXL A;  2DKG A;  4C0D C;  1KC8 C;  1YHQ A;  5TB6 A;  3RIR A;  1U3O A;  2RM4 A;  5FE7 A;  3OYJ A;  8AT1 B;  3JCM h;  1NYF A;  2EVR A;  1JJ2 A;  1EIF A;  2E64 A;  4BE0 A;  2I7K A;  4M7A D;  1N8R U;  1ZBJ A;  5ENF A;  1WUG A;  3QBY A;  1WIE A;  2M9U A;  3H41 A;  1UTI A;  4B9W A;  1N27 A;  4XTZ A;  3RDV A;  2FHD A;  3EG2 A;  5FE0 A;  4QVD A;  3UT1 A;  1AOJ A;  1X6B A;  5I83 A;  5GMK h;  2AT1 B;  1MHN A;  1LPL A;  5KYX B;  1QVF A;  3MB4 A;  2PU9 B;  5A83 A;  5EC7 A;  1D1B A;  5GAN f;  5C87 A;  4O71 A;  1WQ7 A;  3MQM A;  5HM0 A;  4BDY A;  3P5O A;  1QWE A;  4C92 B;  1RAF B;  3UW9 A;  2LCL A;  3M0P A;  4HXR A;  3G4S T;  4C5G A;  3CXC A;  4WIV A;  3WVE B;  2E5K A;  3CME Q;  2CZ6 B;  3CCE Q;  1WZO A;  1VQK T;  3V8K A;  2DVQ A;  1GFC A;  4R56 A;  5CQ8 A;  4BD3 A;  4BJX A;  2CDT A;  4M75 B;  2J7I A;  2HQE A;  1VQ4 T;  5HCL A;  2HBW A;  4FYV B;  4J9D A;  2JM9 A;  3CCE A;  5LVR A;  5F62 A;  3BE3 A;  4LDU A;  5CQX A;  2RI7 A;  4TQN A;  5D24 A;  1M90 R;  3NXB A;  1I07 A;  5GAN d;  4PLI A;  1ZBX A;  3A1P A;  3G4S A;  2IVW A;  2YRC A;  4YY6 A;  2BTT A;  4UIW A;  3JB9 H;  1SRM A;  2VUB A;  4OMN A;  2ZAE A;  4JLG A;  3LH0 A;  3PE0 A;  2E70 A;  4RG2 A;  1WJR A;  4J7I A;  4X1V A;  2D0Q B;  3V8J A;  5CUB A;  1RL2 A;  5CAI A;  3QJY A;  2LQW A;  1TUC A;  1VQ9 A;  1GCQ A;  2EAY A;  4C92 E;  1IHV A;  4HVU A;  4BW1 A;  4HKE A;  3JVL A;  4M7D F;  4KBM B;  2RN8 A;  4O70 A;  5D3J A;  5G4R A;  5KH6 A;  3A8H B;  5FU7 B;  5E9Y A;  2PVG B;  3TQ7 P;  2MAM A;  3OYI A;  2L0A A;  1QVG S;  3QJ6 A;  4YK0 A;  1TWB A;  1ZQ1 A;  1VQ9 T;  4BI3 A;  1QCF A;  5IGN A;  5HEM A;  2KDS A;  1M8V A;  1HK9 A;  2RJC A;  1OEB A;  3D7C A;  3QKJ A;  2F6J A;  4M7D B;  2BE7 D;  3EGD B;  2WSE E;  3I56 T;  2DRK A;  1UJ0 A;  2P0Q A;  2YUP A;  3LW5 E;  1QVG A;  5JI8 A;  2D8H A;  2GQI A;  2QAS A;  1S72 A;  2MIO A;  1WHK A;  1K9A A;  4AKG A;  2LX7 A;  1BCM A;  2O31 A;  5IBN A;  4LD9 K;  1R8O B;  4C8Q G;  5CUE A;  1YHQ Q;  4YYN A;  4BW4 A;  3HFO A;  1X69 A;  1YBY A;  4ANJ A;  1IB8 A;  5LKT A;  2A36 A;  1H8K A;  1RAB B;  4QST A;  1U5S A;  3JB9 D;  5GAN 8;  4UIZ A;  2HBP A;  1VQ4 A;  1VQK A;  4AFQ C;  1T0H A;  4M77 A;  2DRM A;  5FE6 A;  1ZX6 A;  5D3S A;  3OYF A;  4YYM A;  2O4X A;  1O9S A;  5CR2 A;  1NJI U;  2PUK B;  3RBB B;  1KFZ A;  1MV3 A;  5DBM A;  4QKU A;  1XJW B;  2F5K A;  4MZP A;  2NUP B;  5IGM A;  3OS5 A;  4P5N A;  1UUE A;  2GCX A;  1YIJ T;  4FYX B;  2KR3 A;  5IHN A;  4A9I A;  1PKS A;  1TS9 A;  3MP1 A;  5EP7 A;  4E6R A;  3OW2 A;  3DB4 A;  1K0S A;  5LJ3 e;  5FFY A;  3RKW A;  2KBT A;  4JRQ A;  4TS8 A;  4C92 C;  5FE9 A;  2KT8 A;  3CMA T;  4PJO A;  4QYL A;  3WXM B;  2QA4 Q;  2EQJ A;  1K76 A;  1MMD A;  5E9V A;  2PQW A;  5D3P A;  3EFR A;  5GAN 6;  2DNU A;  1WJS A;  3HRT A;  1VQ5 T;  4CUT A;  4TZ8 A;  5CP5 A;  2NUT A;  3VV0 A;  5KYW A;  1ZUY A;  2KMT A;  2VC8 A;  5GMK m;  2D9T A;  1Y07 A;  1SHF A;  1OU9 A;  3RUX A;  1A0N B;  5EPS A;  2ZPG B;  2QQ9 A;  4IOR A;  3ER0 A;  1IRE B;  4YAX A;  2EQI A;  3LQH A;  1BBZ A;  2YLC A;  3Q2E A;  3CC7 A;  3OYH A;  3I56 Q;  1JM4 B;  2C06 A;  1KIK A;  4TTE A;  4PS5 A;  1G8X A;  4J5Y A;  5LJ3 j;  3CC2 A;  1PSE A;  3JB9 I;  4QVC A;  3OBW A;  1WGS A;  1ZSG A;  5HJC A;  1YWP A;  2HCK A;  5IXF A;  1K1Z A;  3VYH B;  2OTJ A;  3MJX A;  5CQA A;  5LKU A;  4OF1 A;  1YJ9 T;  2DKW A;  1F68 A;  1X6G A;  2J05 A;  2KT1 A;  3JCM g;  1OX8 A;  2F2X A;  2IG0 A;  2XK0 A;  5F3A A;  1Y57 A;  5I88 A;  2XIC A;  1BI0 A;  1V76 A;  2RA2 