2R0YA

Structure of the rsc4 tandem bromodomain in complex with an acetylated h3 peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
DYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromatin structure-remodeling complex protein RSC4
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 101
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0yA01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0yA02
2MJVB 5HFQA 5HFRA 5F62A 4YC9A 5E9LA 4HXNA 2RS9B 2H60A 4F3IA 5A5RA 4XY8A 5A82A 5IGKA 3JVJA 3QZTA 5LKXA 5FE0A 5FE3A 4YYIA 4KCXA 5ENGA 5DYXA 5IGLA 2NXBA 4N4FA 5FB1A 5C4QA 4TT4A 4PTBA 5DYAA 1WUGA 5E7DA 5BT5A 5DW1A 5F25A 4Z6HA 4Z1QA 4C66A 5FFWA 5H85A 4BHWA 5IIDA 5FE1A 4ZQLA 4QNSA 4XUAA 4PY6A 2G4AA 5D3JA 5FE4A 4O78A 4A9NA 4LR6A 3FKMX 5HCLA 5CS8A 4MEPA 5DY7A 5E73A 5KTXA 2D9EA 3S92A 4LYSA 4CFLA 5LVRA 3MB4A 2E7NA 3O36A 4MR6A 3QZSA 3K2JA 4YK0A 5A7CA 5EA1A 5I80A 2KTBB 2D82A 3HMHA 4HXOA 3UVYA 5LJ0A 5AD2A 4NUEA 4NRAA 4RVRA 3TLPA 5K29A 2E7OA 4PCEA 3G0JA 3LJWA 4ZW1A 4NR5A 5IG6A 4QR4A 5I83A 3SVGA 3MUKA 3D7CA 3U5KA 4IORA 5TB6A 4WIVA 5D26A 5EPBA 4QC1A 5E9MA 4OGJA 4QR5A 5HRXA 3AQAA 4YYHA 4LZSA 4YH4A 5FFYA 4A9JA 2DVRA 4IR4A 3MQMA 5FE9A 5CQ6A 1JM4B 5HLSA 4HXSA 5EP7A 4YYGA 2RNWA 2F6NA 5JI8A 3P1FA 4QBMA 4QSWA 4Y03A 3UVDA 4QYLA 5E9VA 4CFKA 5ETBA 5A83A 4N4IA 2DWWA 4QSTA 4O7BA 4A9KA 4YBMA 4YYMA 1F68A 3QZVA 5DBMA 5ENBA 3S91A 4UITA 3HMFA 5ENEA 5D3RA 5CUAA 4QYDA 4QSXA 5FBXA 3G0LA 4TZ2A 5EPRA 2DVVA 4CUTA 4Z1SA 5LJ1A 4TU6A 5DFDA 2RNYA 4BW2A 5EVAA 2GRCA 2I7KA 5HENA 4LYWA 4NYXA 5L97A 3P1EA 4PCIA 5EI4A 4CUQA 3UVXA 4A9IA 5LJ2A 5KTWA 5EWCA 3O33A 5FFVA 4TQNA 5E3GA 5F60A 5LKUA 4AKNA 5A5NA 4QB3A 5J0DA 5D3NA 2YW5A 3UV5A 4NQNA 4TT2A 4O76A 4O77A 5A5QA 4Q0NA 5LKTA 4MEOA 5E9KA 5EISA 4TYLA 1N72A 4YYDA 4NR8A 4FLPA 5DW2A 4QUUA 5LKZA 4O71A 4UIXA 5IGNA 5CGPA 4N4HA 4BW3A 2L85A 4NR9A 5H1VA 4Q0OA 5L99A 3LXJA 4NR7A 2R10A 5L8TA 4HXLA 5FDZA 4UIUA 3NXBA 4YAXA 1ZS5A 5HQ6A 4NYWA 4O7EA 5EQ1A 5HJCA 5II1A 2OO1A 5JWMA 2RO1A 5ETDA 4LC2A 5DLZA 3DWYA 4LYIA 5D3LA 4ZC9A 4NUCA 5E0RA 4CL9A 2DVSA 4YADA 3LQHA 5F3AA 4LDFA 5C89A 3U5NA 3U5MA 5EV9A 5D3TA 5I1QA 4HBWA 5KO4A 4UIZA 3O37A 4UYFB 5E9IA 