3RCWA

Crystal structure of the bromodomain of human brd1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
LRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3rcwA00
4WHWA 5LKZA 5FBXA 4UYGA 4TS8A 5LKXA 5L96A 5HRVA 5A5PA 4HXLA 3QZSA 5FFWA 3U5OA 5CZGA 3MXFA 4N4GA 1E6IA 2R0SA 5D25A 4YY4A 4PCEA 4YYHA 5CQ6A 5DFCA 4NR8A 4YADA 5DX4A 5D3TA 2MJVB 4A9JA 3JVMA 5EISA 4QY4A 5FE5A 4TZ2A 4Q0OA 3UVXA 4QR3A 4YBTA 5D3SA 3O34A 4MR4A 5A5QA 4QEVA 5AMFA 5CUBA 4J0SA 2WP2A 5F63A 4Z6IA 5IGKA 5E7DA 3UW9A 5CUAA 5DKDA 4ZQLA 4CL9A 5LJ2A 1JSPB 5EPBA 5HQ5A 3RCWA 5I1QA 5E73A 2YYNA 3D7CA 5L99A 5CPEA 4NUCA 4YYMA 4ALHA 5FG5A 4OUFA 5CUEA 2R0VA 5ENFA 3AQAA 5LUUA 3GG3A 3K2JA 3O36A 4TTEA 3U5NA 5HELA 3MB3A 3JVJA 4HXSA 5HENA 4QEWA 5IG6A 4PCIA 4HXPA 5EQ1A 4XUAA 4TYLA 4TT6A 5JWMA 4RVRA 4TT4A 5D3HA 3U5JA 5CRZA 5E9YA 5EWWA 3JVKA 3NXBA 2DVSA 4HBYA 5LVQA 4UIXA 5E9LA 4TT2A 5D26A 4A9NA 1WUGA 5D3RA 3QZVA 4N4HA 5F60A 4NYWA 4C66A 4DONA 5L8TA 5A7CA 4MR5A 3JVLA 5HCLA 4A9IA 5CY9A 5HQ6A 4NR5A 5EWCA 5E9VA 3G0LA 5AD2A 3IU5A 5D3NA 4PTBA 5EICA 4QYLA 4BW4A 4QB3A 4HXRA 4Z6HA 2GRCA 5IIDA 5DYCA 5EA1A 3UV2A 5FDZA 4A9KA 2YEMA 5FH8A 5I89A 5HRWA 5D3JA 5CUGA 5A5NA 2WP1A 5DBMA 5FE3A 5TB6A 4J1PA 5IGMA 4J3IA 4NR7A 4UYHA 2DVRA 3LQJA 4QYDA 5CRMA 2RO1A 5H1VA 3FKMX 4XUBA 3DWYA 5JI8A 5A85A 2YDWA 4O77A 5FH6A 4QSXA 4GPJA 3UVDA 5EWVA 4PY6A 4LDFA 4YYGA 4QSPA 5C4QA 2H60A 4E96A 3U5PA 5CQ7A 2YEKA 5EWDA 5DKHA 5EK9A 5CGPA 4O74A 5FE1A 5KO4A 5A82A 4BJXA 5ENCA 5C7NA 4HXMA 4UIWA 5I80A 2R10A 4UYFA 2F6NA 2RI7A 4HBXA 2YW5A 5I86A 3O35A 4CLBA 3HMHA 4QUTA 2RNWA 4YYDA 4N4IA 5HRXA 5CP5A 4CFLA 3P1EA 5ENIA 3UVYA 2DATA 5LJ0A 4NXJA 4ZW1A 2L5EA 4WHUA 5II2A 5IGNA 4A9OA 2FSAA 4QSWA 4HBVA 5BT3A 5EGUA 4TU4A 4O72A 5E3GA 5AD3A 4LYWA 4QSRA 3MQMA 3U5LA 5F1LA 4NS5A 5ETDA 4X2IA 5LKTA 5D24A 5K29A 3MULA 2D82A 3TLPA 5KTXA 4A9LA 5FH7A 4N3WA 4CFKA 5ENBA 4YH3A 3Q2FA 5C8GA 4UIZA 5C89A 5F25A 2L85A 4NR9A 5H85A 4TZ8A 4O71A 5FE8A 4O70A 5E74A 5CTLA 4LYIA 4UYEA 5I7XA 5FE0A 1EQFA 5FE6A 2RFJA 5F2PA 4MEQA 4YAXA 4QUUA 5DW2A 5FE4A 3Q2EA 5J0DA 4UIVA 5EM3A 4LR6A 4XYAA 5HM0A 5A81A 4YBMA 2RS9B 5E9IA 4CUQA 3SVFA 5BT5A 4A9EA 4O75A 4YH4A 1WUMA 3S92A 5FG6A 4FLPA 4NQNA 4A9FA 3MB4A 5H1TA 4N4FA 3HMFA 3LQIA 4MR3A 4NR6A 5DFDA 4HXOA 5II1A 5ENHA 5CUDA 5FE9A 4PS5A 5HQ7A 2OUOA 4O7FA 3SVGA 4ZC9A 4UYFB 3ZYUA 4LZ2A 4YYKA 4MENA 5CQAA 5DY7A 2KTBB 5I83A 3S91A 4IR6A 5CS8A 2E7OA 4Z1QA 5FG4A 4KV4A 4NQMA 4NRBA 4QSTA 3LXJA 5DLXA 5HJCA 4WIVA 5DLZA 4NRCA 4O7EA 4AKNA 4UYDA 4QNSA 3HMEA 5ACYA 4QSUA 5D3PA 4ALGA 5CQTA 4IOQA 5FB1A 5D7XA 5A5OA 5L8UA 5FE2A 4CUUA 3UV4A 4LC2A 4YK0A 5EU1A 5F3AA 3IU6A 2YELA 4KV1A 4QR4A 5D3LA 4QR5A 5I29A 5A83A 2D9EA 4MR6A 4O7AA 5F61A 4YYJA 4UIYA 5LJ1A 4TU6A 4QSQA 4LYSA 4HXNA 5KU3A 5H1UA 4CUSA 5DYXA 4CUPA 4UIUA 4PKLA 2OO1A 3G0JA 3LQHA 5HFRA 4Y03A 5LVRA 4QSVA 2I8NA 4A9HA 5C85A 2E7NA 4IOOA 3I3JA 5EP7A 4J0RA 4MEPA 5DKCA 3P1DA 2YQDA 4YABA 4NYVA 3SVHA 5DYAA 5EWHA 5E0RA 5F5ZA 4IR3A 5ENGA 5A5SA 5LKUA 2F6JA 1F68A 2RNXA 4OGJA 5DW1A 5C87A 4OGIA 2RNYA 5I40A 2DWWA 5E3DA 5CFWA 4O7BA 5ENEA 4CUTA 4MEOA 4Z93A 5E9KA 5EV9A 5HFQA 5ENJA 5EVAA 5A5RA 4O78A 2LSPB 3AADA 2R0YA 4TQNA 4YBSA 4KCXA 3LJWA 4YC9A 4BHWA 5CQ4A 2DVQA 5KTWA 5AMEA 3P1FA 5D0CA 4CURA 1JM4B 5CQ3A 5L97A 5HLSA 5EI4A 4YYNA 4NRAA 5F62A 1N72A 4XY8A 2NXBA 5E9MA 5FE7A 5COIA 5TCMA 4UITA 2L84A 5FB0A 4C67A 3U5MA 3DAIA 4IORA 5DYUA 4XY9A 4YYIA 4F3IA 2DVVA 4O7CA 2G4AA 2DKWA 3UV5A 3P1CA 5KTUA 5L98A 5IBNA 4NR4A 4O76A 3UVWA 3ONIA 3MUKA 5F1HA 5I88A 5EPRA 4A9MA 5DFBA 1ZS5A 5ETBA 2OSSA 4HBWA 3O37A 4NUEA 3O33A 4LZRA 4QEUA 5G4SA 5HEMA 4IR4A 3QZTA 4HXKA 3U5KA 5BT4A 4YATA 5CU8A 5G4RA 5I7YA 3P5OA 5EPSA 5CUCA 5KHMA 5FFVA 2I7KA 4YY6A 2N9GA 4BW2A 4NYXA 4Q0NA 4NUDA 5CQ5A 1X0JA 4QC3A 5IGLA 5CQ8A 4BW3A 4QSSA 5FFYA 4Z1SA 4QC1A 4IR5A 4QZSA 4LZSA 4LRGA 4QBMA 2E3KA 4BW1A 5F36A