A;  4M77 C;  3GF5 A;  1IRX A;  3L2Z A;  2FB7 A;  1WXB A;  1FMW A;  3VUB A;  5E9K A;  4FM4 B;  3GNF B;  5J3B A;  1DJ7 B;  4QEW A;  4DQ2 A;  3UV4 A;  3NPF A;  4XTW A;  5HK3 A;  5AD2 A;  5C89 A;  1K73 C;  4A9E A;  5LJ0 A;  4NR5 A;  4ZNX A;  2A7Y A;  4A9N A;  1RI9 A;  3VYG A;  2J6O A;  1VA7 A;  2LDM A;  5E3D A;  3NTK A;  3VS5 A;  1VQM Q;  1ZKR A;  1NZ9 A;  3G71 T;  2FRY A;  4JS4 A;  3CBO A;  4O7A A;  1WJQ A;  1QLY A;  4YYI A;  4F7U A;  4JZ3 A;  4BI8 B;  1KQ1 A;  1D09 B;  1RAH B;  2LVM A;  4LDY A;  5FBX A;  1X75 C;  4IR3 A;  2FO0 A;  3VS2 A;  1KD1 U;  1VQK Q;  3O37 A;  3CME T;  2D6F A;  4FU6 A;  1XNI A;  5ENB A;  2K2V A;  4OB1 B;  1YI2 T;  3LJW A;  3HPW A;  4Y03 A;  4FW2 A;  2HMA A;  1G5V A;  1X2K A;  2K79 A;  5CS8 A;  2LJ3 A;  1U06 A;  4LR6 A;  1G3Y A;  1VOM A;  2K6D A;  1VQ8 A;  1D0Y A;  3JB9 F;  2DER A;  3V8L A;  3IQL A;  3OYY A;  2R0S A;  4JPB W;  4M7D D;  5DYU A;  2R58 A;  2RNA A;  1N9S A;  3SWN B;  1W1F A;  1ACM B;  1GCQ C;  1W2B A;  1E6G A;  4N4F A;  5CUD A;  3P8D A;  1ZA2 B;  4OGE A;  3RKY A;  2CP2 A;  3FLG A;  5LJ5 e;  4PFP A;  2RHY A;  1D0Z A;  4OGI A;  1RI0 A;  2YLB A;  4YYD A;  2QI2 A;  4C5I A;  5GAO l;  2HZY A;  1AT1 B;  4PK4 A;  5DLO A;  2X4X A;  4NS5 A;  5CQ3 A;  2HL5 C;  2DIQ A;  1AHJ B;  1FWZ A;  5ENH A;  3UV2 A;  1YNZ A;  2DET A;  4IR4 A;  1FYN A;  5D3L A;  4LDX A;  4O72 A;  1UGV A;  4QSV A;  1BIA A;  2R5A A;  1U1S A;  3NGP A;  4QR5 A;  3VJP A;  4UIX A;  4XU2 A;  1QWF A;  5F36 A;  4O7C A;  1F1B B;  2R0V A;  2CS7 A;  2MMP A;  3OMG A;  1VQ7 Q;  2H3J A;  4NYW A;  1C6V X;  5HRV A;  4F17 A;  2EBP A;  3JB9 J;  1OYX A;  1CSK A;  3HME A;  1Q86 U;  3JSC A;  1M1K R;  5KTW A;  1VQL T;  5EWC A;  4KGX B;  4IKF A;  5FH8 A;  2C0I A;  2RB6 A;  4NR7 A;  2L3Q A;  4QVZ A;  4NRB A;  4ZTJ A;  4QSP A;  2QDY B;  2JXB A;  3SD4 A;  3I3J A;  2GF7 A;  4C5E A;  2KRO A;  4NR8 A;  3IU5 A;  1V29 B;  5D6Y A;  4IUT A;  3SB2 A;  1Q86 C;  4F7U G;  5GAO p;  2D0N A;  3M4G A;  1ZLM A;  3RNJ A;  5EWH A;  5CQT A;  5CQ6 A;  3SVF A;  3L2V A;  3PIO A;  3SDZ A;  2DVS A;  5FU6 B;  1R77 A;  2XDB A;  1GBR A;  2RJE A;  2XDP A;  1VQ8 Q;  5FH6 A;  3U5N A;  2BUD A;  3MEV A;  2QA4 A;  3DWY A;  4QUU A;  1Y96 A;  3CPF A;  2QQB A;  5FWB A;  2X51 A;  4BY6 B;  3E2U A;  4RTY A;  1I4K 1;  5EI4 A;  5DYX A;  5GAN 5;  4B9X A;  2I8N A;  4C67 A;  5F25 A;  3HRS A;  3M9Q A;  1YIJ Q;  1LJO A;  1JJ2 P;  4JS5 A;  5I11 A;  1JEG A;  2VAS A;  2E3K A;  3O36 A;  4M78 F;  2NUZ A;  3QYG B;  2P4T A;  4M7D E;  1PC0 A;  4QSQ A;  1YJN Q;  1AVZ C;  4Z02 A;  3EFO A;  2DYI A;  5DLX A;  2AZV A;  2HD0 A;  4O7E A;  2CT3 A;  5E9M A;  3QWY A;  4ORZ A;  3FRN A;  1YI2 Q;  4KUD K;  3UVD A;  2DL8 A;  3JCM f;  4EMK C;  5IAY A;  2MWP A;  1WXT A;  2MF2 A;  2K2M A;  3J7A F;  2YHT A;  3LQI A;  3REB B;  3OBY A;  5GAN 4;  3CC7 Q;  4AKN A;  2FVU A;  2NUT B;  2QK0 A;  2KRM A;  4WHU A;  5KCO A;  4J0S A;  4K11 A;  4J1P A;  1UEC A;  1NYG A;  4LDV A;  3P1F A;  2LZ6 B;  4Z93 A;  1QKW A;  4LDF A;  2L8D A;  4XK8 E;  3SHW A;  5HFQ A;  1EFN A;  3X28 B;  5LJ2 A;  3JVM A;  3VS7 A;  2MI6 A;  1VIE A;  4QQG A;  4M7D C;  2DBM A;  2HQX A;  3SVH A;  2ENM A;  4NR6 A;  4A9J A;  4Z89 A;  2YUO A;  2F2V A;  2QEX T;  2E12 A;  3I35 A;  2LMJ A;  3CCU T;  2BKD N;  3G71 A;  1BK2 A;  3UA7 A;  3G6E A;  4XU0 A;  4QC1 A;  2DD5 A;  4C0D B;  5FRM A;  3PMT A;  1MMG A;  2DAT A;  3JCM c;  4J9I A;  4NR4 A;  2B86 A;  4TVR A;  1MNE A;  4PJJ A;  2VGM A;  5DFB A;  2GRC A;  4LXC A;  4XTU A;  3VU3 C;  