4ALHA

N-terminal bromodomain of human brd2 with 3,5 dimethyl-4-phenyl-1,2- oxazole
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords BROMODOMAIN CONTAINING 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 2: Optimization of Phenylisoxazole Sulfonamides.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4alhA00
3AADA 5EPSA 2R0SA 5H1TA 4Z1QA 5D3NA 4HXKA 4QSUA 5A83A 4QSWA 4NQMA 4MENA 3P1DA 3U5MA 5CQ4A 3P1FA 2RNXA 5A82A 4PKLA 5FE9A 5KHMA 5TB6A 2E3KA 2YEMA 3DAIA 2DWWA 5I40A 2F6NA 3FKMX 5FH8A 5COIA 4UYEA 2R0YA 4QSPA 4QYLA 5CUAA 4NR5A 3LQJA 5H1VA 1X0JA 4QSTA 4J3IA 4YYGA 4TQNA 5K29A 5HFQA 5CQ7A 5CQ6A 4PCIA 2I8NA 5FH6A 4IR6A 4FLPA 5LJ2A 5DY7A 4TTEA 4NS5A 4HXOA 4LZSA 4ZQLA 1EQFA 5CQAA 5L8UA 4QUUA 3U5OA 2L84A 5D3RA 2OSSA 5ENJA 4O78A 5CRZA 5EPRA 3O35A 3UW9A 4UIZA 4TU4A 3SVGA 4NYWA 4CUQA 2D82A 4F3IA 4MR3A 4QEUA 4A9NA 4WHWA 2RI7A 4O75A 5E9YA 4IR4A 4QR5A 2RFJA 4QSRA 4NRBA 5E9IA 2DVVA 4QB3A 5D3LA 4UYGA 4QEWA 4HXNA 5CQ3A 4N3WA 4NXJA 2MJVB 4TS8A 5BT5A 4A9HA 4CFLA 5ENFA 5FFWA 5LKXA 4NR7A 5D3TA 2N9GA 4YYNA 3UV4A 3LXJA 5CY9A 4YY6A 5AMEA 4UYFB 5EWHA 3O36A 4YATA 5EWCA 5G4RA 5J0DA 4GPJA 5IIDA 5I86A 3MULA 4QNSA 5LKUA 2LSPB 2NXBA 4UIUA 4IORA 4O76A 4A9EA 5DLZA 4X2IA 4YC9A 4HBXA 5E9LA 5CUEA 5E3DA 2GRCA 4NR4A 3MUKA 4MR4A 3JVKA 4HXLA 5CGPA 5CZGA 4YH4A 5A5RA 5A5OA 4MEQA 5D3JA 5C87A 1ZS5A 2DVQA 5DKDA 5DFBA 3HMEA 4O71A 3S92A 3D7CA 5CS8A 5C85A 5FE2A 1WUMA 3QZSA 5F60A 4DONA 5HRXA 2E7NA 5F61A 3MB3A 4J0SA 4QEVA 5FFYA 4UIXA 3TLPA 5E9MA 5FE0A 4O70A 4PY6A 4A9LA 3JVJA 4XYAA 5D26A 5FE5A 3S91A 4QSQA 4O72A 5I89A 4CUTA 5FBXA 5CPEA 2DVRA 2G4AA 4XUBA 4YH3A 3U5LA 4J1PA 4A9KA 5C7NA 4NUEA 4QR3A 4QYDA 5L98A 2OO1A 5EU1A 5H1UA 5FFVA 5FE1A 5HQ5A 4CURA 4TT6A 5D3PA 3P1CA 5DYCA 5DX4A 4PCEA 2WP1A 5FE8A 4O77A 4IR3A 5F63A 2RNWA 5ETBA 4OGJA 3U5NA 5EQ1A 5FH7A 4C67A 4O7CA 5F62A 4YBTA 5E0RA 5C8GA 4QC1A 4WHUA 5A5NA 5HLSA 5ENCA 4PTBA 5FE4A 5EWVA 5DFCA 5HM0A 4QUTA 4NQNA 5EGUA 5KTUA 4QBMA 5D3SA 4YYMA 4Q0NA 4QSVA 1JSPB 4UITA 5DYAA 5ENGA 2DKWA 4YYHA 5A85A 1WUGA 4NR6A 5IBNA 5ENHA 5HQ7A 5D3HA 3UVXA 5E7DA 5CP5A 4LR6A 4TT4A 3LQIA 2YQDA 4HXSA 5EICA 4XUAA 2YDWA 2RO1A 5FB1A 5HFRA 5IGLA 4A9IA 2I7KA 4UIWA 5C4QA 5EM3A 4QR4A 5FB0A 5DYXA 3QZVA 5DBMA 1JM4B 4LYIA 5HRWA 3G0JA 5LKZA 4LYSA 5A5SA 4IOQA 4LDFA 4HBWA 4XY8A 3UVYA 5ACYA 5IG6A 5JI8A 4BW4A 3U5JA 3DWYA 5EISA 5EWDA 5D25A 4OGIA 3JVLA 4YADA 5F3AA 4HXMA 5DW2A 4YABA 2YYNA 5IGKA 3UVWA 3MXFA 5EPBA 5CQTA 4MEPA 4O7FA 4LC2A 5FG5A 4YBSA 2F6JA 4O7EA 4A9JA 2L5EA 2E7OA 5IGNA 5HELA 3UV5A 5D7XA 3LJWA 4ZC9A 5A5PA 5IGMA 5L97A 5LVQA 4IOOA 5KTWA 2D9EA 5AD2A 4BW1A 5CUDA 3SVFA 4NR8A 5HJCA 3U5KA 5CFWA 5DKCA 5F2PA 4CUUA 4XY9A 5CUBA 5I29A 3O34A 5DFDA 4BW3A 4UYDA 3P1EA 3GG3A 4MR5A 4O74A 3QZTA 4TU6A 3UVDA 5FE6A 4N4HA 4A9MA 5DYUA 5F1LA 4N4IA 4YYIA 4Z1SA 4J0RA 5FE3A 2WP2A 5KO4A 5F5ZA 4LZ2A 4E96A 4HBYA 2RNYA 5I83A 2RS9B 5ENEA 4QC3A 4Z6IA 1F68A 4KCXA 5TCMA 5D24A 4A9FA 5CUCA 4N4FA 3JVMA 4QSSA 4C66A 3HMHA 4NUDA 4TZ8A 5L99A 5CUGA 5KTXA 2KTBB 5FG6A 3MB4A 5C89A 4YAXA 5I80A 5I7XA 5BT3A 2YW5A 4NYXA 5L96A 5F36A 5I1QA 5H85A 2H60A 4CFKA 1E6IA 5HCLA 4NUCA 5G4SA 5L8TA 4MR6A 5KU3A 4O7BA 5FDZA 4NRAA 4YY4A 4QSXA 5EV9A 3UV2A 4KV1A 5AD3A 5HRVA 4YYDA 5AMFA 4CUPA 2YELA 4LZRA 4HXRA 4O7AA 4LRGA 2R10A 3K2JA 4KV4A 4Z6HA 3Q2FA 5EWWA 4TT2A 5ENBA 4CUSA 5F1HA 5E74A 5EK9A 4NR9A 4UIYA 4YK0A 3Q2EA 3ONIA 4UYFA 5LKTA 5E73A 5ETDA 2R0VA 5FG4A 4QY4A 5DW1A 4Z93A 4YYJA 4HXPA 1N72A 5D0CA 5I88A 3G0LA 5FE7A 4TZ2A 5DKHA 5DLXA 5JWMA 3U5PA 5LJ1A 4OUFA 3NXBA 4MEOA 2OUOA 3O37A 4RVRA 5A5QA 5LVRA 3RCWA 5E9KA 4YYKA 2DVSA 5LJ0A 3AQAA 4AKNA 4WIVA 3SVHA 5A7CA 3IU6A 5CTLA 5CQ5A 5A81A 4A9OA 4Q0OA 5II1A 2YEKA 4BJXA 4NRCA 4NYVA 4UYHA 4BW2A 2DATA 5F25A 5EP7A 5I7YA 4TYLA 4QZSA 5HQ6A 5EVAA 4ZW1A 4PS5A 2FSAA 5HENA 5HEMA 4ALHA 4UIVA 3MQMA 3HMFA 4CL9A 3I3JA 3IU5A 3O33A 4HBVA 4N4GA 5E3GA 4BHWA 4CLBA 5LUUA 5ENIA 5E9VA 4YBMA 5EI4A 4ALGA 4LYWA 5CQ8A 3P5OA 2L85A 4Y03A 5EA1A 4IR5A 3ZYUA 3LQHA 5II2A 5CU8A 5CRMA 5BT4A