chains in the Genus database with same CATH superfamily
4WHWA 5LKZA 5FBXA 4UYGA 4TS8A 5LKXA 5L96A 5HRVA 5A5PA 4HXLA 3QZSA 5FFWA 3U5OA 5CZGA 3MXFA 4N4GA 1E6IA 2R0SA 5D25A 4YY4A 4PCEA 4YYHA 5CQ6A 5DFCA 4NR8A 4YADA 5DX4A 5D3TA 2MJVB 4A9JA 3JVMA 5EISA 4QY4A 5FE5A 4TZ2A 4Q0OA 3UVXA 4QR3A 4YBTA 5D3SA 3O34A 4MR4A 5A5QA 4QEVA 5AMFA 5CUBA 4J0SA 2WP2A 5F63A 4Z6IA 5IGKA 5E7DA 3UW9A 5CUAA 5DKDA 4ZQLA 4CL9A 5LJ2A 1JSPB 5EPBA 5HQ5A 3RCWA 5I1QA 5E73A 2YYNA 3D7CA 5L99A 5CPEA 4NUCA 4YYMA 4ALHA 5FG5A 4OUFA 5CUEA 2R0VA 5ENFA 3AQAA 5LUUA 3GG3A 3D1DA 3K2JA 3O36A 4TTEA 3U5NA 5HELA 3MB3A 3JVJA 4HXSA 5HENA 4QEWA 5IG6A 4PCIA 4HXPA 5EQ1A 4XUAA 4TYLA 4TT6A 5JWMA 4RVRA 4TT4A 5D3HA 3U5JA 5CRZA 5E9YA 5EWWA 3JVKA 3NXBA 2DVSA 4HBYA 5LVQA 4UIXA 5E9LA 4TT2A 5D26A 4A9NA 1WUGA 5D3RA 3QZVA 4N4HA 5F60A 4NYWA 4C66A 4DONA 5L8TA 5A7CA 4MR5A 3JVLA 5HCLA 4A9IA 5CY9A 5HQ6A 4NR5A 5EWCA 5E9VA 3G0LA 5AD2A 3IU5A 5D3NA 4PTBA 5EICA 4QYLA 4BW4A 4QB3A 4HXRA 4Z6HA 2GRCA 5IIDA 5DYCA 5EA1A 3UV2A 5FDZA 4A9KA 2YEMA 5FH8A 5I89A 5HRWA 5D3JA 5CUGA 5A5NA 2WP1A 5DBMA 5FE3A 5TB6A 4J1PA 5IGMA 4J3IA 4NR7A 4UYHA 2DVRA 3LQJA 4QYDA 5CRMA 2RO1A 5H1VA 3FKMX 4XUBA 3DWYA 5JI8A 5A85A 2YDWA 4O77A 5FH6A 4QSXA 4GPJA 3UVDA 5EWVA 4PY6A 4LDFA 4YYGA 4QSPA 5C4QA 2H60A 4E96A 3U5PA 5CQ7A 2YEKA 5EWDA 5DKHA 5EK9A 5CGPA 4O74A 5FE1A 3VKGA 5KO4A 5A82A 4BJXA 5ENCA 5C7NA 4HXMA 4UIWA 5I80A 2R10A 4UYFA 2F6NA 2RI7A 4HBXA 2YW5A 5I86A 3O35A 4CLBA 3HMHA 4QUTA 2RNWA 4YYDA 4N4IA 5HRXA 5CP5A 4CFLA 3P1EA 5ENIA 3UVYA 2DATA 5LJ0A 4NXJA 4ZW1A 2L5EA 4WHUA 5II2A 5IGNA 4A9OA 2FSAA 4QSWA 4HBVA 5BT3A 5EGUA 4TU4A 4O72A 5E3GA 5AD3A 4LYWA 4QSRA 3MQMA 3U5LA 5F1LA 4AKHA 4NS5A 5ETDA 4X2IA 5LKTA 1PUOA 5D24A 5K29A 3MULA 2D82A 3TLPA 5KTXA 4A9LA 5FH7A 4N3WA 4CFKA 5ENBA 4YH3A 3Q2FA 5C8GA 4UIZA 5C89A 5F25A 2L85A 4NR9A 5H85A 4TZ8A 4O71A 5FE8A 4O70A 5E74A 5CTLA 4LYIA 4UYEA 5I7XA 5FE0A 1EQFA 5FE6A 2RFJA 5F2PA 4MEQA 4YAXA 4QUUA 5DW2A 5FE4A 3Q2EA 5J0DA 4UIVA 5EM3A 4LR6A 4XYAA 5HM0A 5A81A 4YBMA 2RS9B 5E9IA 4CUQA 3SVFA 5BT5A 4A9EA 4O75A 4YH4A 1WUMA 3S92A 5FG6A 4FLPA 4NQNA 4A9FA 3MB4A 5H1TA 4N4FA 3HMFA 3LQIA 4MR3A 4NR6A 5DFDA 4HXOA 5II1A 5ENHA 5CUDA 5FE9A 4PS5A 5HQ7A 2OUOA 4O7FA 3SVGA 4ZC9A 4UYFB 3ZYUA 4LZ2A 4YYKA 4MENA 5CQAA 5DY7A 2KTBB 5I83A 3S91A 4IR6A 5CS8A 2E7OA 4Z1QA 5FG4A 4KV4A 4NQMA 4NRBA 4QSTA 3LXJA 5DLXA 5HJCA 4WIVA 5DLZA 4NRCA 4O7EA 4AKNA 4UYDA 4QNSA 3HMEA 5ACYA 4QSUA 5D3PA 4ALGA 5CQTA 4IOQA 5FB1A 5D7XA 5A5OA 5L8UA 5FE2A 4CUUA 3UV4A 4LC2A 4YK0A 5EU1A 5F3AA 2YELA 3IU6A 4KV1A 4QR4A 5D3LA 4QR5A 5I29A 5A83A 2D9EA 4MR6A 4O7AA 5F61A 4YYJA 4UIYA 5LJ1A 4TU6A 4QSQA 4LYSA 4HXNA 5KU3A 4AKGA 5H1UA 4CUSA 5DYXA 3ERRA 4CUPA 4UIUA 4PKLA 2OO1A 3G0JA 3LQHA 5HFRA 4Y03A 5LVRA 4QSVA 4AI6A 2I8NA 4A9HA 5C85A 2E7NA 4IOOA 3I3JA 5EP7A 4J0RA 4MEPA 5DKCA 3P1DA 2YQDA 4YABA 4NYVA 3SVHA 5DYAA 5EWHA 5E0RA 5F5ZA 4IR3A 5ENGA 5A5SA 5LKUA 2F6JA 1F68A 2RNXA 4OGJA 5DW1A 5C87A 4OGIA 2RNYA 5I40A 2DWWA 5E3DA 5CFWA 4O7BA 5ENEA 4CUTA 4MEOA 4Z93A 5E9KA 5EV9A 5HFQA 5ENJA 5EVAA 5A5RA 4O78A 2LSPB 3AADA 2R0YA 4TQNA 4YBSA 4KCXA 1ZKRA 3LJWA 4YC9A 4BHWA 3D1BA 5CQ4A 2DVQA 5KTWA 5AMEA 3P1FA 5D0CA 2EJNA 4CURA 1JM4B 5CQ3A 5L97A 