4C92 A;  2H8H A;  5A5N A;  2LC4 A;  4PJO E;  3K2J A;  1PM3 A;  4M7A B;  4NQN A;  4GPJ A;  1VQ6 A;  4ZGD B;  4QNS A;  5EM3 A;  5KYW B;  4FT2 A;  4CLB A;  4HXN A;  1UE9 A;  3CCS Q;  1KC8 U;  2DIG A;  2JTE A;  1AWO A;  2DAQ A;  2CH4 W;  4CC7 A;  2OTJ T;  3CCV Q;  1AEY A;  2YRV A;  1M1K C;  4JDS A;  4M4Z A;  4UYH A;  1Z9Z A;  4C5H A;  2HKN A;  4ALH A;  5LVQ A;  1SG5 A;  1RUW A;  5FB0 A;  4MZM A;  3C12 A;  1QVF S;  5I40 A;  1YJW A;  3VKG A;  2AK5 A;  3NFC A;  4M75 C;  3CCJ A;  4PJO D;  2E1H A;  1IZ6 A;  4XUA A;  1GL5 A;  3UVW A;  3S3N A;  3VUZ A;  3OSV A;  4YAB A;  2RHX A;  2YYN A;  3CCR Q;  2V26 A;  2EIF A;  4M78 G;  5LJ3 h;  5CTL A;  1I5L A;  4F04 B;  4NUE A;  2HQH A;  4WTO B;  2H60 A;  1FX7 A;  4NXJ A;  2ZPH B;  3J81 E;  2RF0 A;  5EU1 A;  4OUF A;  2LNV A;  3RMS A;  4CUQ A;  2Y4Y A;  3OQ5 A;  3LX7 A;  4HVV A;  4E7H A;  1NE8 A;  2YSQ A;  1OUL A;  5I21 A;  5GAO q;  5D6W A;  1BI2 A;  3JB9 G;  1HXD A;  1YIT A;  2E4H A;  2EGC A;  3CQT A;  5ETD A;  3INZ A;  5KO4 A;  4C92 G;  2RQT A;  2QQR A;  2DXB A;  5GMK l;  4M78 D;  1K9M U;  5KYY B;  4HT8 A;  5CPE A;  3CD6 Q;  4C8Q F;  4A9K A;  5LJ5 f;  4OVA A;  5L97 A;  2SEM A;  4OB0 B;  2YEM A;  2Y4X A;  3JVJ A;  1BI3 A;  4OMQ A;  3X24 B;  4F16 A;  3OMC A;  4RTZ A;  1M1F A;  4F7U F;  5E3G A;  5AME A;  1KD1 R;  3MUL A;  1B7T A;  5FE3 A;  3EG3 A;  3AAD A;  1M1K U;  2RMO A;  5LJ5 j;  2RFJ A;  4A9H A;  3H6Z A;  4F7U B;  2CP0 A;  3GPL A;  5LJ3 f;  4PCE A;  1QP2 A;  4NYX A;  4QSX A;  1WI7 A;  2D8J A;  1JXO A;  3M57 A;  4FW1 A;  2V1R A;  1NJI R;  2XD0 A;  5D3N A;  5LJ1 A;  4BY6 C;  4HCZ A;  2FPF A;  4LZS A;  2DTO A;  2EYW A;  2KXD A;  2X3W D;  4CI0 C;  4BW3 A;  1U1T A;  5GAN 3;  4C8Q E;  1PNJ A;  4M7D G;  3P1E A;  1NM7 A;  3REA B;  1XTD A;  3GG3 A;  3DKM A;  1WYX A;  5I7Y A;  2X4W A;  4A4E A;  1M1G A;  3A8L B;  3EG9 A;  1WX6 A;  3JCM Q;  1PSF A;  2H3E B;  2HSE B;  3UAT A;  4JJB A;  3H9N A;  3CCL A;  4F14 A;  3JCM X;  2ECZ A;  3EG1 A;  4X34 A;  2ZZD A;  3P8H A;  1AZG B;  1OV3 A;  4X9C A;  4NRA A;  4NL3 A;  1VYU A;  3CC7 T;  1XOV A;  4HXP A;  2COW A;  3OY9 A;  3TVT A;  4QQD A;  3CD6 A;  2YDL A;  2HKQ B;  2DL5 A;  2ZCF B;  1VYV A;  5CCA A;  3MEA A;  1VQ7 T;  2R0Y A;  4NR9 A;  4C8Q D;  1LNX A;  1YJN A;  3WVD B;  4JRI A;  2CP6 A;  2FZC B;  1PCX A;  2DTI A;  3ME9 A;  1ZSZ A;  3LYI A;  1UGR B;  4A53 A;  5EVA A;  2DA9 A;  1E7O A;  2GBQ A;  4RUG A;  4J83 A;  1K8A U;  4CUS A;  5F2P A;  1M27 C;  4XUB A;  4CUU A;  5I22 A;  5D7U A;  3CCM Q;  5IGK A;  1FXX A;  5EG2 A;  2X9H A;  4JLI A;  1I0C A;  3THK A;  4TT4 A;  2DM1 A;  1RAE B;  5KU3 A;  5I2S A;  4HCK A;  3JVK A;  5FU6 C;  3TSZ A;  1WXU A;  5ECA A;  4IR6 A;  4CC3 A;  2I2L A;  5CIU A;  2DTH A;  1ABQ A;  2DZC A;  3BY7 A;  4PJN A;  4KGV B;  4JRP A;  2KRS A;  5EGU A;  4M78 E;  4QW2 A;  4IIM A;  2RI5 A;  2B8A A;  2O01 E;  5DX4 A;  3CCR A;  2ZPF B;  4DOW A;  2EYZ A;  3GIB A;  4M78 A;  2ZGW A;  3EFO B;  3CPW P;  5LJ3 d;  4MEO A;  5GAN 7;  4MR3 A;  3PVQ A;  4FSS A;  1Q95 G;  2DE0 X;  4R55 A;  5F1L A;  3QII A;  2OAU A;  5GMK e;  3MET A;  4XTV A;  5GAN g;  1YP5 A;  1QMC A;  2LQN A;  4PFO A;  1KC8 R;  2CZ1 B;  5A81 A;  5FE2 A;  2A3L A;  3CPW S;  2P0K A;  5A5O A;  2F69 A;  3O33 A;  1RLQ C;  3QZ9 B;  3DAI A;  3RKX A;  4BB7 A;  4LUD A;  2VKN A;  3JRZ A;  4YH4 A;  4GLK A;  4IOO A;  1OZ3 A;  1YI2 A;  3C0C A;  2JOY A;  1JXM A;  4N0A C;  2ABL A;  2RPN A;  1ZSZ B;  2SRC A;  3MO8 A;  5CK9 A;  3TCJ A;  3CCQ Q;  1Z9Q A;  3CPW A;  