chains in the Genus database with same CATH superfamily
3AADA 5EPSA 2R0SA 5H1TA 4Z1QA 5D3NA 4HXKA 4QSUA 5A83A 4QSWA 4NQMA 4MENA 3P1DA 3U5MA 5CQ4A 3P1FA 2RNXA 5A82A 4PKLA 5FE9A 5KHMA 5TB6A 2E3KA 2YEMA 3DAIA 2DWWA 5I40A 2F6NA 3FKMX 5FH8A 5COIA 4UYEA 2R0YA 4QSPA 4QYLA 5CUAA 4NR5A 3LQJA 5H1VA 1X0JA 4QSTA 3D1DA 4J3IA 4YYGA 4TQNA 5K29A 5HFQA 5CQ7A 5CQ6A 4PCIA 2I8NA 5FH6A 4IR6A 4FLPA 5LJ2A 5DY7A 4TTEA 4NS5A 4HXOA 4LZSA 4ZQLA 1EQFA 5CQAA 5L8UA 4QUUA 3U5OA 2L84A 5D3RA 2OSSA 5ENJA 4O78A 5CRZA 5EPRA 3O35A 3UW9A 4UIZA 4TU4A 3SVGA 4NYWA 4CUQA 2D82A 4F3IA 4MR3A 4QEUA 4A9NA 4WHWA 2RI7A 4O75A 5E9YA 4IR4A 4QR5A 2RFJA 4QSRA 4NRBA 5E9IA 2DVVA 4QB3A 5D3LA 4UYGA 4QEWA 4HXNA 4AI6A 5CQ3A 4N3WA 4NXJA 2MJVB 4TS8A 5BT5A 4A9HA 4CFLA 5ENFA 5FFWA 5LKXA 4NR7A 5D3TA 2N9GA 4YYNA 3UV4A 3LXJA 5CY9A 4YY6A 5AMEA 4UYFB 5EWHA 3O36A 4YATA 5EWCA 5G4RA 5J0DA 4GPJA 5IIDA 5I86A 3MULA 4QNSA 5LKUA 2LSPB 2NXBA 4UIUA 4IORA 4O76A 4A9EA 5DLZA 4X2IA 4YC9A 4HBXA 5E9LA 5CUEA 5E3DA 2GRCA 4NR4A 3MUKA 4MR4A 3JVKA 4HXLA 5CGPA 5CZGA 4YH4A 5A5RA 5A5OA 4MEQA 5D3JA 5C87A 1ZS5A 2DVQA 5DKDA 5DFBA 3HMEA 4O71A 3S92A 3D7CA 5CS8A 5C85A 5FE2A 1WUMA 3QZSA 5F60A 4DONA 5HRXA 2E7NA 5F61A 3MB3A 4J0SA 4QEVA 5FFYA 4UIXA 3TLPA 5E9MA 5FE0A 4O70A 4PY6A 4A9LA 3JVJA 4XYAA 5D26A 5FE5A 3S91A 4QSQA 4O72A 5I89A 4CUTA 5FBXA 5CPEA 3D1BA 2DVRA 2G4AA 4XUBA 4YH3A 3U5LA 4J1PA 4A9KA 5C7NA 4NUEA 4QR3A 4QYDA 5L98A 2OO1A 5EU1A 5H1UA 5FFVA 5FE1A 5HQ5A 4CURA 4TT6A 5D3PA 3P1CA 5DYCA 5DX4A 4PCEA 2WP1A 5FE8A 4O77A 4IR3A 5F63A 2RNWA 5ETBA 4OGJA 3U5NA 5EQ1A 5FH7A 4C67A 4O7CA 5F62A 4YBTA 5E0RA 5C8GA 4QC1A 4WHUA 5A5NA 5HLSA 5ENCA 4PTBA 5FE4A 5EWVA 5DFCA 5HM0A 4QUTA 4NQNA 5EGUA 5KTUA 4QBMA 5D3SA 4YYMA 4Q0NA 4QSVA 1JSPB 4UITA 5DYAA 5ENGA 2DKWA 4YYHA 5A85A 1WUGA 4NR6A 5IBNA 5ENHA 5HQ7A 5D3HA 3UVXA 5E7DA 5CP5A 4LR6A 4TT4A 3LQIA 2YQDA 4HXSA 5EICA 4XUAA 2YDWA 2RO1A 5FB1A 5HFRA 5IGLA 4A9IA 2I7KA 4UIWA 5C4QA 5EM3A 4QR4A 5FB0A 5DYXA 3QZVA 5DBMA 1JM4B 4LYIA 5HRWA 3G0JA 5LKZA 4LYSA 5A5SA 4IOQA 4LDFA 4HBWA 4XY8A 3UVYA 5ACYA 5IG6A 5JI8A 4BW4A 3U5JA 3DWYA 5EISA 5EWDA 5D25A 4OGIA 3JVLA 4YADA 5F3AA 4HXMA 5DW2A 4YABA 4AKHA 2YYNA 5IGKA 3UVWA 3MXFA 5EPBA 5CQTA 4MEPA 4O7FA 4LC2A 1PUOA 5FG5A 4YBSA 2F6JA 4O7EA 4A9JA 2L5EA 2E7OA 5IGNA 5HELA 3UV5A 5D7XA 3LJWA 4ZC9A 5A5PA 5IGMA 5L97A 5LVQA 4IOOA 5KTWA 2D9EA 5AD2A 4BW1A 5CUDA 3SVFA 4NR8A 5HJCA 3U5KA 5CFWA 5DKCA 5F2PA 4CUUA 4XY9A 5CUBA 5I29A 4AKGA 3O34A 5DFDA 4BW3A 4UYDA 3P1EA 3GG3A 4MR5A 4O74A 3QZTA 4TU6A 3UVDA 5FE6A 4N4HA 1ZKRA 4A9MA 5DYUA 5F1LA 4AKIA 4N4IA 4YYIA 4Z1SA 4J0RA 5FE3A 2WP2A 5KO4A 5F5ZA 4LZ2A 4E96A 4HBYA 2RNYA 5I83A 2RS9B 5ENEA 4QC3A 4Z6IA 1F68A 4KCXA 5TCMA 5D24A 4A9FA 5CUCA 4N4FA 3JVMA 4QSSA 4C66A 3HMHA 4NUDA 4TZ8A 5L99A 5CUGA 3ERRA 5KTXA 2KTBB 5FG6A 3MB4A 5C89A 4YAXA 5I80A 5I7XA 5BT3A 2YW5A 4NYXA 5L96A 5F36A 5I1QA 5H85A 2H60A 4CFKA 1E6IA 5HCLA 4NUCA 5G4SA 5L8TA 3VKHA 4MR6A 5KU3A 4O7BA 5FDZA 4NRAA 4YY4A 4QSXA 5EV9A 3UV2A 4KV1A 5AD3A 5HRVA 4YYDA 5AMFA 4CUPA 2YELA 4LZRA 4HXRA 4O7AA 4LRGA 2R10A 3K2JA 4KV4A 