5HLSA 5EI4A 4YYNA 4NRAA 5F62A 1N72A 4XY8A 2NXBA 5E9MA 5FE7A 5COIA 5TCMA 4UITA 2L84A 5FB0A 4C67A 3U5MA 3DAIA 4IORA 5DYUA 4XY9A 4YYIA 4F3IA 2DVVA 4O7CA 2G4AA 2DKWA 3UV5A 3P1CA 5KTUA 5L98A 5IBNA 4NR4A 4O76A 3UVWA 3ONIA 3MUKA 5F1HA 5I88A 5EPRA 4A9MA 5DFBA 1ZS5A 5ETBA 2OSSA 4HBWA 3O37A 4NUEA 3O33A 4LZRA 4QEUA 5G4SA 5HEMA 4IR4A 3QZTA 4HXKA 3U5KA 5BT4A 4YATA 5CU8A 5G4RA 5I7YA 3P5OA 3VKHA 5EPSA 5CUCA 5KHMA 5FFVA 2I7KA 4YY6A 2N9GA 4BW2A 4AKIA 4NYXA 4Q0NA 4NUDA 5CQ5A 1X0JA 4QC3A 5IGLA 5CQ8A 4BW3A 4QSSA 5FFYA 4Z1SA 4QC1A 4IR5A 4QZSA 4LZSA 4LRGA 4QBMA 2E3KA 4BW1A 5F36A
chains in the Genus database with same CATH topology
4WHWA 5LKZA 5FBXA 4UYGA 4TS8A 5LKXA 5L96A 5HRVA 5A5PA 4HXLA 3QZSA 5FFWA 3U5OA 5CZGA 3MXFA 4N4GA 1E6IA 2R0SA 5D25A 4YY4A 4PCEA 4YYHA 5CQ6A 5DFCA 4NR8A 4YADA 5DX4A 5D3TA 2MJVB 4A9JA 3JVMA 5EISA 4QY4A 5FE5A 4TZ2A 4Q0OA 3UVXA 4QR3A 4YBTA 5D3SA 3O34A 4MR4A 5A5QA 4QEVA 5AMFA 5CUBA 4J0SA 2WP2A 5F63A 4Z6IA 5IGKA 5E7DA 3UW9A 5CUAA 5DKDA 4ZQLA 4CL9A 5LJ2A 1JSPB 5EPBA 5HQ5A 3RCWA 5I1QA 5E73A 2YYNA 3D7CA 5L99A 5CPEA 4NUCA 4YYMA 4ALHA 5FG5A 4OUFA 5CUEA 2R0VA 5ENFA 3AQAA 5LUUA 3GG3A 3K2JA 3O36A 4TTEA 3U5NA 5HELA 3MB3A 3JVJA 4HXSA 5HENA 4QEWA 5IG6A 4PCIA 4HXPA 5EQ1A 4XUAA 4TYLA 4TT6A 5JWMA 4RVRA 4TT4A 5D3HA 3U5JA 5CRZA 5E9YA 5EWWA 3JVKA 3NXBA 2DVSA 4HBYA 5LVQA 4UIXA 5E9LA 4TT2A 5D26A 4A9NA 1WUGA 5D3RA 3QZVA 4N4HA 5F60A 4NYWA 4C66A 4DONA 5L8TA 5A7CA 4MR5A 3JVLA 5HCLA 4A9IA 5CY9A 5HQ6A 4NR5A 5EWCA 5E9VA 3G0LA 5AD2A 3IU5A 5D3NA 4PTBA 5EICA 4QYLA 4BW4A 4QB3A 4HXRA 4Z6HA 2GRCA 5IIDA 5DYCA 5EA1A 3UV2A 5FDZA 4A9KA 2YEMA 5FH8A 5I89A 5HRWA 5D3JA 5CUGA 5A5NA 2WP1A 5DBMA 5FE3A 5TB6A 4J1PA 5IGMA 4J3IA 4NR7A 4UYHA 2DVRA 3LQJA 4QYDA 5CRMA 2RO1A 5H1VA 3FKMX 4XUBA 3DWYA 5JI8A 5A85A 2YDWA 4O77A 5FH6A 4QSXA 4GPJA 3UVDA 5EWVA 4PY6A 4LDFA 4YYGA 4QSPA 5C4QA 2H60A 4E96A 3U5PA 5CQ7A 2YEKA 5EWDA 5DKHA 5EK9A 5CGPA 4O74A 5FE1A 5KO4A 5A82A 4BJXA 5ENCA 5C7NA 4HXMA 4UIWA 5I80A 2R10A 4UYFA 2F6NA 2RI7A 4HBXA 2YW5A 5I86A 3O35A 4CLBA 3HMHA 4QUTA 2RNWA 4YYDA 4N4IA 5HRXA 5CP5A 4CFLA 3P1EA 5ENIA 3UVYA 2DATA 5LJ0A 4NXJA 4ZW1A 2L5EA 4WHUA 5II2A 5IGNA 4A9OA 2FSAA 4QSWA 4HBVA 5BT3A 5EGUA 4TU4A 4O72A 5E3GA 5AD3A 4LYWA 4QSRA 3MQMA 3U5LA 5F1LA 4NS5A 5ETDA 4X2IA 5LKTA 5D24A 5K29A 3MULA 2D82A 3TLPA 5KTXA 4A9LA 5FH7A 4N3WA 4CFKA 5ENBA 4YH3A 3Q2FA 5C8GA 4UIZA 5C89A 5F25A 2L85A 4NR9A 5H85A 4TZ8A 4O71A 5FE8A 4O70A 5E74A 5CTLA 4LYIA 4UYEA 5I7XA 5FE0A 1EQFA 5FE6A 2RFJA 5F2PA 4MEQA 4YAXA 4QUUA 5DW2A 5FE4A 3Q2EA 5J0DA 4UIVA 5EM3A 4LR6A 4XYAA 5HM0A 5A81A 4YBMA 2RS9B 5E9IA 4CUQA 3SVFA 5BT5A 4A9EA 4O75A 4YH4A 1WUMA 3S92A 5FG6A 4FLPA 4NQNA 4A9FA 3MB4A 5H1TA 4N4FA 3HMFA 3LQIA 4MR3A 4NR6A 5DFDA 4HXOA 5II1A 5ENHA 5CUDA 5FE9A 4PS5A 5HQ7A 2OUOA 4O7FA 3SVGA 4ZC9A 4UYFB 3ZYUA 4LZ2A 4YYKA 4MENA 5CQAA 5DY7A 2KTBB 5I83A 3S91A 4IR6A 5CS8A 2E7OA 4Z1QA 5FG4A 4KV4A 4NQMA 4NRBA 4QSTA 3LXJA 5DLXA 5HJCA 4WIVA 5DLZA 4NRCA 4O7EA 4AKNA 4UYDA 4QNSA 3HMEA 5ACYA 4QSUA 5D3PA 4ALGA 5CQTA 4IOQA 5FB1A 5D7XA 5A5OA 5L8UA 5FE2A 4CUUA 3UV4A 4LC2A 4YK0A 5EU1A 5F3AA 3IU6A 2YELA 4KV1A 4QR4A 5D3LA 4QR5A 5I29A 5A83A 2D9EA 4MR6A 4O7AA 5F61A 4YYJA 4UIYA 5LJ1A 4TU6A 4QSQA 4LYSA 4HXNA 5KU3A 5H1UA 4CUSA 5DYXA 4CUPA 4UIUA 4PKLA 2OO1A 3G0JA 3LQHA 5HFRA 4Y03A 5LVRA 4QSVA 2I8NA 4A9HA 5C85A 2E7NA 4IOOA 3I3JA 5EP7A 4J0RA 4MEPA 5DKCA 3P1DA 2YQDA 4YABA 4NYVA 3SVHA 5DYAA 5EWHA 5E0RA 5F5ZA 4IR3A 5ENGA 5A5SA 5LKUA 2F6JA 1F68A 2RNXA 4OGJA 5DW1A 5C87A 4OGIA 2RNYA 5I40A 2DWWA 