1N8R R;  3UF4 A;  2VXF A;  1D0X A;  2M1H A;  4RTU A;  4YAD A;  2EYQ A;  1TG0 A;  3ERR A;  4QEV A;  3MEU A;  3I5R A;  3R6O A;  3X25 B;  2QG9 B;  2CZ0 B;  5KYY A;  5EIS A;  2YEK A;  3QZ5 B;  1TXQ A;  4CRI A;  2K9G A;  5DW2 A;  2EJF A;  3E1S A;  5EV9 A;  5AMF A;  1KD1 C;  5BT4 A;  1LVK A;  4E96 A;  1HSQ A;  1YJN T;  4N4H A;  3CEY A;  3QHS A;  4GY5 A;  5BT3 A;  4EMK A;  4YH3 A;  4LN2 A;  4OMM A;  3A5Z B;  1UJY A;  4O7F A;  4AFU C;  3DLL A;  1RAD B;  3C95 A;  3M55 A;  1GRI A;  4FIB A;  1AD5 A;  5C85 A;  3EG0 A;  4M78 B;  1NLO C;  5E73 A;  1OI1 A;  2YRD A;  3EAE A;  2L89 A;  3LLR A;  2EYY A;  1BCO A;  1Y0M A;  3DLM A;  4IR5 A;  2F1L A;  3NMZ C;  3AQA A;  2I0N A;  3OYG A;  3Q2F A;  5FG5 A;  3RR6 A;  5A7C A;  2BZY A;  4J9C A;  4PCI A;  2FSA A;  2KNB B;  2MK5 A;  1VQ4 Q;  1NEG A;  2E65 A;  3NTH A;  4HXS A;  5LJ3 g;  1KSW A;  4C8Q A;  3PNW C;  2HEQ A;  3G1J A;  4OP0 A;  4AKI A;  4HBV A;  5I1Q A;  2OTL Q;  5FFV A;  5D6X A;  5E9I A;  5A0D A;  1Y96 B;  5CRM A;  3FDR A;  5CVI A;  2KY9 A;  1YIJ A;  4PLL A;  2DL4 A;  2GFA A;  2RO1 A;  3VRY A;  5IXB A;  2LTO A;  3QDR B;  4HBW A;  3L2Q A;  1YIT Q;  2JM8 A;  5HRW A;  3VS1 A;  3JCM P;  2EW3 A;  1BU1 A;  1PHT A;  2FZG B;  5GAM h;  5DYC A;  4NL2 A;  5HEN A;  4A4G A;  2OI3 A;  5J0D A;  3EGD A;  1WDX A;  5II1 A;  2O4X B;  4N0A A;  1HD3 A;  2COY A;  2QTX A;  4Z1S A;  2JT4 A;  2DEU A;  4FSX A;  3L2U A;  4CC2 A;  4HXM A;  1OU8 A;  5HQ5 A;  2RHZ A;  5D26 A;  5I2M A;  5GAO r;  3CXC P;  5FW9 A;  1O75 A;  4C8Q B;  5LL6 S;  1VQ8 T;  3DB3 A;  2RQW A;  3GLX A;  4WHW A;  4MDX A;  4HXK A;  2HSP A;  2M51 A; 
#chains in the Genus database with same CATH homology
 3UPU A;  3CCV T;  4QR3 A;  2WAC A;  3H8Z A;  5KCH A;  4QBM A;  2OTL T;  5EIC A;  5GAN 2;  3HSB A;  3X26 B;  2VYT A;  3SVG A;  4YYK A;  4WF2 A;  3G0L A;  4XU3 A;  1VQM A;  1YHQ T;  2LT1 A;  2D9E A;  2M0O A;  3ZBD A;  5K29 A;  1XQH A;  3CCR T;  3OS0 A;  3RES A;  4N4I A;  3N5B B;  1YJ9 A;  4ZN3 A;  2JTM A;  1KG1 A;  5F63 A;  4O76 A;  4A9L A;  1BIB A;  3OB9 A;  5CKE A;  4NQM A;  2R10 A;  3U5O A;  1QP3 A;  4OB2 B;  4QSU A;  3O34 A;  4YBM A;  4MR5 A;  4UC4 A;  5FRN A;  3M53 A;  3HP9 A;  4LYW A;  2F5T X;  4QSW A;  3C4S A;  3QZS A;  4YBT A;  3S92 A;  5CO7 A;  5E9L A;  1UEB A;  4IUU A;  1Q7Y U;  2X4Y A;  2EKO A;  5ENJ A;  4IUV A;  4E7L A;  1WUM A;  1UGQ B;  3P8B B;  5FG6 A;  4NRC A;  2KAF A;  4BE2 A;  4XQ3 A;  1VQ6 T;  1Q82 U;  4FT4 A;  1GXI E;  5HRX A;  4YBS A;  2AHJ B;  3J80 E;  4CUR A;  4XYA A;  5HKC A;  4YYH A;  3RCW A;  1KQS A;  2JUF A;  3HMF A;  3ONI A;  4XY8 A;  3CCM T;  2E6N A;  4NYV A;  1K9M C;  3MXF A;  2E5Q A;  3E19 A;  5GAN h;  5M9O A;  5CKD A;  2KSS A;  5I7X A;  2V8I A;  1NJI C;  4C0G A;  2RH2 A;  4BDZ A;  5CQ5 A;  3UWN A;  1E6I A;  4RCC A;  4M77 B;  5FU7 C;  2OO1 A;  1U8R A;  4TU6 A;  4EPC A;  5DKD A;  1I81 A;  2JN0 A;  2WP2 A;  4KV4 A;  3RER A;  3PTA A;  1VQ7 A;  3FEO A;  5L8R E;  3KXT A;  5H1T A;  4PKL A;  3G6E T;  3OYL A;  5I89 A;  2JVV A;  2CGH A;  3OW2 S;  3I55 A;  4O75 A;  2ZPI B;  5LJ5 g;  3OYB A;  5HQ7 A;  5GAM j;  1BKB A;  4J6W A;  3M56 A;  2NXB A;  4TT2 A;  3G7Z A;  3I55 T;  2CYZ B;  1B34 B;  2LQK A;  3OYD A;  3CCU A;  5HEL A;  4M77 G;  4RKU E;  3GP8 A;  1WQW A;  3LWH A;  5DFC A;  2DD4 A;  2K5I A;  4LZR A;  1M9S A;  2E41 A;  4ZGE B;  2EQU A;  2OTL A;  4QSS A;  5F5Z A;  3JCM b;  5J26 A;  3URG A;  3FC3 A;  5HY6 A;  5CZG A;  4QY4 A;  4XTX A;  3M58 A;  5DFD A;  4NUC A;  4HXO A;  4PJO B;  1X0J