4Z6HA 3Q2FA 5EWWA 4TT2A 5ENBA 4CUSA 5F1HA 5E74A 5EK9A 4NR9A 4UIYA 4YK0A 3Q2EA 3ONIA 4UYFA 5LKTA 5E73A 5ETDA 2R0VA 5FG4A 4QY4A 5DW1A 4Z93A 4YYJA 4HXPA 1N72A 5D0CA 5I88A 3G0LA 5FE7A 4TZ2A 5DKHA 5DLXA 5JWMA 3U5PA 5LJ1A 4OUFA 3NXBA 4MEOA 2OUOA 3O37A 4RVRA 5A5QA 5LVRA 3RCWA 5E9KA 4YYKA 2DVSA 5LJ0A 3AQAA 4AKNA 4WIVA 3SVHA 5A7CA 3IU6A 5CTLA 5CQ5A 5A81A 4A9OA 4Q0OA 5II1A 2YEKA 4BJXA 4NRCA 4NYVA 4UYHA 4BW2A 2DATA 5F25A 5EP7A 5I7YA 4TYLA 4QZSA 5HQ6A 5EVAA 4ZW1A 4PS5A 2FSAA 5HENA 5HEMA 4ALHA 4UIVA 3MQMA 3HMFA 2EJNA 4CL9A 3I3JA 3IU5A 3O33A 4HBVA 4N4GA 5E3GA 4BHWA 4CLBA 5LUUA 5ENIA 5E9VA 4YBMA 5EI4A 4ALGA 4LYWA 5CQ8A 3P5OA 2L85A 4Y03A 5EA1A 4IR5A 3VKGA 3ZYUA 3LQHA 5II2A 5CU8A 5CRMA 5BT4A
chains in the Genus database with same CATH topology
3AADA 5EPSA 2R0SA 5H1TA 4Z1QA 5D3NA 4HXKA 4QSUA 5A83A 4QSWA 4NQMA 4MENA 3P1DA 3U5MA 5CQ4A 3P1FA 2RNXA 5A82A 4PKLA 5FE9A 5KHMA 5TB6A 2E3KA 2YEMA 3DAIA 2DWWA 5I40A 2F6NA 3FKMX 5FH8A 5COIA 4UYEA 2R0YA 4QSPA 4QYLA 5CUAA 4NR5A 3LQJA 5H1VA 1X0JA 4QSTA 4J3IA 4YYGA 4TQNA 5K29A 5HFQA 5CQ7A 5CQ6A 4PCIA 2I8NA 5FH6A 4IR6A 4FLPA 5LJ2A 5DY7A 4TTEA 4NS5A 4HXOA 4LZSA 4ZQLA 1EQFA 5CQAA 5L8UA 4QUUA 3U5OA 2L84A 5D3RA 2OSSA 5ENJA 4O78A 5CRZA 5EPRA 3O35A 3UW9A 4UIZA 4TU4A 3SVGA 4NYWA 4CUQA 2D82A 4F3IA 4MR3A 4QEUA 4A9NA 4WHWA 2RI7A 4O75A 5E9YA 4IR4A 4QR5A 2RFJA 4QSRA 4NRBA 5E9IA 2DVVA 4QB3A 5D3LA 4UYGA 4QEWA 4HXNA 5CQ3A 4N3WA 4NXJA 2MJVB 4TS8A 5BT5A 4A9HA 4CFLA 5ENFA 5FFWA 5LKXA 4NR7A 5D3TA 2N9GA 4YYNA 3UV4A 3LXJA 5CY9A 4YY6A 5AMEA 4UYFB 5EWHA 3O36A 4YATA 5EWCA 5G4RA 5J0DA 4GPJA 5IIDA 5I86A 3MULA 4QNSA 5LKUA 2LSPB 2NXBA 4UIUA 4IORA 4O76A 4A9EA 5DLZA 4X2IA 4YC9A 4HBXA 5E9LA 5CUEA 5E3DA 2GRCA 4NR4A 3MUKA 4MR4A 3JVKA 4HXLA 5CGPA 5CZGA 4YH4A 5A5RA 5A5OA 4MEQA 5D3JA 5C87A 1ZS5A 2DVQA 5DKDA 5DFBA 3HMEA 4O71A 3S92A 3D7CA 5CS8A 5C85A 5FE2A 1WUMA 3QZSA 5F60A 4DONA 5HRXA 2E7NA 5F61A 3MB3A 4J0SA 4QEVA 5FFYA 4UIXA 3TLPA 5E9MA 5FE0A 4O70A 4PY6A 4A9LA 3JVJA 4XYAA 5D26A 5FE5A 3S91A 4QSQA 4O72A 5I89A 4CUTA 5FBXA 5CPEA 2DVRA 2G4AA 4XUBA 4YH3A 3U5LA 4J1PA 4A9KA 5C7NA 4NUEA 4QR3A 4QYDA 5L98A 2OO1A 5EU1A 5H1UA 5FFVA 5FE1A 5HQ5A 4CURA 4TT6A 5D3PA 3P1CA 5DYCA 5DX4A 4PCEA 2WP1A 5FE8A 4O77A 4IR3A 5F63A 2RNWA 5ETBA 4OGJA 3U5NA 5EQ1A 5FH7A 4C67A 4O7CA 5F62A 4YBTA 5E0RA 5C8GA 4QC1A 4WHUA 5A5NA 5HLSA 5ENCA 4PTBA 5FE4A 5EWVA 5DFCA 5HM0A 4QUTA 4NQNA 5EGUA 5KTUA 4QBMA 5D3SA 4YYMA 4Q0NA 4QSVA 1JSPB 4UITA 5DYAA 5ENGA 2DKWA 4YYHA 5A85A 1WUGA 4NR6A 5IBNA 5ENHA 5HQ7A 5D3HA 3UVXA 5E7DA 5CP5A 4LR6A 4TT4A 3LQIA 2YQDA 4HXSA 5EICA 4XUAA 2YDWA 2RO1A 5FB1A 5HFRA 5IGLA 4A9IA 2I7KA 4UIWA 5C4QA 5EM3A 4QR4A 5FB0A 5DYXA 3QZVA 5DBMA 1JM4B 4LYIA 5HRWA 3G0JA 5LKZA 4LYSA 5A5SA 4IOQA 4LDFA 4HBWA 4XY8A 3UVYA 5ACYA 5IG6A 5JI8A 4BW4A 3U5JA 3DWYA 5EISA 5EWDA 5D25A 4OGIA 3JVLA 4YADA 5F3AA 4HXMA 5DW2A 4YABA 2YYNA 5IGKA 3UVWA 3MXFA 5EPBA 5CQTA 4MEPA 4O7FA 4LC2A 5FG5A 4YBSA 2F6JA 4O7EA 4A9JA 2L5EA 2E7OA 5IGNA 5HELA 3UV5A 5D7XA 3LJWA 4ZC9A 5A5PA 5IGMA 5L97A 5LVQA 4IOOA 5KTWA 2D9EA 5AD2A 4BW1A 5CUDA 3SVFA 4NR8A 5HJCA 3U5KA 5CFWA 5DKCA 5F2PA 4CUUA 4XY9A 5CUBA 5I29A 3O34A 5DFDA 4BW3A 4UYDA 3P1EA 3GG3A 4MR5A 4O74A 3QZTA 4TU6A 3UVDA 5FE6A 4N4HA 4A9MA 5DYUA 5F1LA 4N4IA 4YYIA 4Z1SA 4J0RA 5FE3A 2WP2A 5KO4A 5F5ZA 4LZ2A 4E96A 4HBYA 2RNYA 5I83A 2RS9B 5ENEA 4QC3A 4Z6IA 1F68A 4KCXA 5TCMA 5D24A 4A9FA 5CUCA 4N4FA 3JVMA 4QSSA 4C66A 3HMHA 4NUDA 4TZ8A 5L99A 5CUGA 5KTXA 2KTBB 5FG6A 3MB4A 5C89A 4YAXA 5I80A 5I7XA 5BT3A 2YW5A 4NYXA 5L96A 5F36A 5I1QA 5H85A 2H60A 