5E3DA 5CFWA 4O7BA 5ENEA 4CUTA 4MEOA 4Z93A 5E9KA 5EV9A 5HFQA 5ENJA 5EVAA 5A5RA 4O78A 2LSPB 3AADA 2R0YA 4TQNA 4YBSA 4KCXA 3LJWA 4YC9A 4BHWA 5CQ4A 2DVQA 5KTWA 5AMEA 3P1FA 5D0CA 4CURA 1JM4B 5CQ3A 5L97A 5HLSA 5EI4A 4YYNA 4NRAA 5F62A 1N72A 4XY8A 2NXBA 5E9MA 5FE7A 5COIA 5TCMA 4UITA 2L84A 5FB0A 4C67A 3U5MA 3DAIA 4IORA 5DYUA 4XY9A 4YYIA 4F3IA 2DVVA 4O7CA 2G4AA 2DKWA 3UV5A 3P1CA 5KTUA 5L98A 5IBNA 4NR4A 4O76A 3UVWA 3ONIA 3MUKA 5F1HA 5I88A 5EPRA 4A9MA 5DFBA 1ZS5A 5ETBA 2OSSA 4HBWA 3O37A 4NUEA 3O33A 4LZRA 4QEUA 5G4SA 5HEMA 4IR4A 3QZTA 4HXKA 3U5KA 5BT4A 4YATA 5CU8A 5G4RA 5I7YA 3P5OA 5EPSA 5CUCA 5KHMA 5FFVA 2I7KA 4YY6A 2N9GA 4BW2A 4NYXA 4Q0NA 4NUDA 5CQ5A 1X0JA 4QC3A 5IGLA 5CQ8A 4BW3A 4QSSA 5FFYA 4Z1SA 4QC1A 4IR5A 4QZSA 4LZSA 4LRGA 4QBMA 2E3KA 4BW1A 5F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHW A;  5LKZ A;  5FBX A;  4UYG A;  4TS8 A;  5LKX A;  5L96 A;  5HRV A;  5A5P A;  4HXL A;  3QZS A;  5FFW A;  3U5O A;  5CZG A;  3MXF A;  4N4G A;  1E6I A;  2R0S A;  5D25 A;  4YY4 A;  4PCE A;  4YYH A;  5CQ6 A;  5DFC A;  4NR8 A;  4YAD A;  5DX4 A;  5D3T A;  2MJV B;  4A9J A;  3JVM A;  5EIS A;  4QY4 A;  5FE5 A;  4TZ2 A;  4Q0O A;  3UVX A;  4QR3 A;  4YBT A;  5D3S A;  3O34 A;  4MR4 A;  5A5Q A;  4QEV A;  5AMF A;  5CUB A;  4J0S A;  2WP2 A;  5F63 A;  4Z6I A;  5IGK A;  5E7D A;  3UW9 A;  5CUA A;  5DKD A;  4ZQL A;  4CL9 A;  5LJ2 A;  1JSP B;  5EPB A;  5HQ5 A;  3RCW A;  5I1Q A;  5E73 A;  2YYN A;  3D7C A;  5L99 A;  5CPE A;  4NUC A;  4YYM A;  4ALH A;  5FG5 A;  4OUF A;  5CUE A;  2R0V A;  5ENF A;  3AQA A;  5LUU A;  3GG3 A;  3K2J A;  3O36 A;  4TTE A;  3U5N A;  5HEL A;  3MB3 A;  3JVJ A;  4HXS A;  5HEN A;  4QEW A;  5IG6 A;  4PCI A;  4HXP A;  5EQ1 A;  4XUA A;  4TYL A;  4TT6 A;  5JWM A;  4RVR A;  4TT4 A;  5D3H A;  3U5J A;  5CRZ A;  5E9Y A;  5EWW A;  3JVK A;  3NXB A;  2DVS A;  4HBY A;  5LVQ A;  4UIX A;  5E9L A;  4TT2 A;  5D26 A;  4A9N A;  1WUG A;  5D3R A;  3QZV A;  4N4H A;  5F60 A;  4NYW A;  4C66 A;  4DON A;  5L8T A;  5A7C A;  4MR5 A;  3JVL A;  5HCL A;  4A9I A;  5CY9 A;  5HQ6 A;  4NR5 A;  5EWC A;  5E9V A;  3G0L A;  5AD2 A;  3IU5 A;  5D3N A;  4PTB A;  5EIC A;  4QYL A;  4BW4 A;  4QB3 A;  4HXR A;  4Z6H A;  2GRC A;  5IID A;  5DYC A;  5EA1 A;  3UV2 A;  5FDZ A;  4A9K A;  2YEM A;  5FH8 A;  5I89 A;  5HRW A;  5D3J A;  5CUG A;  5A5N A;  2WP1 A;  5DBM A;  5FE3 A;  5TB6 A;  4J1P A;  5IGM A;  4J3I A;  4NR7 A;  4UYH A;  2DVR A;  3LQJ A;  4QYD A;  5CRM A;  2RO1 A;  5H1V A;  3FKM X;  4XUB A;  3DWY A;  5JI8 A;  5A85 A;  2YDW A;  4O77 A;  5FH6 A;  4QSX A;  4GPJ A;  3UVD A;  5EWV A;  4PY6 A;  4LDF A;  4YYG A;  4QSP A;  5C4Q A;  2H60 A;  4E96 A;  3U5P A;  5CQ7 A;  2YEK A;  5EWD A;  5DKH A;  5EK9 A;  5CGP A;  4O74 A;  5FE1 A;  5KO4 A;  5A82 A;  4BJX A;  5ENC A;  5C7N A;  4HXM A;  4UIW A;  5I80 A;  2R10 A;  4UYF A;  2F6N A;  2RI7 A;  4HBX A;  2YW5 A;  5I86 A;  3O35 A;  4CLB A;  3HMH A;  4QUT A;  2RNW A;  4YYD A;  4N4I A;  5HRX A;  5CP5 A;  4CFL A;  3P1E A;  5ENI A;  3UVY A;  2DAT A;  5LJ0 A;  4NXJ A;  4ZW1 A;  2L5E A;  4WHU A;  5II2 A;  5IGN A;  4A9O A;  2FSA A;  4QSW A;  4HBV A;  5BT3 A;  5EGU A;  4TU4 A;  4O72 A;  5E3G A;  5AD3 A;  4LYW A;  4QSR A;  3MQM A;  3U5L A;  5F1L A;  4NS5 A;  5ETD A;  4X2I A;  5LKT A;  5D24 A;  5K29 A;  3MUL A;  2D82 A;  3TLP A;  5KTX A;  4A9L A;  5FH7 A;  4N3W A;  4CFK A;  5ENB A;  4YH3 A;  3Q2F A;  5C8G A;  4UIZ A;  5C89 A;  5F25 A;  2L85 A;  4NR9 A;  5H85 A;  4TZ8 A;  4O71 A;  5FE8 A;  4O70 A;  