A;  5EK9 A;  4L59 A;  4XAX B;  4ME7 A;  3V7C A;  2DVV A;  4RG8 A;  5FDZ A;  3EFS A;  5C7N A;  4O78 A;  2BIV A;  5GAM g;  3LQJ A;  2E7N A;  4CFK A;  5FE8 A;  2GQV A;  5GAO m;  4YY4 A;  4OB3 B;  2RK2 A;  2K4Y A;  4YYJ A;  4HBY A;  1Y71 A;  3S3O A;  3U5M A;  5JWM A;  2K3Y A;  2DXC A;  4QB3 A;  4EMK B;  1EQF A;  3HMH A;  4M77 F;  5ACY A;  2E6Z A;  1MGQ A;  1N72 A;  5CUG A;  4M7D A;  2DEQ A;  4UYG A;  2YEL A;  2DO3 A;  3CCS T;  3MP6 A;  4BE1 A;  2RI2 A;  4OGC A;  1YIT T;  5A85 A;  4RVR A;  5DKH A;  4O6J A;  5L98 A;  3CC4 T;  4J3I A;  3UV5 A;  3JCM e;  1BI1 A;  4F7U E;  3CME A;  4QUT A;  4EMH A;  2HNI A;  4TZ2 A;  3BDL A;  2EQK A;  4MEN A;  3FJP A;  5C0M A;  5DLQ E;  3CCS A;  3AHU A;  3JCM V;  1JSP B;  2YQD A;  3FB9 A;  3O35 A;  5H1V A;  2L5Q A;  4M75 F;  3L1A A;  5FE4 A;  3S3M A;  3OYA A;  3S91 A;  1W2B S;  1N8R C;  5KHM A;  4ZQL A;  2EJG A;  5CQ7 A;  1NPP A;  5D3H A;  3MB3 A;  5DW1 A;  1VQN A;  2R57 A;  5GAN j;  3JCM W;  4LZ2 A;  4CL9 A;  3L2W A;  5D3R A;  1LOJ A;  3QG1 A;  3MEW A;  3M59 A;  5A5S A;  5ENE A;  2LT4 A;  4PJO G;  5FG4 A;  4KCX A;  3LXJ A;  4UIY A;  2XKO C;  5C8G A;  4IUQ A;  1UGP B;  5DKC A;  1P92 A;  3V7R A;  4M77 E;  3U5P A;  2LRQ A;  3GOX A;  5GAM d;  5GAM e;  4C8Q C;  4NUD A;  4X2I A;  2KK4 A;  1Q7Y C;  2DJZ A;  3OYM A;  1M90 C;  5CUC A;  5CU8 A;  5CGP A;  3NTI A;  4E7K A;  4Q0N A;  3A8O B;  5D7X A;  5L8T A;  5GMK j;  4XY9 A;  2VV5 A;  1ZS5 A;  1JBM A;  4J6Y A;  1K8A C;  2EWN A;  4DOV A;  5C6S A;  4MEQ A;  4QEU A;  4TU4 A;  4ZN1 A;  3P1C A;  2JZ2 A;  1JRI A;  4A9O A;  3QZT A;  4O77 A;  3L42 A;  3SWN A;  2M16 A;  1Q81 C;  2RNW A;  2JNG A;  4C66 A;  3CXC S;  2FL7 A;  4Z1Q A;  4E7I A;  4ALG A;  2RHU A;  5EQ1 A;  1G3S A;  4M7A G;  2L84 A;  3G0J A;  5FFW A;  2V8J A;  5CFW A;  4QZS A;  2DK3 A;  2XHC A;  3HHT B;  3KBG A;  4PL6 A;  5I80 A;  5H1U A;  3PMI A;  1TH7 A;  5FLX E;  4Z6H A;  5EWD A;  5A82 A;  4HBX A;  4A4K A;  3RMQ A;  2D82 A;  5LJ5 h;  5EA1 A;  4M78 C;  4BUG A;  3SFM A;  5TCM A;  4BI4 A;  3JAM E;  4XU1 A;  5DM7 R;  4LC2 A;  4LRG A;  3CCL T;  4C92 D;  4RMO A;  2MWO A;  5COI A;  1NPR A;  5HQ6 A;  1K73 U;  1I8F A;  3CBP A;  4TYL A;  3Q1J A;  1W4S A;  4VUB A;  5A0G A;  3TLP A;  2L5E A;  2N9G A;  3CC2 T;  3QYH B;  4Y91 A;  4A9F A;  5IGL A;  2XG8 D;  4KUI A;  1N9R A;  1VQO A;  5AD3 A;  2QQA A;  3O8V A;  5IID A;  5FE1 A;  5J39 A;  3A8G B;  3MP8 A;  4QC3 A;  4TT6 A;  2EJ9 A;  3PT9 A;  2DXT A;  5CKH A;  2CKK A;  1M4Z A;  3MHX A;  4A4F A;  2G4A A;  2WP1 A;  4YAT A;  4N4G A;  4UYF B;  4QQ6 A;  3L2R A;  4II1 A;  1JB0 E;  5KTX A;  2RS9 B;  4UYF A;  2LCC A;  3CCQ A;  1H64 1;  1KHC A;  1BYM A;  2RO0 A;  4FLP A;  5CUA A;  5D0C A;  4E47 A;  5DLZ A;  2EFI A;  3T9N A;  3UVY A;  4PNO A;  4FL6 A;  4PKC C;  3M54 A;  5D25 A;  3QZV A;  4Y28 E;  5ENC A;  5II2 A;  3ASK A;  4PY6 A;  4PJO F;  3OS2 A;  3CC4 A;  4BW2 A;  2OSS A;  5FE5 A;  4RCB A;  3OYC A;  1UGS B;  4EDU A;  5G4S A;  5D3T A;  3A8M B;  1JJ2 S;  3CCQ T;  4ZC9 A;  4Q5W A;  3F70 A;  4A54 A;  5GMK i;  3X20 B;  1VQP T;  5CRZ A;  2DVR A;  5KTU A;  5GAM f;  4M7A E;  2DPP B;  2L3R A;  2EQM A;  3U5K A;  3QO3 A;  1WNL A;  3CD6 T;  2K57 A;  3MUK A;  3UDC A;  3P1D A;  1VQO T;  2FYK A;  2DVE A;  3OYK A;  4M7A A;  5KE2 A;  1VIF A;  4QR4 A;  4V2S A;  2YDW A;  5EWW A;  1QW1 A;  5BT5 A;  3GNG A;  4ZW1 A;  5CQY A;  5A5P A;  5KE3 A;  2LQ8 A;  1VQL A;  5LKX A;  1VQM T;  4E7J A;  3M5A A;  3HKS A;  4IUP A;  5IN1 A;  2QEX A;  2L85 A;  5HLS