4CFKA 1E6IA 5HCLA 4NUCA 5G4SA 5L8TA 4MR6A 5KU3A 4O7BA 5FDZA 4NRAA 4YY4A 4QSXA 5EV9A 3UV2A 4KV1A 5AD3A 5HRVA 4YYDA 5AMFA 4CUPA 2YELA 4LZRA 4HXRA 4O7AA 4LRGA 2R10A 3K2JA 4KV4A 4Z6HA 3Q2FA 5EWWA 4TT2A 5ENBA 4CUSA 5F1HA 5E74A 5EK9A 4NR9A 4UIYA 4YK0A 3Q2EA 3ONIA 4UYFA 5LKTA 5E73A 5ETDA 2R0VA 5FG4A 4QY4A 5DW1A 4Z93A 4YYJA 4HXPA 1N72A 5D0CA 5I88A 3G0LA 5FE7A 4TZ2A 5DKHA 5DLXA 5JWMA 3U5PA 5LJ1A 4OUFA 3NXBA 4MEOA 2OUOA 3O37A 4RVRA 5A5QA 5LVRA 3RCWA 5E9KA 4YYKA 2DVSA 5LJ0A 3AQAA 4AKNA 4WIVA 3SVHA 5A7CA 3IU6A 5CTLA 5CQ5A 5A81A 4A9OA 4Q0OA 5II1A 2YEKA 4BJXA 4NRCA 4NYVA 4UYHA 4BW2A 2DATA 5F25A 5EP7A 5I7YA 4TYLA 4QZSA 5HQ6A 5EVAA 4ZW1A 4PS5A 2FSAA 5HENA 5HEMA 4ALHA 4UIVA 3MQMA 3HMFA 4CL9A 3I3JA 3IU5A 3O33A 4HBVA 4N4GA 5E3GA 4BHWA 4CLBA 5LUUA 5ENIA 5E9VA 4YBMA 5EI4A 4ALGA 4LYWA 5CQ8A 3P5OA 2L85A 4Y03A 5EA1A 4IR5A 3ZYUA 3LQHA 5II2A 5CU8A 5CRMA 5BT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAD A;  5EPS A;  2R0S A;  5H1T A;  4Z1Q A;  5D3N A;  4HXK A;  4QSU A;  5A83 A;  4QSW A;  4NQM A;  4MEN A;  3P1D A;  3U5M A;  5CQ4 A;  3P1F A;  2RNX A;  5A82 A;  4PKL A;  5FE9 A;  5KHM A;  5TB6 A;  2E3K A;  2YEM A;  3DAI A;  2DWW A;  5I40 A;  2F6N A;  3FKM X;  5FH8 A;  5COI A;  4UYE A;  2R0Y A;  4QSP A;  4QYL A;  5CUA A;  4NR5 A;  3LQJ A;  5H1V A;  1X0J A;  4QST A;  4J3I A;  4YYG A;  4TQN A;  5K29 A;  5HFQ A;  5CQ7 A;  5CQ6 A;  4PCI A;  2I8N A;  5FH6 A;  4IR6 A;  4FLP A;  5LJ2 A;  5DY7 A;  4TTE A;  4NS5 A;  4HXO A;  4LZS A;  4ZQL A;  1EQF A;  5CQA A;  5L8U A;  4QUU A;  3U5O A;  2L84 A;  5D3R A;  2OSS A;  5ENJ A;  4O78 A;  5CRZ A;  5EPR A;  3O35 A;  3UW9 A;  4UIZ A;  4TU4 A;  3SVG A;  4NYW A;  4CUQ A;  2D82 A;  4F3I A;  4MR3 A;  4QEU A;  4A9N A;  4WHW A;  2RI7 A;  4O75 A;  5E9Y A;  4IR4 A;  4QR5 A;  2RFJ A;  4QSR A;  4NRB A;  5E9I A;  2DVV A;  4QB3 A;  5D3L A;  4UYG A;  4QEW A;  4HXN A;  5CQ3 A;  4N3W A;  4NXJ A;  2MJV B;  4TS8 A;  5BT5 A;  4A9H A;  4CFL A;  5ENF A;  5FFW A;  5LKX A;  4NR7 A;  5D3T A;  2N9G A;  4YYN A;  3UV4 A;  3LXJ A;  5CY9 A;  4YY6 A;  5AME A;  4UYF B;  5EWH A;  3O36 A;  4YAT A;  5EWC A;  5G4R A;  5J0D A;  4GPJ A;  5IID A;  5I86 A;  3MUL A;  4QNS A;  5LKU A;  2LSP B;  2NXB A;  4UIU A;  4IOR A;  4O76 A;  4A9E A;  5DLZ A;  4X2I A;  4YC9 A;  4HBX A;  5E9L A;  5CUE A;  5E3D A;  2GRC A;  4NR4 A;  3MUK A;  4MR4 A;  3JVK A;  4HXL A;  5CGP A;  5CZG A;  4YH4 A;  5A5R A;  5A5O A;  4MEQ A;  5D3J A;  5C87 A;  1ZS5 A;  2DVQ A;  5DKD A;  5DFB A;  3HME A;  4O71 A;  3S92 A;  3D7C A;  5CS8 A;  5C85 A;  5FE2 A;  1WUM A;  3QZS A;  5F60 A;  4DON A;  5HRX A;  2E7N A;  5F61 A;  3MB3 A;  4J0S A;  4QEV A;  5FFY A;  4UIX A;  3TLP A;  5E9M A;  5FE0 A;  4O70 A;  4PY6 A;  4A9L A;  3JVJ A;  4XYA A;  5D26 A;  5FE5 A;  3S91 A;  4QSQ A;  4O72 A;  5I89 A;  4CUT A;  5FBX A;  5CPE A;  2DVR A;  2G4A A;  4XUB A;  4YH3 A;  3U5L A;  4J1P A;  4A9K A;  5C7N A;  4NUE A;  4QR3 A;  4QYD A;  5L98 A;  2OO1 A;  5EU1 A;  5H1U A;  5FFV A;  5FE1 A;  5HQ5 A;  4CUR A;  4TT6 A;  5D3P A;  3P1C A;  5DYC A;  5DX4 A;  4PCE A;  2WP1 A;  5FE8 A;  4O77 A;  4IR3 A;  5F63 A;  2RNW A;  5ETB A;  4OGJ A;  3U5N A;  5EQ1 A;  5FH7 A;  4C67 A;  4O7C A;  5F62 A;  4YBT A;  5E0R A;  5C8G A;  4QC1 A;  4WHU A;  5A5N A;  5HLS A;  5ENC A;  4PTB A;  5FE4 A;  5EWV A;  5DFC A;  5HM0 A;  4QUT A;  4NQN A;  5EGU A;  5KTU A;  4QBM A;  5D3S A;  4YYM A;  4Q0N A;  4QSV A;  1JSP B;  4UIT A;  5DYA A;  5ENG A;  2DKW A;  4YYH A;  5A85 A;  1WUG A;  4NR6 A;  5IBN A;  5ENH