5E74 A;  5CTL A;  4LYI A;  4UYE A;  5I7X A;  5FE0 A;  1EQF A;  5FE6 A;  2RFJ A;  5F2P A;  4MEQ A;  4YAX A;  4QUU A;  5DW2 A;  5FE4 A;  3Q2E A;  5J0D A;  4UIV A;  5EM3 A;  4LR6 A;  4XYA A;  5HM0 A;  5A81 A;  4YBM A;  2RS9 B;  5E9I A;  4CUQ A;  3SVF A;  5BT5 A;  4A9E A;  4O75 A;  4YH4 A;  1WUM A;  3S92 A;  5FG6 A;  4FLP A;  4NQN A;  4A9F A;  3MB4 A;  5H1T A;  4N4F A;  3HMF A;  3LQI A;  4MR3 A;  4NR6 A;  5DFD A;  4HXO A;  5II1 A;  5ENH A;  5CUD A;  5FE9 A;  4PS5 A;  5HQ7 A;  2OUO A;  4O7F A;  3SVG A;  4ZC9 A;  4UYF B;  3ZYU A;  4LZ2 A;  4YYK A;  4MEN A;  5CQA A;  5DY7 A;  2KTB B;  5I83 A;  3S91 A;  4IR6 A;  5CS8 A;  2E7O A;  4Z1Q A;  5FG4 A;  4KV4 A;  4NQM A;  4NRB A;  4QST A;  3LXJ A;  5DLX A;  5HJC A;  4WIV A;  5DLZ A;  4NRC A;  4O7E A;  4AKN A;  4UYD A;  4QNS A;  3HME A;  5ACY A;  4QSU A;  5D3P A;  4ALG A;  5CQT A;  4IOQ A;  5FB1 A;  5D7X A;  5A5O A;  5L8U A;  5FE2 A;  4CUU A;  3UV4 A;  4LC2 A;  4YK0 A;  5EU1 A;  5F3A A;  3IU6 A;  2YEL A;  4KV1 A;  4QR4 A;  5D3L A;  4QR5 A;  5I29 A;  5A83 A;  2D9E A;  4MR6 A;  4O7A A;  5F61 A;  4YYJ A;  4UIY A;  5LJ1 A;  4TU6 A;  4QSQ A;  4LYS A;  4HXN A;  5KU3 A;  5H1U A;  4CUS A;  5DYX A;  4CUP A;  4UIU A;  4PKL A;  2OO1 A;  3G0J A;  3LQH A;  5HFR A;  4Y03 A;  5LVR A;  4QSV A;  2I8N A;  4A9H A;  5C85 A;  2E7N A;  4IOO A;  3I3J A;  5EP7 A;  4J0R A;  4MEP A;  5DKC A;  3P1D A;  2YQD A;  4YAB A;  4NYV A;  3SVH A;  5DYA A;  5EWH A;  5E0R A;  5F5Z A;  4IR3 A;  5ENG A;  5A5S A;  5LKU A;  2F6J A;  1F68 A;  2RNX A;  4OGJ A;  5DW1 A;  5C87 A;  4OGI A;  2RNY A;  5I40 A;  2DWW A;  5E3D A;  5CFW A;  4O7B A;  5ENE A;  4CUT A;  4MEO A;  4Z93 A;  5E9K A;  5EV9 A;  5HFQ A;  5ENJ A;  5EVA A;  5A5R A;  4O78 A;  2LSP B;  3AAD A;  2R0Y A;  4TQN A;  4YBS A;  4KCX A;  3LJW A;  4YC9 A;  4BHW A;  5CQ4 A;  2DVQ A;  5KTW A;  5AME A;  3P1F A;  5D0C A;  4CUR A;  1JM4 B;  5CQ3 A;  5L97 A;  5HLS A;  5EI4 A;  4YYN A;  4NRA A;  5F62 A;  1N72 A;  4XY8 A;  2NXB A;  5E9M A;  5FE7 A;  5COI A;  5TCM A;  4UIT A;  2L84 A;  5FB0 A;  4C67 A;  3U5M A;  3DAI A;  4IOR A;  5DYU A;  4XY9 A;  4YYI A;  4F3I A;  2DVV A;  4O7C A;  2G4A A;  2DKW A;  3UV5 A;  3P1C A;  5KTU A;  5L98 A;  5IBN A;  4NR4 A;  4O76 A;  3UVW A;  3ONI A;  3MUK A;  5F1H A;  5I88 A;  5EPR A;  4A9M A;  5DFB A;  1ZS5 A;  5ETB A;  2OSS A;  4HBW A;  3O37 A;  4NUE A;  3O33 A;  4LZR A;  4QEU A;  5G4S A;  5HEM A;  4IR4 A;  3QZT A;  4HXK A;  3U5K A;  5BT4 A;  4YAT A;  5CU8 A;  5G4R A;  5I7Y A;  3P5O A;  5EPS A;  5CUC A;  5KHM A;  5FFV A;  2I7K A;  4YY6 A;  2N9G A;  4BW2 A;  4NYX A;  4Q0N A;  4NUD A;  5CQ5 A;  1X0J A;  4QC3 A;  5IGL A;  5CQ8 A;  4BW3 A;  4QSS A;  5FFY A;  4Z1S A;  4QC1 A;  4IR5 A;  4QZS A;  4LZS A;  4LRG A;  4QBM A;  2E3K A;  4BW1 A;  5F36 A; 
#chains in the Genus database with same CATH topology
 4WHW A;  5LKZ A;  5FBX A;  4UYG A;  4TS8 A;  5LKX A;  5L96 A;  5HRV A;  5A5P A;  4HXL A;  3QZS A;  5FFW A;  3U5O A;  5CZG A;  3MXF A;  4N4G A;  1E6I A;  2R0S A;  5D25 A;  4YY4 A;  4PCE A;  4YYH A;  5CQ6 A;  5DFC A;  4NR8 A;  4YAD A;  5DX4 A;  5D3T A;  2MJV B;  4A9J A;  3JVM A;  5EIS A;  4QY4 A;  5FE5 A;  4TZ2 A;  4Q0O A;  3UVX A;  4QR3 A;  4YBT A;  5D3S A;  3O34 A;  4MR4 A;  5A5Q A;  4QEV A;  5AMF A;  5CUB A;  4J0S A;  2WP2 A;  5F63 A;  4Z6I A;  5IGK A;  5E7D A;  3UW9 A;  5CUA A;  5DKD A;  4ZQL A;  4CL9 A;  5LJ2 A;  1JSP B;  5EPB A;  5HQ5 A;  3RCW A;  5I1Q A;  5E73 A;  2YYN A;  3D7C A;  5L99 A;  5CPE