A;  5GAN e;  3LGF A;  3S6W A;  3OYN A;  1UB4 A;  2PUO B;  2X35 A;  4J8O A;  5L8U A;  3E9F A;  5F60 A;  1D3B A;  2XDD A;  2PVD B;  3OYE A;  2PVO B;  4LDW A;  5EWV A;  5FH7 A;  4L6V 5;  3VKI A;  1KQS S;  3CCE T;  3FIF A;  5IG6 A;  3OA6 A;  4OMF B;  3TU4 K;  4L5G A;  2HAX A;  1VQ5 A;  3KUF A;  5CY9 A;  3QPH A;  4PTB A;  2P0P A;  3QXE B;  2F6N A;  3LWI A;  2RK1 A;  5C4Q A;  2ZPB B;  4HA8 A;  5IT9 E;  4X9D A;  3JCM d;  4QSR A;  2CZ7 B;  4ZTF A;  4HT9 A;  5A2Q E;  4ZGJ B;  5I86 A;  2LX9 A;  4HCC A;  3BFM A;  4NOY A;  1G3W A;  4M7A C;  3CCJ T;  5EPB A;  5CKB A;  1D3B B;  1YJW T;  5LUU A;  2RD1 A;  5A5Q A;  4M77 D;  4J0R A;  4MML A;  3CCM A;  3TRE A;  5LJ5 d;  5H85 A;  4O7B A;  4UYD A;  4Q0O A;  4BHW A;  2R5M A;  4ELZ C;  1H3Z A;  1Q81 U;  5CKF A;  4KUL A;  1VUB A;  5CQ4 A;  3U5L A;  4D6W A;  4UIV A;  2XID A;  3I56 A;  4UYE A;  2LSP B;  5DY9 A;  4M75 G;  4JRK A;  5I29 A;  4J7F A;  4MEP A;  1ZHI A;  5GAO n;  3TEE A;  5L99 A;  5E7D A;  3BW1 A;  3ZFJ A;  3E9G A;  4CFL A;  5ETB A;  4M7A F;  1Y7X A;  5HK0 A;  3PGG A;  2DWW A;  1OZ2 A;  2E7O A;  1KHI A;  1M90 U;  4PJO C;  2RJD A;  5DY7 A;  4M75 D;  2E10 A;  2V8K A;  4JUV A;  3M4Y A;  4KT0 E;  2WSC E;  2X4J A;  1G3T A;  2JTF A;  4O74 A;  4YTL A;  4JJN K;  3V7S A;  5E0R A;  4MR4 A;  4MZT A;  5EPR A;  4MMK A;  4KV1 A;  2RNY A;  1VQN T;  2MJV B;  4Z6I A;  5E74 A;  1WPY A;  4MDW A;  1X6O A;  3BDU A;  2Y90 A;  5HFR A;  1VQP A;  5L96 A;  5F1H A;  4J6X A;  3PFS A;  3HL8 A;  4A9M A;  3C94 A;  3LGL A;  4YYG A;  3CMA A;  5ENG A;  3HRU A;  2RNX A;  4C92 F;  5FB1 A;  3CCV A;  4QYD A;  4OGJ A;  1QVP A;  2RI3 A;  2K3X A;  3JCM J;  3UVX A;  1YCY A;  4N3W A;  2DZ9 A;  2YW5 A;  4MR6 A;  4ELY C;  1S72 T;  2QQS A;  4O5V A;  2NLU A;  4UIT A;  3ZYU A;  3MCA B;  4LD6 A;  3FKM X;  2XU8 A;  5A0L A;  1X01 A;  2KQW A;  3U5J A;  4ATO A;  4DA4 A;  2KTB B;  4HCB A;  3IU6 A;  2QXF A;  2GFU A;  3ZEH A;  2ZPE B;  2RJF A;  4DON A;  4BAC A;  4EMG A;  2VXE A;  5DYA A;  3HFN A;  2VGN A;  2K5L A;  3SWN C;  1KQ2 A;  4UIU A;  3OSS C;  3OS1 A;  1Q82 C;  5FRO A;  5AYF A;  4XTY A;  5A5R A;  2RHI A;  1B34 A;  4CUP A;  3QUI A;  2KVQ G;  4IUR A;  2DXU A;  1M5Q 1;  3QSU A;  4A4H A;  3CBM A;  2OUO A;  4M75 E;  2K5F A;  4C0F A;  2QA4 T;  4C0Z A;  4YC9 A;  2G3R A;  3PIP A;  4IOQ A;  1SSF A;  1N6A A;  4M75 A;  4LYI A;  5ENI A;  2WSF E;  4F3I A;  5LKZ A;  2XI9 A;  5F61 A;  4LYS A;  4HXL A;  2DKG A;  4C0D C;  1KC8 C;  1YHQ A;  5TB6 A;  3RIR A;  2RM4 A;  5FE7 A;  3OYJ A;  3JCM h;  1JJ2 A;  2E64 A;  1EIF A;  4BE0 A;  2I7K A;  4M7A D;  1N8R U;  5ENF A;  1WUG A;  3QBY A;  2M9U A;  4B9W A;  1N27 A;  4XTZ A;  2FHD A;  5FE0 A;  4QVD A;  3UT1 A;  5I83 A;  5GMK h;  1MHN A;  1QVF A;  3MB4 A;  2PU9 B;  5A83 A;  5GAN f;  5C87 A;  4O71 A;  1WQ7 A;  3MQM A;  5HM0 A;  4BDY A;  3P5O A;  4C92 B;  3UW9 A;  2LCL A;  4HXR A;  3G4S T;  4C5G A;  3CXC A;  4WIV A;  3WVE B;  2CZ6 B;  1VQK T;  3V8K A;  2DVQ A;  4R56 A;  5CQ8 A;  4BD3 A;  4BJX A;  4M75 B;  2HQE A;  1VQ4 T;  5HCL A;  3CCE A;  5LVR A;  5F62 A;  4LDU A;  5CQX A;  2RI7 A;  4TQN A;  5D24 A;  3NXB A;  5GAN d;  4PLI A;  1ZBX A;  3G4S A;  2IVW A;  4YY6 A;  4UIW A;  3JB9 H;  2VUB A;  4JLG A;  3LH0 A;  2E70 A;  4RG2 A;  1WJR A;  4J7I A;  2D0Q B;  3V8J A;  5CUB A;  1RL2 A;  5CAI A;  3QJY A;  1VQ9 A;  2EAY A;  4C92 E;  4BW1 A;  4HKE A;  3JVL A;  4M7D F;  4KBM B;  4O70 A;  5D3J A;  5G4R A;  5KH6 A;  3A8H B;  5FU7 B;  5E9Y A;  2PVG B;  3OYI A;  2MAM A;  1QVG S;  