3MULA 5DLXA 3JVMA 4N3WA 3DAIA 5CUEA 4OGIA 5DFBA 5CRMA 5D24A 3IU5A 1E6IA 2FSAA 5FE8A 4HBXA 5ENFA 4A9FA 5H1UA 5CFWA 4QEWA 5CQAA 4TS8A 5ENHA 5EU1A 4YYKA 4UYDA 5CU8A 2YEMA 3ZYUA 4IOOA 5DX4A 2L84A 5HQ5A 2OUOA 4LZ2A 4XYAA 5A5PA 5AMFA 5EWHA 4ALGA 4QSSA 3Q2FA 5CP5A 5CUGA 2YYNA 3U5LA 5FG6A 5E74A 3JVKA 4YATA 4O7CA 4QC3A 3LQIA 4YY6A 3P1CA 5FE2A 4CLBA 2I8NA 5CY9A 4BW1A 5ENCA 5D3PA 4YYNA 4QSRA 4BW4A 4NRBA 4O7AA 5F36A 5BT4A 5CRZA 5F61A 4BJXA 5EWDA 3GG3A 5I40A 2YQDA 3HMEA 5CUCA 4YBTA 4UYFA 5E9YA 4NUDA 3UV2A 4YYJA 3U5JA 4Z6IA 5KHMA 4UYHA 4O72A 4J0RA 4E96A 5EICA 2LSPB 4HBVA 2F6JA 5G4RA 4LRGA 4HXPA 4NXJA 4PS5A 4TTEA 3I3JA 5EK9A 5E3DA 5FE6A 4HXMA 3UVWA 5I89A 4QR3A 4QSQA 2DATA 2YEKA 4C67A 5EWWA 3ONIA 5CQ7A 5FB0A 4NR6A 5DFCA 4MR3A 5TCMA 5L8UA 4X2IA 4NQMA 2L5EA 5DKHA 4IR5A 5C8GA 4CURA 5D3SA 5HM0A 5HRWA 3SVHA 5A5SA 4CUUA 5F1LA 5LVQA 4CUSA 4TT6A 4HXKA 5L96A 5EPSA 4NRCA 5HRVA 5IBNA 1WUMA 4UIWA 5FH6A 3P1DA 5HQ7A 5I7YA 4IR3A 4MENA 5FG4A 5FE5A 2N9GA 4PKLA 5CQ5A 4OUFA 2RFJA 4N4GA 1X0JA 3O35A 4HXRA 4O7FA 4O70A 4MR5A 5I88A 5CPEA 3IU6A 5FH7A 4HBYA 4QUTA 5CUBA 4UIVA 5BT3A 5FE7A 2DVQA 4YY4A 5CQ8A 2R0SA 4A9LA 5G4SA 5HEMA 3Q2EA 4QZSA 3O34A 4O75A 5CQ3A 4LZRA 4QSPA 5D25A 5A85A 4TU4A 4XY9A 3UV4A 4QEUA 5KTUA 2WP1A 5II2A 5I29A 2YDWA 4MEQA 4UYGA 5DKCA 3U5OA 5IGMA 2WP2A 5A5OA 5CZGA 4XUBA 2YELA 3UW9A 5COIA 5C87A 4CUPA 5AMEA 4KV1A 5C85A 4QY4A 2DKWA 5CQ4A 4Z93A 4QSUA 5CUDA 2E3KA 4NYVA 4WHUA 4J0SA 4TZ8A 5ENJA 3U5PA 4J1PA 4A9OA 5FG5A 4IOQA 5F2PA 4YABA 3SVFA 3AADA 4A9MA 5F5ZA 5FH8A 4DONA 2R0VA 5I86A 5CQTA 5D3HA 4O74A 3LQJA 2OSSA 5HELA 5DYUA 2RI7A 5D0CA 4UIYA 5DKDA 4YH3A 4NR4A 4YBSA 4GPJA 5ACYA 5D7XA 5EWVA 5AD3A 5DYCA 5C7NA 5F1HA 4WHWA 5ENIA 4A9EA 1EQFA 5KU3A 3P5OA 5EM3A 4NS5A 4MR4A 2RNXA 5I7XA 5A81A 5L98A 5LUUA 2R0YA 4KV4A 5F63A 4QEVA 4J3IA 4A9HA 3MXFA 1JSPB 3RCWA 5H1TA 3JVLA 4QSVA 4UYEA 5CTLA 4IR6A 5EGUA 4ALHA 3MB3A
chains in the Genus database with same CATH superfamily