A;  4NUC A;  4YYM A;  4ALH A;  5FG5 A;  4OUF A;  5CUE A;  2R0V A;  5ENF A;  3AQA A;  5LUU A;  3GG3 A;  3D1D A;  3K2J A;  3O36 A;  4TTE A;  3U5N A;  5HEL A;  3MB3 A;  3JVJ A;  4HXS A;  5HEN A;  4QEW A;  5IG6 A;  4PCI A;  4HXP A;  5EQ1 A;  4XUA A;  4TYL A;  4TT6 A;  5JWM A;  4RVR A;  4TT4 A;  5D3H A;  3U5J A;  5CRZ A;  5E9Y A;  5EWW A;  3JVK A;  3NXB A;  2DVS A;  4HBY A;  5LVQ A;  4UIX A;  5E9L A;  4TT2 A;  5D26 A;  4A9N A;  1WUG A;  5D3R A;  3QZV A;  4N4H A;  5F60 A;  4NYW A;  4C66 A;  4DON A;  5L8T A;  5A7C A;  4MR5 A;  3JVL A;  5HCL A;  4A9I A;  5CY9 A;  5HQ6 A;  4NR5 A;  5EWC A;  5E9V A;  3G0L A;  5AD2 A;  3IU5 A;  5D3N A;  4PTB A;  5EIC A;  4QYL A;  4BW4 A;  4QB3 A;  4HXR A;  4Z6H A;  2GRC A;  5IID A;  5DYC A;  5EA1 A;  3UV2 A;  5FDZ A;  4A9K A;  2YEM A;  5FH8 A;  5I89 A;  5HRW A;  5D3J A;  5CUG A;  5A5N A;  2WP1 A;  5DBM A;  5FE3 A;  5TB6 A;  4J1P A;  5IGM A;  4J3I A;  4NR7 A;  4UYH A;  2DVR A;  3LQJ A;  4QYD A;  5CRM A;  2RO1 A;  5H1V A;  3FKM X;  4XUB A;  3DWY A;  5JI8 A;  5A85 A;  2YDW A;  4O77 A;  5FH6 A;  4QSX A;  4GPJ A;  3UVD A;  5EWV A;  4PY6 A;  4LDF A;  4YYG A;  4QSP A;  5C4Q A;  2H60 A;  4E96 A;  3U5P A;  5CQ7 A;  2YEK A;  5EWD A;  5DKH A;  5EK9 A;  5CGP A;  4O74 A;  5FE1 A;  3VKG A;  5KO4 A;  5A82 A;  4BJX A;  5ENC A;  5C7N A;  4HXM A;  4UIW A;  5I80 A;  2R10 A;  4UYF A;  2F6N A;  2RI7 A;  4HBX A;  2YW5 A;  5I86 A;  3O35 A;  4CLB A;  3HMH A;  4QUT A;  2RNW A;  4YYD A;  4N4I A;  5HRX A;  5CP5 A;  4CFL A;  3P1E A;  5ENI A;  3UVY A;  2DAT A;  5LJ0 A;  4NXJ A;  4ZW1 A;  2L5E A;  4WHU A;  5II2 A;  5IGN A;  4A9O A;  2FSA A;  4QSW A;  4HBV A;  5BT3 A;  5EGU A;  4TU4 A;  4O72 A;  5E3G A;  5AD3 A;  4LYW A;  4QSR A;  3MQM A;  3U5L A;  5F1L A;  4AKH A;  4NS5 A;  5ETD A;  4X2I A;  5LKT A;  1PUO A;  5D24 A;  5K29 A;  3MUL A;  2D82 A;  3TLP A;  5KTX A;  4A9L A;  5FH7 A;  4N3W A;  4CFK A;  5ENB A;  4YH3 A;  3Q2F A;  5C8G A;  4UIZ A;  5C89 A;  5F25 A;  2L85 A;  4NR9 A;  5H85 A;  4TZ8 A;  4O71 A;  5FE8 A;  4O70 A;  5E74 A;  5CTL A;  4LYI A;  4UYE A;  5I7X A;  5FE0 A;  1EQF A;  5FE6 A;  2RFJ A;  5F2P A;  4MEQ A;  4YAX A;  4QUU A;  5DW2 A;  5FE4 A;  3Q2E A;  5J0D A;  4UIV A;  5EM3 A;  4LR6 A;  4XYA A;  5HM0 A;  5A81 A;  4YBM A;  2RS9 B;  5E9I A;  4CUQ A;  3SVF A;  5BT5 A;  4A9E A;  4O75 A;  4YH4 A;  1WUM A;  3S92 A;  5FG6 A;  4FLP A;  4NQN A;  4A9F A;  3MB4 A;  5H1T A;  4N4F A;  3HMF A;  3LQI A;  4MR3 A;  4NR6 A;  5DFD A;  4HXO A;  5II1 A;  5ENH A;  5CUD A;  5FE9 A;  4PS5 A;  5HQ7 A;  2OUO A;  4O7F A;  3SVG A;  4ZC9 A;  4UYF B;  3ZYU A;  4LZ2 A;  4YYK A;  4MEN A;  5CQA A;  5DY7 A;  2KTB B;  5I83 A;  3S91 A;  4IR6 A;  5CS8 A;  2E7O A;  4Z1Q A;  5FG4 A;  4KV4 A;  4NQM A;  4NRB A;  4QST A;  3LXJ A;  5DLX A;  5HJC A;  4WIV A;  5DLZ A;  4NRC A;  4O7E A;  4AKN A;  4UYD A;  4QNS A;  3HME A;  5ACY A;  4QSU A;  5D3P A;  4ALG A;  5CQT A;  4IOQ A;  5FB1 A;  5D7X A;  5A5O A;  5L8U A;  5FE2 A;  4CUU A;  3UV4 A;  4LC2 A;  4YK0 A;  5EU1 A;  5F3A A;  2YEL A;  3IU6 A;  4KV1 A;  4QR4 A;  5D3L A;  4QR5 A;  5I29 A;  5A83 A;  2D9E A;  4MR6 A;  4O7A A;  5F61 A;  4YYJ A;  4UIY A;  5LJ1 A;  4TU6 A;  4QSQ A;  4LYS A;  4HXN A;  5KU3 A;  4AKG A;  5H1U A;  4CUS A;  5DYX A;  3ERR A;  4CUP A;  4UIU A;  4PKL A;  2OO1 A;  3G0J A;  3LQH A;  5HFR A;  4Y03 A;  5LVR A;  4QSV A;  4AI6 A;  2I8N A;  4A9H A;  5C85 A;  2E7N A;  4IOO A;  3I3J A;  5EP7 A;  4J0R A;  4MEP A;  5DKC A;  3P1D A;  2YQD A;  