3QJ6 A;  4YK0 A;  1ZQ1 A;  1VQ9 T;  4BI3 A;  5IGN A;  5HEM A;  2KDS A;  1M8V A;  1HK9 A;  2RJC A;  3D7C A;  3QKJ A;  2F6J A;  4M7D B;  2WSE E;  3I56 T;  2P0Q A;  3LW5 E;  1QVG A;  5JI8 A;  1S72 A;  4LD9 K;  5IBN A;  4C8Q G;  1R8O B;  5CUE A;  4YYN A;  4BW4 A;  3HFO A;  1YBY A;  5LKT A;  4QST A;  3JB9 D;  1VQ4 A;  5GAN 8;  4UIZ A;  2HBP A;  1VQK A;  4M77 A;  5FE6 A;  5D3S A;  3OYF A;  4YYM A;  2O4X A;  1O9S A;  5CR2 A;  1NJI U;  2PUK B;  5DBM A;  2F5K A;  4MZP A;  3OS5 A;  5IGM A;  4P5N A;  2GCX A;  1YIJ T;  4A9I A;  3MP1 A;  5EP7 A;  3OW2 A;  3DB4 A;  5LJ3 e;  5FFY A;  3RKW A;  4JRQ A;  4TS8 A;  4C92 C;  5FE9 A;  3CMA T;  4PJO A;  4QYL A;  3WXM B;  2EQJ A;  5E9V A;  2PQW A;  5D3P A;  3EFR A;  5GAN 6;  3HRT A;  1WJS A;  1VQ5 T;  4CUT A;  4TZ8 A;  5CP5 A;  3VV0 A;  2KMT A;  2VC8 A;  5GMK m;  2D9T A;  1Y07 A;  3RUX A;  5EPS A;  2ZPG B;  2QQ9 A;  4IOR A;  3ER0 A;  1IRE B;  4YAX A;  3LQH A;  2YLC A;  3Q2E A;  3CC7 A;  3OYH A;  2C06 A;  1JM4 B;  4TTE A;  4PS5 A;  4J5Y A;  5LJ3 j;  3CC2 A;  1PSE A;  3JB9 I;  4QVC A;  3OBW A;  1WGS A;  5HJC A;  3VYH B;  2OTJ A;  5CQA A;  5LKU A;  4OF1 A;  1YJ9 T;  2DKW A;  1F68 A;  3JCM g;  2IG0 A;  2XK0 A;  5F3A A;  5I88 A;  2XIC A;  1BI0 A;  2RA2 A;  4M77 C;  3GF5 A;  3L2Z A;  2FB7 A;  3VUB A;  5E9K A;  4FM4 B;  3GNF B;  5J3B A;  1DJ7 B;  4QEW A;  4DQ2 A;  3UV4 A;  4XTW A;  5HK3 A;  5AD2 A;  5C89 A;  1K73 C;  4A9E A;  5LJ0 A;  4NR5 A;  2A7Y A;  4A9N A;  3VYG A;  2LDM A;  5E3D A;  3NTK A;  1NZ9 A;  3G71 T;  4JS4 A;  3CBO A;  4O7A A;  1WJQ A;  4YYI A;  4F7U A;  4BI8 B;  1KQ1 A;  2LVM A;  4LDY A;  5FBX A;  1X75 C;  4IR3 A;  1KD1 U;  3O37 A;  3CME T;  2D6F A;  4FU6 A;  1XNI A;  5ENB A;  2K2V A;  4OB1 B;  1YI2 T;  3LJW A;  3HPW A;  4Y03 A;  1G5V A;  5CS8 A;  4LR6 A;  1G3Y A;  1VQ8 A;  3JB9 F;  3V8L A;  3OYY A;  2R0S A;  4M7D D;  5DYU A;  2R58 A;  1N9S A;  3SWN B;  1W2B A;  4N4F A;  5CUD A;  3P8D A;  4OGE A;  3RKY A;  3FLG A;  5LJ5 e;  2RHY A;  4OGI A;  1RI0 A;  2YLB A;  4YYD A;  2QI2 A;  4C5I A;  5GAO l;  5DLO A;  2X4X A;  4NS5 A;  5CQ3 A;  2DIQ A;  1AHJ B;  1FWZ A;  5ENH A;  3UV2 A;  4IR4 A;  4LDX A;  5D3L A;  4O72 A;  4QSV A;  1BIA A;  2R5A A;  1U1S A;  4QR5 A;  3VJP A;  4UIX A;  4XU2 A;  5F36 A;  4O7C A;  2CS7 A;  2R0V A;  2MMP A;  3OMG A;  2H3J A;  4NYW A;  5HRV A;  3JB9 J;  1OYX A;  3HME A;  1Q86 U;  3JSC A;  5KTW A;  1VQL T;  5EWC A;  4IKF A;  5FH8 A;  2RB6 A;  4NR7 A;  4QVZ A;  4NRB A;  4ZTJ A;  4QSP A;  2QDY B;  3SD4 A;  3I3J A;  2GF7 A;  4C5E A;  4NR8 A;  3IU5 A;  1V29 B;  5D6Y A;  4IUT A;  3SB2 A;  1Q86 C;  4F7U G;  5GAO p;  3M4G A;  5EWH A;  5CQT A;  5CQ6 A;  3SVF A;  3L2V A;  3PIO A;  3SDZ A;  2DVS A;  5FU6 B;  2XDB A;  2RJE A;  2XDP A;  5FH6 A;  3U5N A;  2BUD A;  3MEV A;  2QA4 A;  3DWY A;  4QUU A;  1Y96 A;  3CPF A;  2QQB A;  4BY6 B;  1I4K 1;  5EI4 A;  5DYX A;  5GAN 5;  4B9X A;  2I8N A;  4C67 A;  5F25 A;  3HRS A;  3M9Q A;  1LJO A;  4JS5 A;  2E3K A;  3O36 A;  4M78 F;  3QYG B;  2P4T A;  4M7D E;  4QSQ A;  4Z02 A;  5DLX A;  2HD0 A;  4O7E A;  5E9M A;  3FRN A;  4KUD K;  3UVD A;  3JCM f;  4EMK C;  5IAY A;  2MWP A;  2MF2 A;  3J7A F;  2YHT A;  3LQI A;  5GAN 4;  3OBY A;  4AKN A;  2FVU A;  4WHU A;  5KCO A;  4J0S A;  4J1P A;  4LDV A;  3P1F A;  4Z93 A;  4LDF A;  2L8D A;  4XK8 E;  5HFQ A;  3X28 B;  5LJ2 A;  3JVM A;  2MI6 A;  1VIE A;  4QQG A;  4M7D C;  2HQX A;  3SVH A;  4NR6 A;  4A9J A;  2QEX T;  2E12 A;  3CCU T;  2BKD N;  3G71 A;  3G6E A;  4XU0 A;  