2MJVB 5HFQA 5HFRA 5F62A 4YC9A 5E9LA 4HXNA 2RS9B 2H60A 4F3IA 5A5RA 4XY8A 5A82A 5IGKA 3JVJA 3QZTA 5LKXA 5FE0A 5FE3A 4YYIA 4KCXA 5ENGA 5DYXA 5IGLA 2NXBA 4N4FA 5FB1A 5C4QA 4TT4A 4PTBA 5DYAA 1WUGA 5E7DA 5BT5A 5DW1A 5F25A 4Z6HA 4Z1QA 4C66A 5FFWA 5H85A 4BHWA 5IIDA 4AKHA 5FE1A 4ZQLA 4QNSA 4XUAA 4PY6A 2G4AA 5D3JA 5FE4A 4O78A 4A9NA 4LR6A 3FKMX 5HCLA 5CS8A 4MEPA 5DY7A 5E73A 5KTXA 2D9EA 3S92A 4LYSA 4CFLA 5LVRA 3MB4A 2E7NA 3O36A 4MR6A 3QZSA 3K2JA 4YK0A 5A7CA 5EA1A 5I80A 2KTBB 2D82A 3HMHA 4HXOA 3UVYA 5LJ0A 5AD2A 4NUEA 4NRAA 4RVRA 3TLPA 5K29A 2E7OA 4PCEA 3G0JA 3LJWA 4ZW1A 4NR5A 5IG6A 4QR4A 5I83A 3SVGA 1PUOA 3MUKA 3D7CA 3U5KA 4IORA 5TB6A 4WIVA 5D26A 5EPBA 4QC1A 5E9MA 4OGJA 4QR5A 5HRXA 3AQAA 4YYHA 4LZSA 4YH4A 5FFYA 4A9JA 4AKIA 2DVRA 4IR4A 3MQMA 5FE9A 5CQ6A 1JM4B 5HLSA 4HXSA 5EP7A 4YYGA 2RNWA 2F6NA 5JI8A 3P1FA 4QBMA 4QSWA 4Y03A 3UVDA 4QYLA 5E9VA 4CFKA 5ETBA 5A83A 4N4IA 2DWWA 4QSTA 4O7BA 4A9KA 4YBMA 4YYMA 1F68A 3QZVA 5DBMA 5ENBA 3S91A 4UITA 3HMFA 5ENEA 5D3RA 5CUAA 4QYDA 4QSXA 5FBXA 3G0LA 4TZ2A 5EPRA 2DVVA 4CUTA 4Z1SA 5LJ1A 4TU6A 5DFDA 2RNYA 4BW2A 5EVAA 2GRCA 2I7KA 5HENA 4LYWA 4NYXA 5L97A 3P1EA 4PCIA 5EI4A 4CUQA 3UVXA 4A9IA 5LJ2A 5KTWA 5EWCA 3O33A 5FFVA 4TQNA 5E3GA 5F60A 5LKUA 4AKNA 5A5NA 4QB3A 1ZKRA 5J0DA 5D3NA 2YW5A 3UV5A 4NQNA 4TT2A 4O76A 4O77A 5A5QA 4Q0NA 5LKTA 4MEOA 5E9KA 5EISA 4TYLA 1N72A 4YYDA 4NR8A 4FLPA 5DW2A 4QUUA 5LKZA 4O71A 4UIXA 5IGNA 5CGPA 4N4HA 4BW3A 2L85A 4NR9A 5H1VA 4Q0OA 5L99A 3LXJA 4NR7A 2R10A 5L8TA 4HXLA 5FDZA 4UIUA 3NXBA 4YAXA 1ZS5A 5HQ6A 4NYWA 4O7EA 5EQ1A 5HJCA 5II1A 2OO1A 5JWMA 2RO1A 5ETDA 4LC2A 5DLZA 3DWYA 4LYIA 5D3LA 2EJNA 4ZC9A 4NUCA 5E0RA 4CL9A 2DVSA 4YADA 3LQHA 5F3AA 4LDFA 5C89A 3U5NA 3U5MA 5EV9A 5D3TA 5I1QA 4HBWA 5KO4A 4UIZA 3O37A 4UYFB 5E9IA 3ERRA 3MULA 5DLXA 3JVMA 4N3WA 4AI6A 3DAIA 5CUEA 4OGIA 5DFBA 5CRMA 5D24A 3IU5A 1E6IA 2FSAA 5FE8A 4HBXA 5ENFA 4A9FA 5H1UA 5CFWA 4QEWA 5CQAA 4TS8A 5ENHA 5EU1A 4YYKA 4UYDA 5CU8A 2YEMA 3ZYUA 4IOOA 5DX4A 2L84A 5HQ5A 2OUOA 4LZ2A 4XYAA 5A5PA 5AMFA 5EWHA 4ALGA 4QSSA 3Q2FA 5CP5A 5CUGA 2YYNA 3U5LA 5FG6A 5E74A 3JVKA 4YATA 4O7CA 4QC3A 3LQIA 4YY6A 3P1CA 5FE2A 4CLBA 2I8NA 5CY9A 4BW1A 5ENCA 5D3PA 4YYNA 4QSRA 4BW4A 4NRBA 4O7AA 5F36A 5BT4A 5CRZA 5F61A 4BJXA 5EWDA 3GG3A 5I40A 2YQDA 3HMEA 5CUCA 4YBTA 4UYFA 5E9YA 4NUDA 3UV2A 4YYJA 3U5JA 4Z6IA 5KHMA 4UYHA 4O72A 4J0RA 4E96A 5EICA 2LSPB 4HBVA 2F6JA 5G4RA 4LRGA 