A;  5HQ7 A;  5D3H A;  3UVX A;  5E7D A;  5CP5 A;  4LR6 A;  4TT4 A;  3LQI A;  2YQD A;  4HXS A;  5EIC A;  4XUA A;  2YDW A;  2RO1 A;  5FB1 A;  5HFR A;  5IGL A;  4A9I A;  2I7K A;  4UIW A;  5C4Q A;  5EM3 A;  4QR4 A;  5FB0 A;  5DYX A;  3QZV A;  5DBM A;  1JM4 B;  4LYI A;  5HRW A;  3G0J A;  5LKZ A;  4LYS A;  5A5S A;  4IOQ A;  4LDF A;  4HBW A;  4XY8 A;  3UVY A;  5ACY A;  5IG6 A;  5JI8 A;  4BW4 A;  3U5J A;  3DWY A;  5EIS A;  5EWD A;  5D25 A;  4OGI A;  3JVL A;  4YAD A;  5F3A A;  4HXM A;  5DW2 A;  4YAB A;  2YYN A;  5IGK A;  3UVW A;  3MXF A;  5EPB A;  5CQT A;  4MEP A;  4O7F A;  4LC2 A;  5FG5 A;  4YBS A;  2F6J A;  4O7E A;  4A9J A;  2L5E A;  2E7O A;  5IGN A;  5HEL A;  3UV5 A;  5D7X A;  3LJW A;  4ZC9 A;  5A5P A;  5IGM A;  5L97 A;  5LVQ A;  4IOO A;  5KTW A;  2D9E A;  5AD2 A;  4BW1 A;  5CUD A;  3SVF A;  4NR8 A;  5HJC A;  3U5K A;  5CFW A;  5DKC A;  5F2P A;  4CUU A;  4XY9 A;  5CUB A;  5I29 A;  3O34 A;  5DFD A;  4BW3 A;  4UYD A;  3P1E A;  3GG3 A;  4MR5 A;  4O74 A;  3QZT A;  4TU6 A;  3UVD A;  5FE6 A;  4N4H A;  4A9M A;  5DYU A;  5F1L A;  4N4I A;  4YYI A;  4Z1S A;  4J0R A;  5FE3 A;  2WP2 A;  5KO4 A;  5F5Z A;  4LZ2 A;  4E96 A;  4HBY A;  2RNY A;  5I83 A;  2RS9 B;  5ENE A;  4QC3 A;  4Z6I A;  1F68 A;  4KCX A;  5TCM A;  5D24 A;  4A9F A;  5CUC A;  4N4F A;  3JVM A;  4QSS A;  4C66 A;  3HMH A;  4NUD A;  4TZ8 A;  5L99 A;  5CUG A;  5KTX A;  2KTB B;  5FG6 A;  3MB4 A;  5C89 A;  4YAX A;  5I80 A;  5I7X A;  5BT3 A;  2YW5 A;  4NYX A;  5L96 A;  5F36 A;  5I1Q A;  5H85 A;  2H60 A;  4CFK A;  1E6I A;  5HCL A;  4NUC A;  5G4S A;  5L8T A;  4MR6 A;  5KU3 A;  4O7B A;  5FDZ A;  4NRA A;  4YY4 A;  4QSX A;  5EV9 A;  3UV2 A;  4KV1 A;  5AD3 A;  5HRV A;  4YYD A;  5AMF A;  4CUP A;  2YEL A;  4LZR A;  4HXR A;  4O7A A;  4LRG A;  2R10 A;  3K2J A;  4KV4 A;  4Z6H A;  3Q2F A;  5EWW A;  4TT2 A;  5ENB A;  4CUS A;  5F1H A;  5E74 A;  5EK9 A;  4NR9 A;  4UIY A;  4YK0 A;  3Q2E A;  3ONI A;  4UYF A;  5LKT A;  5E73 A;  5ETD A;  2R0V A;  5FG4 A;  4QY4 A;  5DW1 A;  4Z93 A;  4YYJ A;  4HXP A;  1N72 A;  5D0C A;  5I88 A;  3G0L A;  5FE7 A;  4TZ2 A;  5DKH A;  5DLX A;  5JWM A;  3U5P A;  5LJ1 A;  4OUF A;  3NXB A;  4MEO A;  2OUO A;  3O37 A;  4RVR A;  5A5Q A;  5LVR A;  3RCW A;  5E9K A;  4YYK A;  2DVS A;  5LJ0 A;  3AQA A;  4AKN A;  4WIV A;  3SVH A;  5A7C A;  3IU6 A;  5CTL A;  5CQ5 A;  5A81 A;  4A9O A;  4Q0O A;  5II1 A;  2YEK A;  4BJX A;  4NRC A;  4NYV A;  4UYH A;  4BW2 A;  2DAT A;  5F25 A;  5EP7 A;  5I7Y A;  4TYL A;  4QZS A;  5HQ6 A;  5EVA A;  4ZW1 A;  4PS5 A;  2FSA A;  5HEN A;  5HEM A;  4ALH A;  4UIV A;  3MQM A;  3HMF A;  4CL9 A;  3I3J A;  3IU5 A;  3O33 A;  4HBV A;  4N4G A;  5E3G A;  4BHW A;  4CLB A;  5LUU A;  5ENI A;  5E9V A;  4YBM A;  5EI4 A;  4ALG A;  4LYW A;  5CQ8 A;  3P5O A;  2L85 A;  4Y03 A;  5EA1 A;  4IR5 A;  3ZYU A;  3LQH A;  5II2 A;  5CU8 A;  5CRM A;  5BT4 A; 
#chains in the Genus database with same CATH topology
 3AAD A;  5EPS A;  2R0S A;  5H1T A;  4Z1Q A;  5D3N A;  4HXK A;  4QSU A;  5A83 A;  4QSW A;  4NQM A;  4MEN A;  3P1D A;  3U5M A;  5CQ4 A;  3P1F A;  2RNX A;  5A82 A;  4PKL A;  5FE9 A;  5KHM A;  5TB6 A;  2E3K A;  2YEM A;  3DAI A;  2DWW A;  5I40 A;  2F6N A;  3FKM X;  5FH8 A;  5COI A;  4UYE A;  2R0Y A;  4QSP A;  4QYL A;  5CUA A;  4NR5 A;  3LQJ A;  5H1V A;  1X0J A;  4QST A;  3D1D A;  4J3I A;  4YYG A;  4TQN A;  5K29 A;  5HFQ A;  5CQ7 A;  5CQ6 A;  4PCI A;  2I8N A;  5FH6 A;  4IR6 A;  4FLP A;  5LJ2 A;  5DY7 A;  4TTE A;  4NS5 A;  4HXO A;  4LZS A;  4ZQL A;  