4YAB A;  4NYV A;  3SVH A;  5DYA A;  5EWH A;  5E0R A;  5F5Z A;  4IR3 A;  5ENG A;  5A5S A;  5LKU A;  2F6J A;  1F68 A;  2RNX A;  4OGJ A;  5DW1 A;  5C87 A;  4OGI A;  2RNY A;  5I40 A;  2DWW A;  5E3D A;  5CFW A;  4O7B A;  5ENE A;  4CUT A;  4MEO A;  4Z93 A;  5E9K A;  5EV9 A;  5HFQ A;  5ENJ A;  5EVA A;  5A5R A;  4O78 A;  2LSP B;  3AAD A;  2R0Y A;  4TQN A;  4YBS A;  4KCX A;  1ZKR A;  3LJW A;  4YC9 A;  4BHW A;  3D1B A;  5CQ4 A;  2DVQ A;  5KTW A;  5AME A;  3P1F A;  5D0C A;  2EJN A;  4CUR A;  1JM4 B;  5CQ3 A;  5L97 A;  5HLS A;  5EI4 A;  4YYN A;  4NRA A;  5F62 A;  1N72 A;  4XY8 A;  2NXB A;  5E9M A;  5FE7 A;  5COI A;  5TCM A;  4UIT A;  2L84 A;  5FB0 A;  4C67 A;  3U5M A;  3DAI A;  4IOR A;  5DYU A;  4XY9 A;  4YYI A;  4F3I A;  2DVV A;  4O7C A;  2G4A A;  2DKW A;  3UV5 A;  3P1C A;  5KTU A;  5L98 A;  5IBN A;  4NR4 A;  4O76 A;  3UVW A;  3ONI A;  3MUK A;  5F1H A;  5I88 A;  5EPR A;  4A9M A;  5DFB A;  1ZS5 A;  5ETB A;  2OSS A;  4HBW A;  3O37 A;  4NUE A;  3O33 A;  4LZR A;  4QEU A;  5G4S A;  5HEM A;  4IR4 A;  3QZT A;  4HXK A;  3U5K A;  5BT4 A;  4YAT A;  5CU8 A;  5G4R A;  5I7Y A;  3P5O A;  3VKH A;  5EPS A;  5CUC A;  5KHM A;  5FFV A;  2I7K A;  4YY6 A;  2N9G A;  4BW2 A;  4AKI A;  4NYX A;  4Q0N A;  4NUD A;  5CQ5 A;  1X0J A;  4QC3 A;  5IGL A;  5CQ8 A;  4BW3 A;  4QSS A;  5FFY A;  4Z1S A;  4QC1 A;  4IR5 A;  4QZS A;  4LZS A;  4LRG A;  4QBM A;  2E3K A;  4BW1 A;  5F36 A; 
#chains in the Genus database with same CATH homology
 4WHW A;  5LKZ A;  5FBX A;  4UYG A;  4TS8 A;  5LKX A;  5L96 A;  5HRV A;  5A5P A;  4HXL A;  3QZS A;  5FFW A;  3U5O A;  5CZG A;  3MXF A;  4N4G A;  1E6I A;  2R0S A;  5D25 A;  4YY4 A;  4PCE A;  4YYH A;  5CQ6 A;  5DFC A;  4NR8 A;  4YAD A;  5DX4 A;  5D3T A;  2MJV B;  4A9J A;  3JVM A;  5EIS A;  4QY4 A;  5FE5 A;  4TZ2 A;  4Q0O A;  3UVX A;  4QR3 A;  4YBT A;  5D3S A;  3O34 A;  4MR4 A;  5A5Q A;  4QEV A;  5AMF A;  5CUB A;  4J0S A;  2WP2 A;  5F63 A;  4Z6I A;  5IGK A;  5E7D A;  3UW9 A;  5CUA A;  5DKD A;  4ZQL A;  4CL9 A;  5LJ2 A;  1JSP B;  5EPB A;  5HQ5 A;  3RCW A;  5I1Q A;  5E73 A;  2YYN A;  3D7C A;  5L99 A;  5CPE A;  4NUC A;  4YYM A;  4ALH A;  5FG5 A;  4OUF A;  5CUE A;  2R0V A;  5ENF A;  3AQA A;  5LUU A;  3GG3 A;  3K2J A;  3O36 A;  4TTE A;  3U5N A;  5HEL A;  3MB3 A;  3JVJ A;  4HXS A;  5HEN A;  4QEW A;  5IG6 A;  4PCI A;  4HXP A;  5EQ1 A;  4XUA A;  4TYL A;  4TT6 A;  5JWM A;  4RVR A;  4TT4 A;  5D3H A;  3U5J A;  5CRZ A;  5E9Y A;  5EWW A;  3JVK A;  3NXB A;  2DVS A;  4HBY A;  5LVQ A;  4UIX A;  5E9L A;  4TT2 A;  5D26 A;  4A9N A;  1WUG A;  5D3R A;  3QZV A;  4N4H A;  5F60 A;  4NYW A;  4C66 A;  4DON A;  5L8T A;  5A7C A;  4MR5 A;  3JVL A;  5HCL A;  4A9I A;  5CY9 A;  5HQ6 A;  4NR5 A;  5EWC A;  5E9V A;  3G0L A;  5AD2 A;  3IU5 A;  5D3N A;  4PTB A;  5EIC A;  4QYL A;  4BW4 A;  4QB3 A;  4HXR A;  4Z6H A;  2GRC A;  5IID A;  5DYC A;  5EA1 A;  3UV2 A;  5FDZ A;  4A9K A;  2YEM A;  5FH8 A;  5I89 A;  5HRW A;  5D3J A;  5CUG A;  5A5N A;  2WP1 A;  5DBM A;  5FE3 A;  5TB6 A;  4J1P A;  5IGM A;  4J3I A;  4NR7 A;  4UYH A;  2DVR A;  3LQJ A;  4QYD A;  5CRM A;  2RO1 A;  5H1V A;  3FKM X;  4XUB A;  3DWY A;  5JI8 A;  5A85 A;  2YDW A;  4O77 A;  5FH6 A;  4QSX A;  4GPJ A;  3UVD A;  5EWV A;  4PY6 A;  4LDF A;  4YYG A;  4QSP A;  5C4Q A;  2H60 A;  4E96 A;  3U5P A;  5CQ7 A;  2YEK A;  5EWD A;  5DKH A;  5EK9 A;  5CGP A;  4O74 A;  5FE1 A;  5KO4 A;  5A82 A;  4BJX A;  5ENC A;  5C7N A;  4HXM A;  4UIW A;  5I80 A;  2R10 A;  4UYF A;  2F6N A;  2RI7 A;  4HBX A;  2YW5 A;  5I86 A;  3O35 A;  4CLB A;  3HMH A;  4QUT A;  2RNW A;  4YYD A;  4N4I A;  5HRX A;  5CP5 A;  4CFL A;  3P1E A;  5ENI A;  3UVY A;  2DAT A;  5LJ0 A;  4NXJ A;  4ZW1 A;  2L5E A;  4WHU A;  5II2 A;  5IGN A;  4A9O A;  2FSA A;  4QSW A;  4HBV A;  5BT3 A;  5EGU A;  4TU4 A;  4O72 A;  5E3G A;  5AD3 A;  4LYW A;  4QSR A;  3MQM A;  3U5L A;  5F1L A;  4NS5 A;  5ETD A;  4X2I A;  5LKT A;  5D24 A;  5K29 A;  3MUL A;  2D82 A;  3TLP A;  5KTX A;  4A9L A;  5FH7 A;  4N3W A;  4CFK A;  5ENB A;  4YH3 A;  3Q2F A;  5C8G A;  4UIZ A;  5C89 A;  5F25 A;  2L85 A;  4NR9 A;  5H85 A;  4TZ8 A;  4O71 A;  5FE8 A;  4O70 A;  5E74 A;  5CTL A;  4LYI A;  4UYE A;  5I7X A;  5FE0 A;  1EQF A;  5FE6 A;  2RFJ A;  5F2P A;  4MEQ A;  4YAX A;  4QUU A;  5DW2 A;  5FE4 A;  3Q2E A;  5J0D A;  4UIV A;  5EM3 A;  4LR6 A;  4XYA A;  5HM0 A;  5A81 A;  4YBM A;  2RS9 B;  5E9I A;  4CUQ A;  3SVF A;  5BT5 A;  4A9E A;  4O75 A;  4YH4 A;  1WUM A;  3S92 A;  5FG6 A;  4FLP A;  4NQN A;  4A9F A;  3MB4 A;  5H1T A;  4N4F A;  3HMF A;  3LQI A;  4MR3 A;  4NR6 A;  5DFD A;  4HXO A;  5II1 A;  5ENH A;  5CUD A;  5FE9 A;  4PS5 A;  5HQ7 A;  2OUO A;  4O7F A;  3SVG A;  4ZC9 A;  4UYF B;  3ZYU A;  4LZ2 A;  4YYK A;  4MEN A;  5CQA A;  5DY7 A;  2KTB B;  5I83 A;  3S91 A;  4IR6 A;  5CS8 A;  2E7O A;  4Z1Q A;  5FG4 A;  4KV4 A;  4NQM A;  4NRB A;  4QST A;  3LXJ A;  5DLX A;  5HJC A;  4WIV A;  5DLZ A;  4NRC A;  4O7E A;  4AKN A;  4UYD A;  4QNS A;  3HME A;  5ACY A;  4QSU A;  5D3P A;  4ALG A;  5CQT A;  4IOQ A;  5FB1 A;  5D7X A;  5A5O A;  5L8U A;  5FE2 A;  4CUU A;  3UV4 A;  4LC2 A;  4YK0 A;  5EU1 A;  5F3A A;  3IU6 A;  2YEL A;  4KV1 A;  4QR4 A;  5D3L A;  4QR5 A;  5I29 A;  5A83 A;  2D9E A;  4MR6 A;  4O7A A;  5F61 A;  4YYJ A;  4UIY A;  5LJ1 A;  4TU6 A;  4QSQ A;  4LYS A;  4HXN A;  5KU3 A;  5H1U A;  4CUS A;  5DYX A;  4CUP A;  4UIU A;  4PKL A;  2OO1 A;  3G0J A;  3LQH A;  5HFR A;  4Y03 A;  5LVR A;  4QSV A;  2I8N A;  4A9H A;  5C85 A;  2E7N A;  4IOO A;  3I3J A;  5EP7 A;  4J0R A;  4MEP A;  5DKC A;  3P1D A;  2YQD A;  4YAB A;  4NYV A;  3SVH A;  5DYA A;  5EWH A;  5E0R A;  5F5Z A;  4IR3 A;  5ENG A;  5A5S A;  5LKU A;  2F6J A;  1F68 A;  2RNX A;  4OGJ A;  5DW1 A;  5C87 A;  4OGI A;  2RNY A;  5I40 A;  2DWW A;  5E3D A;  5CFW A;  4O7B A;  5ENE A;  4CUT A;  4MEO A;  4Z93 A;  5E9K A;  5EV9 A;  5HFQ A;  5ENJ A;  5EVA A;  5A5R A;  4O78 A;  2LSP B;  3AAD A;  2R0Y A;  4TQN A;  4YBS A;  4KCX A;  3LJW A;  4YC9 A;  4BHW A;  5CQ4 A;  2DVQ A;  5KTW A;  5AME A;  3P1F A;  5D0C A;  4CUR A;  1JM4 B;  5CQ3 A;  5L97 A;  5HLS A;  5EI4 A;  4YYN A;  4NRA A;  5F62 A;  1N72 A;  4XY8 A;  2NXB A;  5E9M A;  5FE7 A;  5COI A;  5TCM A;  4UIT A;  2L84 A;  5FB0 A;  4C67 A;  3U5M A;  3DAI A;  4IOR A;  5DYU A;  4XY9 A;  4YYI A;  4F3I A;  2DVV A;  4O7C A;  2G4A A;  2DKW A;  3UV5 A;  3P1C A;  5KTU A;  5L98 A;  5IBN A;  4NR4 A;  4O76 A;  3UVW A;  3ONI A;  3MUK A;  5F1H A;  5I88 A;  5EPR A;  4A9M A;  5DFB A;  1ZS5 A;  5ETB A;  2OSS A;  4HBW A;  3O37 A;  4NUE A;  3O33 A;  4LZR A;  4QEU A;  5G4S A;  5HEM A;  4IR4 A;  3QZT A;  4HXK A;  3U5K A;  5BT4 A;  4YAT A;  5CU8 A;  5G4R A;  5I7Y A;  3P5O A;  5EPS A;  5CUC A;  5KHM A;  5FFV A;  2I7K A;  4YY6 A;  2N9G A;  4BW2 A;  4NYX A;  4Q0N A;  4NUD A;  5CQ5 A;  1X0J A;  4QC3 A;  5IGL A;  5CQ8 A;  4BW3 A;  4QSS A;  5FFY A;  4Z1S A;  4QC1 A;  4IR5 A;  4QZS A;  4LZS A;  4LRG A;  4QBM A;  2E3K A;  4BW1 A;  5F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...