4HXPA 4NXJA 4PS5A 4TTEA 3I3JA 5EK9A 5E3DA 5FE6A 4HXMA 3UVWA 5I89A 4QR3A 4QSQA 2DATA 2YEKA 4C67A 5EWWA 3ONIA 5CQ7A 5FB0A 4NR6A 5DFCA 4MR3A 5TCMA 5L8UA 4X2IA 4NQMA 2L5EA 5DKHA 4IR5A 4AKGA 5C8GA 4CURA 5D3SA 5HM0A 5HRWA 3SVHA 5A5SA 4CUUA 5F1LA 5LVQA 4CUSA 3VKGA 4TT6A 4HXKA 5L96A 5EPSA 4NRCA 5HRVA 5IBNA 1WUMA 4UIWA 5FH6A 3P1DA 5HQ7A 5I7YA 3D1DA 4IR3A 4MENA 5FG4A 5FE5A 2N9GA 4PKLA 5CQ5A 3VKHA 4OUFA 2RFJA 4N4GA 1X0JA 3O35A 4HXRA 4O7FA 4O70A 4MR5A 5I88A 5CPEA 3IU6A 5FH7A 4HBYA 4QUTA 5CUBA 4UIVA 5BT3A 5FE7A 2DVQA 4YY4A 5CQ8A 2R0SA 4A9LA 5G4SA 5HEMA 3Q2EA 4QZSA 3O34A 4O75A 5CQ3A 4LZRA 4QSPA 5D25A 5A85A 4TU4A 4XY9A 3UV4A 4QEUA 5KTUA 2WP1A 5II2A 5I29A 2YDWA 4MEQA 4UYGA 5DKCA 3U5OA 5IGMA 2WP2A 5A5OA 5CZGA 4XUBA 2YELA 3UW9A 5COIA 5C87A 4CUPA 5AMEA 4KV1A 5C85A 4QY4A 2DKWA 5CQ4A 4Z93A 4QSUA 5CUDA 2E3KA 4NYVA 4WHUA 4J0SA 4TZ8A 5ENJA 3U5PA 4J1PA 4A9OA 5FG5A 4IOQA 5F2PA 4YABA 3SVFA 3AADA 4A9MA 5F5ZA 5FH8A 4DONA 2R0VA 5I86A 5CQTA 5D3HA 4O74A 3LQJA 2OSSA 5HELA 5DYUA 2RI7A 5D0CA 4UIYA 5DKDA 4YH3A 4NR4A 4YBSA 3D1BA 4GPJA 5ACYA 5D7XA 5EWVA 5AD3A 5DYCA 5C7NA 5F1HA 4WHWA 5ENIA 4A9EA 1EQFA 5KU3A 3P5OA 5EM3A 4NS5A 4MR4A 2RNXA 5I7XA 5A81A 5L98A 5LUUA 2R0YA 4KV4A 5F63A 4QEVA 4J3IA 4A9HA 3MXFA 1JSPB 3RCWA 5H1TA 3JVLA 4QSVA 4UYEA 5CTLA 4IR6A 5EGUA 4ALHA 3MB3A
chains in the Genus database with same CATH topology
2MJVB 5HFQA 5HFRA 5F62A 4YC9A 5E9LA 4HXNA 2RS9B 2H60A 4F3IA 5A5RA 4XY8A 5A82A 5IGKA 3JVJA 3QZTA 5LKXA 5FE0A 5FE3A 4YYIA 4KCXA 5ENGA 5DYXA 5IGLA 2NXBA 4N4FA 5FB1A 5C4QA 4TT4A 4PTBA 5DYAA 1WUGA 5E7DA 5BT5A 5DW1A 5F25A 4Z6HA 4Z1QA 4C66A 5FFWA 5H85A 4BHWA 5IIDA 5FE1A 4ZQLA 4QNSA 4XUAA 4PY6A 2G4AA 5D3JA 5FE4A 4O78A 4A9NA 4LR6A 3FKMX 5HCLA 5CS8A 4MEPA 5DY7A 5E73A 5KTXA 2D9EA 3S92A 4LYSA 4CFLA 5LVRA 3MB4A 2E7NA 3O36A 4MR6A 3QZSA 3K2JA 4YK0A 5A7CA 5EA1A 5I80A 2KTBB 2D82A 3HMHA 4HXOA 3UVYA 5LJ0A 5AD2A 4NUEA 4NRAA 4RVRA 3TLPA 5K29A 2E7OA 4PCEA 3G0JA 3LJWA 4ZW1A 4NR5A 5IG6A 4QR4A 5I83A 3SVGA 3MUKA 3D7CA 3U5KA 4IORA 5TB6A 4WIVA 5D26A 5EPBA 4QC1A 5E9MA 4OGJA 4QR5A 5HRXA 3AQAA 4YYHA 4LZSA 4YH4A 5FFYA 4A9JA 2DVRA 4IR4A 3MQMA 5FE9A 5CQ6A 1JM4B 5HLSA 4HXSA 5EP7A 4YYGA 