1EQF A;  5CQA A;  5L8U A;  4QUU A;  3U5O A;  2L84 A;  5D3R A;  2OSS A;  5ENJ A;  4O78 A;  5CRZ A;  5EPR A;  3O35 A;  3UW9 A;  4UIZ A;  4TU4 A;  3SVG A;  4NYW A;  4CUQ A;  2D82 A;  4F3I A;  4MR3 A;  4QEU A;  4A9N A;  4WHW A;  2RI7 A;  4O75 A;  5E9Y A;  4IR4 A;  4QR5 A;  2RFJ A;  4QSR A;  4NRB A;  5E9I A;  2DVV A;  4QB3 A;  5D3L A;  4UYG A;  4QEW A;  4HXN A;  4AI6 A;  5CQ3 A;  4N3W A;  4NXJ A;  2MJV B;  4TS8 A;  5BT5 A;  4A9H A;  4CFL A;  5ENF A;  5FFW A;  5LKX A;  4NR7 A;  5D3T A;  2N9G A;  4YYN A;  3UV4 A;  3LXJ A;  5CY9 A;  4YY6 A;  5AME A;  4UYF B;  5EWH A;  3O36 A;  4YAT A;  5EWC A;  5G4R A;  5J0D A;  4GPJ A;  5IID A;  5I86 A;  3MUL A;  4QNS A;  5LKU A;  2LSP B;  2NXB A;  4UIU A;  4IOR A;  4O76 A;  4A9E A;  5DLZ A;  4X2I A;  4YC9 A;  4HBX A;  5E9L A;  5CUE A;  5E3D A;  2GRC A;  4NR4 A;  3MUK A;  4MR4 A;  3JVK A;  4HXL A;  5CGP A;  5CZG A;  4YH4 A;  5A5R A;  5A5O A;  4MEQ A;  5D3J A;  5C87 A;  1ZS5 A;  2DVQ A;  5DKD A;  5DFB A;  3HME A;  4O71 A;  3S92 A;  3D7C A;  5CS8 A;  5C85 A;  5FE2 A;  1WUM A;  3QZS A;  5F60 A;  4DON A;  5HRX A;  2E7N A;  5F61 A;  3MB3 A;  4J0S A;  4QEV A;  5FFY A;  4UIX A;  3TLP A;  5E9M A;  5FE0 A;  4O70 A;  4PY6 A;  4A9L A;  3JVJ A;  4XYA A;  5D26 A;  5FE5 A;  3S91 A;  4QSQ A;  4O72 A;  5I89 A;  4CUT A;  5FBX A;  5CPE A;  3D1B A;  2DVR A;  2G4A A;  4XUB A;  4YH3 A;  3U5L A;  4J1P A;  4A9K A;  5C7N A;  4NUE A;  4QR3 A;  4QYD A;  5L98 A;  2OO1 A;  5EU1 A;  5H1U A;  5FFV A;  5FE1 A;  5HQ5 A;  4CUR A;  4TT6 A;  5D3P A;  3P1C A;  5DYC A;  5DX4 A;  4PCE A;  2WP1 A;  5FE8 A;  4O77 A;  4IR3 A;  5F63 A;  2RNW A;  5ETB A;  4OGJ A;  3U5N A;  5EQ1 A;  5FH7 A;  4C67 A;  4O7C A;  5F62 A;  4YBT A;  5E0R A;  5C8G A;  4QC1 A;  4WHU A;  5A5N A;  5HLS A;  5ENC A;  4PTB A;  5FE4 A;  5EWV A;  5DFC A;  5HM0 A;  4QUT A;  4NQN A;  5EGU A;  5KTU A;  4QBM A;  5D3S A;  4YYM A;  4Q0N A;  4QSV A;  1JSP B;  4UIT A;  5DYA A;  5ENG A;  2DKW A;  4YYH A;  5A85 A;  1WUG A;  4NR6 A;  5IBN A;  5ENH A;  5HQ7 A;  5D3H A;  3UVX A;  5E7D A;  5CP5 A;  4LR6 A;  4TT4 A;  3LQI A;  2YQD A;  4HXS A;  5EIC A;  4XUA A;  2YDW A;  2RO1 A;  5FB1 A;  5HFR A;  5IGL A;  4A9I A;  2I7K A;  4UIW A;  5C4Q A;  5EM3 A;  4QR4 A;  5FB0 A;  5DYX A;  3QZV A;  5DBM A;  1JM4 B;  4LYI A;  5HRW A;  3G0J A;  5LKZ A;  4LYS A;  5A5S A;  4IOQ A;  4LDF A;  4HBW A;  4XY8 A;  3UVY A;  5ACY A;  5IG6 A;  5JI8 A;  4BW4 A;  3U5J A;  3DWY A;  5EIS A;  5EWD A;  5D25 A;  4OGI A;  3JVL A;  4YAD A;  5F3A A;  4HXM A;  5DW2 A;  4YAB A;  4AKH A;  2YYN A;  5IGK A;  3UVW A;  3MXF A;  5EPB A;  5CQT A;  4MEP A;  4O7F A;  4LC2 A;  1PUO A;  5FG5 A;  4YBS A;  2F6J A;  4O7E A;  4A9J A;  2L5E A;  2E7O A;  5IGN A;  5HEL A;  3UV5 A;  5D7X A;  3LJW A;  4ZC9 A;  5A5P A;  5IGM A;  5L97 A;  5LVQ A;  4IOO A;  5KTW A;  2D9E A;  5AD2 A;  4BW1 A;  5CUD A;  3SVF A;  4NR8 A;  5HJC A;  3U5K A;  5CFW A;  5DKC A;  5F2P A;  4CUU A;  4XY9 A;  5CUB A;  5I29 A;  4AKG A;  3O34 A;  5DFD A;  4BW3 A;  4UYD A;  3P1E A;  3GG3 A;  4MR5 A;  4O74 A;  3QZT A;  4TU6 A;  3UVD A;  5FE6 A;  4N4H A;  1ZKR A;  4A9M A;  5DYU A;  5F1L A;  4AKI A;  4N4I A;  4YYI A;  4Z1S A;  4J0R A;  5FE3 A;  2WP2 A;  5KO4 A;  5F5Z A;  4LZ2 A;  4E96 A;  4HBY A;  2RNY A;  5I83 A;  2RS9 B;  5ENE A;  4QC3 A;  4Z6I A;  1F68 A;  4KCX A;  5TCM A;  5D24 A;  4A9F A;  5CUC A;  4N4F A;  3JVM A;  4QSS A;  4C66 A;  3HMH A;  4NUD A;  4TZ8 A;  5L99 A;  5CUG A;  3ERR A;  5KTX A;  2KTB B;  5FG6 A;  3MB4 A;  5C89 A;  