4QC1 A;  2DD5 A;  4C0D B;  5FRM A;  3PMT A;  2DAT A;  3JCM c;  4NR4 A;  4TVR A;  2VGM A;  5DFB A;  2GRC A;  4XTU A;  4C92 A;  3VU3 C;  2LC4 A;  5A5N A;  4PJO E;  3K2J A;  4M7A B;  4NQN A;  4GPJ A;  1VQ6 A;  4ZGD B;  4QNS A;  5EM3 A;  4FT2 A;  4CLB A;  4HXN A;  1KC8 U;  2DIG A;  2DAQ A;  2OTJ T;  2YRV A;  1M1K C;  4JDS A;  4UYH A;  4C5H A;  4ALH A;  5LVQ A;  5FB0 A;  4MZM A;  3C12 A;  1QVF S;  5I40 A;  1YJW A;  3NFC A;  4M75 C;  3CCJ A;  4PJO D;  2E1H A;  1IZ6 A;  4XUA A;  3UVW A;  3S3N A;  3VUZ A;  3OSV A;  4YAB A;  2RHX A;  2YYN A;  2EIF A;  4M78 G;  5LJ3 h;  5CTL A;  1I5L A;  4NUE A;  2H60 A;  1FX7 A;  4NXJ A;  2ZPH B;  3J81 E;  5EU1 A;  4OUF A;  2LNV A;  3RMS A;  4CUQ A;  2Y4Y A;  3OQ5 A;  3LX7 A;  4E7H A;  1NE8 A;  5GAO q;  5I21 A;  5D6W A;  1BI2 A;  3JB9 G;  1HXD A;  1YIT A;  5ETD A;  3INZ A;  5KO4 A;  4C92 G;  2QQR A;  2DXB A;  5GMK l;  4M78 D;  1K9M U;  4HT8 A;  5CPE A;  4C8Q F;  4A9K A;  5LJ5 f;  4OVA A;  5L97 A;  4OB0 B;  2YEM A;  2Y4X A;  3JVJ A;  1BI3 A;  3X24 B;  3OMC A;  1M1F A;  4F7U F;  5E3G A;  5AME A;  3MUL A;  5FE3 A;  3AAD A;  1M1K U;  5LJ5 j;  2RFJ A;  4A9H A;  3H6Z A;  4F7U B;  3GPL A;  5LJ3 f;  4PCE A;  1QP2 A;  4NYX A;  4QSX A;  3M57 A;  2XD0 A;  5D3N A;  5LJ1 A;  4BY6 C;  4HCZ A;  4LZS A;  2DTO A;  4CI0 C;  4BW3 A;  1U1T A;  5GAN 3;  4C8Q E;  4M7D G;  3P1E A;  1XTD A;  3GG3 A;  3DKM A;  5I7Y A;  2X4W A;  4A4E A;  1M1G A;  3A8L B;  3JCM Q;  1PSF A;  3CCL A;  3JCM X;  4X34 A;  2ZZD A;  3P8H A;  4X9C A;  4NRA A;  4NL3 A;  3CC7 T;  1XOV A;  4HXP A;  3OY9 A;  4QQD A;  3CD6 A;  2ZCF B;  5CCA A;  3MEA A;  1VQ7 T;  2R0Y A;  4NR9 A;  4C8Q D;  1LNX A;  1YJN A;  3WVD B;  4JRI A;  2DTI A;  3ME9 A;  3LYI A;  1UGR B;  4A53 A;  5EVA A;  1K8A U;  4J83 A;  4CUS A;  5F2P A;  4XUB A;  4CUU A;  5IGK A;  1FXX A;  5EG2 A;  4JLI A;  4TT4 A;  5KU3 A;  5I2S A;  3JVK A;  5FU6 C;  4IR6 A;  2I2L A;  5CIU A;  2DTH A;  3BY7 A;  2DZC A;  4JRP A;  5EGU A;  4M78 E;  4QW2 A;  2B8A A;  2RI5 A;  2O01 E;  5DX4 A;  3CCR A;  2ZPF B;  4DOW A;  3GIB A;  4M78 A;  2ZGW A;  5LJ3 d;  4MEO A;  5GAN 7;  4MR3 A;  4R55 A;  5F1L A;  3QII A;  2OAU A;  5GMK e;  3MET A;  4XTV A;  5GAN g;  2CZ1 B;  5A81 A;  5FE2 A;  2A3L A;  3CPW S;  2P0K A;  5A5O A;  2F69 A;  3O33 A;  3QZ9 B;  3DAI A;  3RKX A;  4BB7 A;  3JRZ A;  4YH4 A;  4GLK A;  4IOO A;  1OZ3 A;  1YI2 A;  2JOY A;  4N0A C;  5CK9 A;  3MO8 A;  3TCJ A;  3CPW A;  2VXF A;  2M1H A;  4YAD A;  2EYQ A;  3MEU A;  4QEV A;  3R6O A;  3X25 B;  2CZ0 B;  5EIS A;  2YEK A;  3QZ5 B;  4CRI A;  5DW2 A;  2EJF A;  3E1S A;  5EV9 A;  5AMF A;  1KD1 C;  5BT4 A;  4E96 A;  1YJN T;  4N4H A;  3CEY A;  3QHS A;  4GY5 A;  5BT3 A;  4EMK A;  4YH3 A;  3A5Z B;  4O7F A;  3DLL A;  3C95 A;  3M55 A;  4FIB A;  5C85 A;  4M78 B;  5E73 A;  1OI1 A;  3EAE A;  3LLR A;  2L89 A;  3DLM A;  4IR5 A;  3AQA A;  3OYG A;  3Q2F A;  5FG5 A;  5A7C A;  4PCI A;  2FSA A;  2E65 A;  3NTH A;  4HXS A;  5LJ3 g;  4C8Q A;  3PNW C;  4OP0 A;  4HBV A;  5I1Q A;  5FFV A;  5D6X A;  5E9I A;  5A0D A;  1Y96 B;  5CRM A;  5CVI A;  3FDR A;  2KY9 A;  1YIJ A;  4PLL A;  2GFA A;  2RO1 A;  2LTO A;  3QDR B;  4HBW A;  3L2Q A;  5HRW A;  3JCM P;  5GAM h;  5DYC A;  4NL2 A;  5HEN A;  4A4G A;  5J0D A;  5II1 A;  2O4X B;  4N0A A;  2QTX A;  4Z1S A;  4FSX A;  3L2U A;  4HXM A;  5HQ5 A;  2RHZ A;  5D26 A;  5I2M A;  5GAO r;  1O75 A;  4C8Q B;  5LL6 S;  1VQ8 T;  3DB3 A;  3GLX A;  4WHW A;  4MDX A;  4HXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...