2RNWA 2F6NA 5JI8A 3P1FA 4QBMA 4QSWA 4Y03A 3UVDA 4QYLA 5E9VA 4CFKA 5ETBA 5A83A 4N4IA 2DWWA 4QSTA 4O7BA 4A9KA 4YBMA 4YYMA 1F68A 3QZVA 5DBMA 5ENBA 3S91A 4UITA 3HMFA 5ENEA 5D3RA 5CUAA 4QYDA 4QSXA 5FBXA 3G0LA 4TZ2A 5EPRA 2DVVA 4CUTA 4Z1SA 5LJ1A 4TU6A 5DFDA 2RNYA 4BW2A 5EVAA 2GRCA 2I7KA 5HENA 4LYWA 4NYXA 5L97A 3P1EA 4PCIA 5EI4A 4CUQA 3UVXA 4A9IA 5LJ2A 5KTWA 5EWCA 3O33A 5FFVA 4TQNA 5E3GA 5F60A 5LKUA 4AKNA 5A5NA 4QB3A 5J0DA 5D3NA 2YW5A 3UV5A 4NQNA 4TT2A 4O76A 4O77A 5A5QA 4Q0NA 5LKTA 4MEOA 5E9KA 5EISA 4TYLA 1N72A 4YYDA 4NR8A 4FLPA 5DW2A 4QUUA 5LKZA 4O71A 4UIXA 5IGNA 5CGPA 4N4HA 4BW3A 2L85A 4NR9A 5H1VA 4Q0OA 5L99A 3LXJA 4NR7A 2R10A 5L8TA 4HXLA 5FDZA 4UIUA 3NXBA 4YAXA 1ZS5A 5HQ6A 4NYWA 4O7EA 5EQ1A 5HJCA 5II1A 2OO1A 5JWMA 2RO1A 5ETDA 4LC2A 5DLZA 3DWYA 4LYIA 5D3LA 4ZC9A 4NUCA 5E0RA 4CL9A 2DVSA 4YADA 3LQHA 5F3AA 4LDFA 5C89A 3U5NA 3U5MA 5EV9A 5D3TA 5I1QA 4HBWA 5KO4A 4UIZA 3O37A 4UYFB 5E9IA 3MULA 5DLXA 3JVMA 4N3WA 3DAIA 5CUEA 4OGIA 5DFBA 5CRMA 5D24A 3IU5A 1E6IA 2FSAA 5FE8A 4HBXA 5ENFA 4A9FA 5H1UA 5CFWA 4QEWA 5CQAA 4TS8A 5ENHA 5EU1A 4YYKA 4UYDA 5CU8A 2YEMA 3ZYUA 4IOOA 5DX4A 2L84A 5HQ5A 2OUOA 4LZ2A 4XYAA 5A5PA 5AMFA 5EWHA 4ALGA 4QSSA 3Q2FA 5CP5A 5CUGA 2YYNA 3U5LA 5FG6A 5E74A 3JVKA 4YATA 4O7CA 4QC3A 3LQIA 4YY6A 3P1CA 5FE2A 4CLBA 2I8NA 5CY9A 4BW1A 5ENCA 5D3PA 4YYNA 4QSRA 4BW4A 4NRBA 4O7AA 5F36A 5BT4A 5CRZA 5F61A 4BJXA 5EWDA 3GG3A 5I40A 2YQDA 3HMEA 5CUCA 4YBTA 4UYFA 5E9YA 4NUDA 3UV2A 4YYJA 3U5JA 4Z6IA 5KHMA 4UYHA 4O72A 4J0RA 4E96A 5EICA 2LSPB 4HBVA 2F6JA 5G4RA 4LRGA 4HXPA 4NXJA 4PS5A 4TTEA 3I3JA 5EK9A 5E3DA 5FE6A 4HXMA 3UVWA 5I89A 4QR3A 4QSQA 2DATA 2YEKA 4C67A 5EWWA 3ONIA 5CQ7A 5FB0A 4NR6A 5DFCA 4MR3A 5TCMA 5L8UA 4X2IA 4NQMA 2L5EA 5DKHA 4IR5A 5C8GA 4CURA 5D3SA 5HM0A 5HRWA 3SVHA 5A5SA 4CUUA 5F1LA 5LVQA 4CUSA 4TT6A 4HXKA 5L96A 5EPSA 4NRCA 5HRVA 5IBNA 1WUMA 4UIWA 5FH6A 3P1DA 5HQ7A 5I7YA 4IR3A 4MENA 5FG4A 5FE5A 2N9GA 4PKLA 5CQ5A 4OUFA 2RFJA 4N4GA 1X0JA 3O35A 4HXRA 4O7FA 4O70A 4MR5A 5I88A 5CPEA 3IU6A 5FH7A 4HBYA 4QUTA 5CUBA 4UIVA 5BT3A 5FE7A 2DVQA 4YY4A 5CQ8A 2R0SA 4A9LA 5G4SA 5HEMA 3Q2EA 4QZSA 3O34A 4O75A 5CQ3A 4LZRA 4QSPA 5D25A 5A85A 4TU4A 4XY9A 3UV4A 