4YAX A;  5I80 A;  5I7X A;  5BT3 A;  2YW5 A;  4NYX A;  5L96 A;  5F36 A;  5I1Q A;  5H85 A;  2H60 A;  4CFK A;  1E6I A;  5HCL A;  4NUC A;  5G4S A;  5L8T A;  3VKH A;  4MR6 A;  5KU3 A;  4O7B A;  5FDZ A;  4NRA A;  4YY4 A;  4QSX A;  5EV9 A;  3UV2 A;  4KV1 A;  5AD3 A;  5HRV A;  4YYD A;  5AMF A;  4CUP A;  2YEL A;  4LZR A;  4HXR A;  4O7A A;  4LRG A;  2R10 A;  3K2J A;  4KV4 A;  4Z6H A;  3Q2F A;  5EWW A;  4TT2 A;  5ENB A;  4CUS A;  5F1H A;  5E74 A;  5EK9 A;  4NR9 A;  4UIY A;  4YK0 A;  3Q2E A;  3ONI A;  4UYF A;  5LKT A;  5E73 A;  5ETD A;  2R0V A;  5FG4 A;  4QY4 A;  5DW1 A;  4Z93 A;  4YYJ A;  4HXP A;  1N72 A;  5D0C A;  5I88 A;  3G0L A;  5FE7 A;  4TZ2 A;  5DKH A;  5DLX A;  5JWM A;  3U5P A;  5LJ1 A;  4OUF A;  3NXB A;  4MEO A;  2OUO A;  3O37 A;  4RVR A;  5A5Q A;  5LVR A;  3RCW A;  5E9K A;  4YYK A;  2DVS A;  5LJ0 A;  3AQA A;  4AKN A;  4WIV A;  3SVH A;  5A7C A;  3IU6 A;  5CTL A;  5CQ5 A;  5A81 A;  4A9O A;  4Q0O A;  5II1 A;  2YEK A;  4BJX A;  4NRC A;  4NYV A;  4UYH A;  4BW2 A;  2DAT A;  5F25 A;  5EP7 A;  5I7Y A;  4TYL A;  4QZS A;  5HQ6 A;  5EVA A;  4ZW1 A;  4PS5 A;  2FSA A;  5HEN A;  5HEM A;  4ALH A;  4UIV A;  3MQM A;  3HMF A;  2EJN A;  4CL9 A;  3I3J A;  3IU5 A;  3O33 A;  4HBV A;  4N4G A;  5E3G A;  4BHW A;  4CLB A;  5LUU A;  5ENI A;  5E9V A;  4YBM A;  5EI4 A;  4ALG A;  4LYW A;  5CQ8 A;  3P5O A;  2L85 A;  4Y03 A;  5EA1 A;  4IR5 A;  3VKG A;  3ZYU A;  3LQH A;  5II2 A;  5CU8 A;  5CRM A;  5BT4 A; 
#chains in the Genus database with same CATH homology
 3AAD A;  5EPS A;  2R0S A;  5H1T A;  4Z1Q A;  5D3N A;  4HXK A;  4QSU A;  5A83 A;  4QSW A;  4NQM A;  4MEN A;  3P1D A;  3U5M A;  5CQ4 A;  3P1F A;  2RNX A;  5A82 A;  4PKL A;  5FE9 A;  5KHM A;  5TB6 A;  2E3K A;  2YEM A;  3DAI A;  2DWW A;  5I40 A;  2F6N A;  3FKM X;  5FH8 A;  5COI A;  4UYE A;  2R0Y A;  4QSP A;  4QYL A;  5CUA A;  4NR5 A;  3LQJ A;  5H1V A;  1X0J A;  4QST A;  4J3I A;  4YYG A;  4TQN A;  5K29 A;  5HFQ A;  5CQ7 A;  5CQ6 A;  4PCI A;  2I8N A;  5FH6 A;  4IR6 A;  4FLP A;  5LJ2 A;  5DY7 A;  4TTE A;  4NS5 A;  4HXO A;  4LZS A;  4ZQL A;  1EQF A;  5CQA A;  5L8U A;  4QUU A;  3U5O A;  2L84 A;  5D3R A;  2OSS A;  5ENJ A;  4O78 A;  5CRZ A;  5EPR A;  3O35 A;  3UW9 A;  4UIZ A;  4TU4 A;  3SVG A;  4NYW A;  4CUQ A;  2D82 A;  4F3I A;  4MR3 A;  4QEU A;  4A9N A;  4WHW A;  2RI7 A;  4O75 A;  5E9Y A;  4IR4 A;  4QR5 A;  2RFJ A;  4QSR A;  4NRB A;  5E9I A;  2DVV A;  4QB3 A;  5D3L A;  4UYG A;  4QEW A;  4HXN A;  5CQ3 A;  4N3W A;  4NXJ A;  2MJV B;  4TS8 A;  5BT5 A;  4A9H A;  4CFL A;  5ENF A;  5FFW A;  5LKX A;  4NR7 A;  5D3T A;  2N9G A;  4YYN A;  3UV4 A;  3LXJ A;  5CY9 A;  4YY6 A;  5AME A;  4UYF B;  5EWH A;  3O36 A;  4YAT A;  5EWC A;  5G4R A;  5J0D A;  4GPJ A;  5IID A;  5I86 A;  3MUL A;  4QNS A;  5LKU A;  2LSP B;  2NXB A;  4UIU A;  4IOR A;  4O76 A;  4A9E A;  5DLZ A;  4X2I A;  4YC9 A;  4HBX A;  5E9L A;  5CUE A;  5E3D A;  2GRC A;  4NR4 A;  3MUK A;  4MR4 A;  3JVK A;  4HXL A;  5CGP A;  5CZG A;  4YH4 A;  5A5R A;  5A5O A;  4MEQ A;  5D3J A;  5C87 A;  1ZS5 A;  2DVQ A;  5DKD A;  5DFB A;  3HME A;  4O71 A;  3S92 A;  3D7C A;  5CS8 A;  5C85 A;  5FE2 A;  1WUM A;  3QZS A;  5F60 A;  4DON A;  5HRX A;  2E7N A;  5F61 A;  3MB3 A;  4J0S A;  4QEV A;  5FFY A;  4UIX A;  3TLP A;  5E9M A;  5FE0 A;  4O70 A;  4PY6 A;  4A9L A;  3JVJ A;  4XYA A;  5D26 A;  5FE5 A;  3S91 A;  4QSQ A;  4O72 A;  5I89 A;  4CUT A;  5FBX A;  5CPE A;  2DVR A;  2G4A A;  4XUB A;  4YH3 A;  3U5L A;  4J1P A;  4A9K A;  5C7N A;  4NUE A;  4QR3 