4QEUA 5KTUA 2WP1A 5II2A 5I29A 2YDWA 4MEQA 4UYGA 5DKCA 3U5OA 5IGMA 2WP2A 5A5OA 5CZGA 4XUBA 2YELA 3UW9A 5COIA 5C87A 4CUPA 5AMEA 4KV1A 5C85A 4QY4A 2DKWA 5CQ4A 4Z93A 4QSUA 5CUDA 2E3KA 4NYVA 4WHUA 4J0SA 4TZ8A 5ENJA 3U5PA 4J1PA 4A9OA 5FG5A 4IOQA 5F2PA 4YABA 3SVFA 3AADA 4A9MA 5F5ZA 5FH8A 4DONA 2R0VA 5I86A 5CQTA 5D3HA 4O74A 3LQJA 2OSSA 5HELA 5DYUA 2RI7A 5D0CA 4UIYA 5DKDA 4YH3A 4NR4A 4YBSA 4GPJA 5ACYA 5D7XA 5EWVA 5AD3A 5DYCA 5C7NA 5F1HA 4WHWA 5ENIA 4A9EA 1EQFA 5KU3A 3P5OA 5EM3A 4NS5A 4MR4A 2RNXA 5I7XA 5A81A 5L98A 5LUUA 2R0YA 4KV4A 5F63A 4QEVA 4J3IA 4A9HA 3MXFA 1JSPB 3RCWA 5H1TA 3JVLA 4QSVA 4UYEA 5CTLA 4IR6A 5EGUA 4ALHA 3MB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJV B;  5HFQ A;  5HFR A;  5F62 A;  4YC9 A;  5E9L A;  4HXN A;  2RS9 B;  2H60 A;  4F3I A;  5A5R A;  4XY8 A;  5A82 A;  5IGK A;  3JVJ A;  3QZT A;  5LKX A;  5FE0 A;  5FE3 A;  4YYI A;  4KCX A;  5ENG A;  5DYX A;  5IGL A;  2NXB A;  4N4F A;  5FB1 A;  5C4Q A;  4TT4 A;  4PTB A;  5DYA A;  1WUG A;  5E7D A;  5BT5 A;  5DW1 A;  5F25 A;  4Z6H A;  4Z1Q A;  4C66 A;  5FFW A;  5H85 A;  4BHW A;  5IID A;  5FE1 A;  4ZQL A;  4QNS A;  4XUA A;  4PY6 A;  2G4A A;  5D3J A;  5FE4 A;  4O78 A;  4A9N A;  4LR6 A;  3FKM X;  5HCL A;  5CS8 A;  4MEP A;  5DY7 A;  5E73 A;  5KTX A;  2D9E A;  3S92 A;  4LYS A;  4CFL A;  5LVR A;  3MB4 A;  2E7N A;  3O36 A;  4MR6 A;  3QZS A;  3K2J A;  4YK0 A;  5A7C A;  5EA1 A;  5I80 A;  2KTB B;  2D82 A;  3HMH A;  4HXO A;  3UVY A;  5LJ0 A;  5AD2 A;  4NUE A;  4NRA A;  4RVR A;  3TLP A;  5K29 A;  2E7O A;  4PCE A;  3G0J A;  3LJW A;  4ZW1 A;  4NR5 A;  5IG6 A;  4QR4 A;  5I83 A;  3SVG A;  3MUK A;  3D7C A;  3U5K A;  4IOR A;  5TB6 A;  4WIV A;  5D26 A;  5EPB A;  4QC1 A;  5E9M A;  4OGJ A;  4QR5 A;  5HRX A;  3AQA A;  4YYH A;  4LZS A;  4YH4 A;  5FFY A;  4A9J A;  2DVR A;  4IR4 A;  3MQM A;  5FE9 A;  5CQ6 A;  1JM4 B;  5HLS A;  4HXS A;  5EP7 A;  4YYG A;  2RNW A;  2F6N A;  5JI8 A;  3P1F A;  4QBM A;  4QSW A;  4Y03 A;  3UVD A;  4QYL A;  5E9V A;  4CFK A;  5ETB A;  5A83 A;  4N4I A;  2DWW A;  4QST A;  4O7B A;  4A9K A;  4YBM A;  4YYM A;  1F68 A;  3QZV A;  5DBM A;  5ENB A;  3S91 A;  4UIT A;  3HMF A;  5ENE A;  