A;  4QYD A;  5L98 A;  2OO1 A;  5EU1 A;  5H1U A;  5FFV A;  5FE1 A;  5HQ5 A;  4CUR A;  4TT6 A;  5D3P A;  3P1C A;  5DYC A;  5DX4 A;  4PCE A;  2WP1 A;  5FE8 A;  4O77 A;  4IR3 A;  5F63 A;  2RNW A;  5ETB A;  4OGJ A;  3U5N A;  5EQ1 A;  5FH7 A;  4C67 A;  4O7C A;  5F62 A;  4YBT A;  5E0R A;  5C8G A;  4QC1 A;  4WHU A;  5A5N A;  5HLS A;  5ENC A;  4PTB A;  5FE4 A;  5EWV A;  5DFC A;  5HM0 A;  4QUT A;  4NQN A;  5EGU A;  5KTU A;  4QBM A;  5D3S A;  4YYM A;  4Q0N A;  4QSV A;  1JSP B;  4UIT A;  5DYA A;  5ENG A;  2DKW A;  4YYH A;  5A85 A;  1WUG A;  4NR6 A;  5IBN A;  5ENH A;  5HQ7 A;  5D3H A;  3UVX A;  5E7D A;  5CP5 A;  4LR6 A;  4TT4 A;  3LQI A;  2YQD A;  4HXS A;  5EIC A;  4XUA A;  2YDW A;  2RO1 A;  5FB1 A;  5HFR A;  5IGL A;  4A9I A;  2I7K A;  4UIW A;  5C4Q A;  5EM3 A;  4QR4 A;  5FB0 A;  5DYX A;  3QZV A;  5DBM A;  1JM4 B;  4LYI A;  5HRW A;  3G0J A;  5LKZ A;  4LYS A;  5A5S A;  4IOQ A;  4LDF A;  4HBW A;  4XY8 A;  3UVY A;  5ACY A;  5IG6 A;  5JI8 A;  4BW4 A;  3U5J A;  3DWY A;  5EIS A;  5EWD A;  5D25 A;  4OGI A;  3JVL A;  4YAD A;  5F3A A;  4HXM A;  5DW2 A;  4YAB A;  2YYN A;  5IGK A;  3UVW A;  3MXF A;  5EPB A;  5CQT A;  4MEP A;  4O7F A;  4LC2 A;  5FG5 A;  4YBS A;  2F6J A;  4O7E A;  4A9J A;  2L5E A;  2E7O A;  5IGN A;  5HEL A;  3UV5 A;  5D7X A;  3LJW A;  4ZC9 A;  5A5P A;  5IGM A;  5L97 A;  5LVQ A;  4IOO A;  5KTW A;  2D9E A;  5AD2 A;  4BW1 A;  5CUD A;  3SVF A;  4NR8 A;  5HJC A;  3U5K A;  5CFW A;  5DKC A;  5F2P A;  4CUU A;  4XY9 A;  5CUB A;  5I29 A;  3O34 A;  5DFD A;  4BW3 A;  4UYD A;  3P1E A;  3GG3 A;  4MR5 A;  4O74 A;  3QZT A;  4TU6 A;  3UVD A;  5FE6 A;  4N4H A;  4A9M A;  5DYU A;  5F1L A;  4N4I A;  4YYI A;  4Z1S A;  4J0R A;  5FE3 A;  2WP2 A;  5KO4 A;  5F5Z A;  4LZ2 A;  4E96 A;  4HBY A;  2RNY A;  5I83 A;  2RS9 B;  5ENE A;  4QC3 A;  4Z6I A;  1F68 A;  4KCX A;  5TCM A;  5D24 A;  4A9F A;  5CUC A;  4N4F A;  3JVM A;  4QSS A;  4C66 A;  3HMH A;  4NUD A;  4TZ8 A;  5L99 A;  5CUG A;  5KTX A;  2KTB B;  5FG6 A;  3MB4 A;  5C89 A;  4YAX A;  5I80 A;  5I7X A;  5BT3 A;  2YW5 A;  4NYX A;  5L96 A;  5F36 A;  5I1Q A;  5H85 A;  2H60 A;  4CFK A;  1E6I A;  5HCL A;  4NUC A;  5G4S A;  5L8T A;  4MR6 A;  5KU3 A;  4O7B A;  5FDZ A;  4NRA A;  4YY4 A;  4QSX A;  5EV9 A;  3UV2 A;  4KV1 A;  5AD3 A;  5HRV A;  4YYD A;  5AMF A;  4CUP A;  2YEL A;  4LZR A;  4HXR A;  4O7A A;  4LRG A;  2R10 A;  3K2J A;  4KV4 A;  4Z6H A;  3Q2F A;  5EWW A;  4TT2 A;  5ENB A;  4CUS A;  5F1H A;  5E74 A;  5EK9 A;  4NR9 A;  4UIY A;  4YK0 A;  3Q2E A;  3ONI A;  4UYF A;  5LKT A;  5E73 A;  5ETD A;  2R0V A;  5FG4 A;  4QY4 A;  5DW1 A;  4Z93 A;  4YYJ A;  4HXP A;  1N72 A;  5D0C A;  5I88 A;  3G0L A;  5FE7 A;  4TZ2 A;  5DKH A;  5DLX A;  5JWM A;  3U5P A;  5LJ1 A;  4OUF A;  3NXB A;  4MEO A;  2OUO A;  3O37 A;  4RVR A;  5A5Q A;  5LVR A;  3RCW A;  5E9K A;  4YYK A;  2DVS A;  5LJ0 A;  3AQA A;  4AKN A;  4WIV A;  3SVH A;  5A7C A;  3IU6 A;  5CTL A;  5CQ5 A;  5A81 A;  4A9O A;  4Q0O A;  5II1 A;  2YEK A;  4BJX A;  4NRC A;  4NYV A;  4UYH A;  4BW2 A;  2DAT A;  5F25 A;  5EP7 A;  5I7Y A;  4TYL A;  4QZS A;  5HQ6 A;  5EVA A;  4ZW1 A;  4PS5 A;  2FSA A;  5HEN A;  5HEM A;  4ALH A;  4UIV A;  3MQM A;  3HMF A;  4CL9 A;  3I3J A;  3IU5 A;  3O33 A;  4HBV A;  4N4G A;  5E3G A;  4BHW A;  4CLB A;  5LUU A;  5ENI A;  5E9V A;  4YBM A;  5EI4 A;  4ALG A;  4LYW A;  5CQ8 A;  3P5O A;  2L85 A;  4Y03 A;  5EA1 A;  4IR5 A;  3ZYU A;  3LQH A;  5II2 A;  5CU8 A;  5CRM A;  5BT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...