5D3R A;  5CUA A;  4QYD A;  4QSX A;  5FBX A;  3G0L A;  4TZ2 A;  5EPR A;  2DVV A;  4CUT A;  4Z1S A;  5LJ1 A;  4TU6 A;  5DFD A;  2RNY A;  4BW2 A;  5EVA A;  2GRC A;  2I7K A;  5HEN A;  4LYW A;  4NYX A;  5L97 A;  3P1E A;  4PCI A;  5EI4 A;  4CUQ A;  3UVX A;  4A9I A;  5LJ2 A;  5KTW A;  5EWC A;  3O33 A;  5FFV A;  4TQN A;  5E3G A;  5F60 A;  5LKU A;  4AKN A;  5A5N A;  4QB3 A;  5J0D A;  5D3N A;  2YW5 A;  3UV5 A;  4NQN A;  4TT2 A;  4O76 A;  4O77 A;  5A5Q A;  4Q0N A;  5LKT A;  4MEO A;  5E9K A;  5EIS A;  4TYL A;  1N72 A;  4YYD A;  4NR8 A;  4FLP A;  5DW2 A;  4QUU A;  5LKZ A;  4O71 A;  4UIX A;  5IGN A;  5CGP A;  4N4H A;  4BW3 A;  2L85 A;  4NR9 A;  5H1V A;  4Q0O A;  5L99 A;  3LXJ A;  4NR7 A;  2R10 A;  5L8T A;  4HXL A;  5FDZ A;  4UIU A;  3NXB A;  4YAX A;  1ZS5 A;  5HQ6 A;  4NYW A;  4O7E A;  5EQ1 A;  5HJC A;  5II1 A;  2OO1 A;  5JWM A;  2RO1 A;  5ETD A;  4LC2 A;  5DLZ A;  3DWY A;  4LYI A;  5D3L A;  4ZC9 A;  4NUC A;  5E0R A;  4CL9 A;  2DVS A;  4YAD A;  3LQH A;  5F3A A;  4LDF A;  5C89 A;  3U5N A;  3U5M A;  5EV9 A;  5D3T A;  5I1Q A;  4HBW A;  5KO4 A;  4UIZ A;  3O37 A;  4UYF B;  5E9I A;  3MUL A;  5DLX A;  3JVM A;  4N3W A;  3DAI A;  5CUE A;  4OGI A;  5DFB A;  5CRM A;  5D24 A;  3IU5 A;  1E6I A;  2FSA A;  5FE8 A;  4HBX A;  5ENF A;  4A9F A;  5H1U A;  5CFW A;  4QEW A;  5CQA A;  4TS8 A;  5ENH A;  5EU1 A;  4YYK A;  4UYD A;  5CU8 A;  2YEM A;  3ZYU A;  4IOO A;  5DX4 A;  2L84 A;  5HQ5 A;  2OUO A;  4LZ2 A;  4XYA A;  5A5P A;  5AMF A;  5EWH A;  4ALG A;  4QSS A;  3Q2F A;  5CP5 A;  5CUG A;  2YYN A;  3U5L A;  5FG6 A;  5E74 A;  3JVK A;  4YAT A;  4O7C A;  4QC3 A;  3LQI A;  4YY6 A;  3P1C A;  5FE2 A;  4CLB A;  2I8N A;  5CY9 A;  4BW1 A;  5ENC A;  5D3P A;  4YYN A;  4QSR A;  4BW4 A;  4NRB A;  4O7A A;  5F36 A;  5BT4 A;  5CRZ A;  5F61 A;  4BJX A;  5EWD A;  3GG3 A;  5I40 A;  2YQD A;  3HME A;  5CUC A;  4YBT A;  4UYF A;  5E9Y A;  4NUD A;  3UV2 A;  4YYJ A;  3U5J A;  4Z6I A;  5KHM A;  4UYH A;  4O72 A;  4J0R A;  4E96 A;  5EIC A;  2LSP B;  4HBV A;  2F6J A;  5G4R A;  4LRG A;  4HXP A;  4NXJ A;  4PS5 A;  4TTE A;  3I3J A;  5EK9 A;  5E3D A;  5FE6 A;  4HXM A;  3UVW A;  5I89 A;  4QR3 A;  4QSQ A;  2DAT A;  2YEK A;  4C67 A;  5EWW A;  3ONI A;  5CQ7 A;  5FB0 A;  4NR6 A;  5DFC A;  4MR3 A;  5TCM A;  5L8U A;  4X2I A;  4NQM A;  2L5E A;  5DKH A;  4IR5 A;  5C8G A;  4CUR A;  5D3S A;  5HM0 A;  5HRW A;  3SVH A;  5A5S A;  4CUU A;  5F1L A;  5LVQ A;  4CUS A;  4TT6 A;  4HXK A;  5L96 A;  5EPS A;  4NRC A;  5HRV A;  5IBN A;  1WUM A;  4UIW A;  5FH6 A;  3P1D A;  5HQ7 A;  5I7Y A;  4IR3 A;  4MEN A;  5FG4 A;  5FE5 A;  2N9G A;  4PKL A;  5CQ5 A;  4OUF A;  2RFJ A;  4N4G A;  1X0J A;  3O35 A;  4HXR A;  4O7F A;  4O70 A;  4MR5 A;  5I88 A;  5CPE A;  3IU6 A;  5FH7 A;  4HBY A;  4QUT A;  5CUB A;  4UIV A;  5BT3 A;  5FE7 A;  2DVQ A;  4YY4 A;  5CQ8 A;  2R0S A;  4A9L A;  5G4S A;  5HEM A;  3Q2E A;  4QZS A;  3O34 A;  4O75 A;  5CQ3 A;  4LZR A;  4QSP A;  5D25 A;  5A85 A;  4TU4 A;  4XY9 A;  3UV4 A;  4QEU A;  5KTU A;  2WP1 A;  5II2 A;  5I29 A;  2YDW A;  4MEQ A;  4UYG A;  5DKC A;  3U5O A;  5IGM A;  2WP2 A;  5A5O A;  5CZG A;  4XUB A;  2YEL A;  3UW9 A;  5COI A;  5C87 A;  4CUP A;  5AME A;  4KV1 A;  5C85 A;  4QY4 A;  2DKW A;  5CQ4 A;  4Z93 A;  4QSU A;  5CUD A;  2E3K A;  4NYV A;  4WHU A;  4J0S A;  4TZ8 A;  5ENJ A;  3U5P A;  4J1P A;  4A9O A;  5FG5 A;  4IOQ A;  5F2P A;  4YAB A;  3SVF A;  3AAD A;  4A9M A;  5F5Z A;  5FH8 A;  4DON A;  2R0V A;  5I86 A;  5CQT A;  5D3H A;  4O74 A;  3LQJ A;  2OSS A;  5HEL A;  5DYU A;  2RI7 A;  5D0C A;  4UIY A;  5DKD A;  4YH3 A;  4NR4 A;  4YBS A;  4GPJ A;  5ACY A;  5D7X A;  5EWV A;  5AD3 A;  5DYC A;  5C7N A;  5F1H A;  4WHW A;  5ENI A;  4A9E A;  1EQF A;  5KU3 A;  3P5O A;  5EM3 A;  4NS5 A;  4MR4 A;  2RNX A;  5I7X A;  5A81 A;  5L98 A;  5LUU A;  2R0Y A;  4KV4 A;  5F63 A;  4QEV A;  4J3I A;  4A9H A;  3MXF A;  1JSP B;  3RCW A;  5H1T A;  3JVL A;  4QSV A;  4UYE A;  5CTL A;  4IR6 A;  5EGU A;  4ALH A;  3MB3 A; 
#chains in the Genus database with same CATH topology
 2MJV B;  5HFQ A;  5HFR A;  5F62 A;  4YC9 A;  5E9L A;  4HXN A;  2RS9 B;  2H60 A;  4F3I A;  5A5R A;  4XY8 A;  5A82 A;  5IGK A;  3JVJ A;  3QZT A;  5LKX A;  5FE0 A;  5FE3 A;  4YYI A;  4KCX A;  5ENG A;  5DYX A;  5IGL A;  2NXB A;  4N4F A;  5FB1 A;  5C4Q A;  4TT4 A;  4PTB A;  5DYA A;  1WUG A;  5E7D A;  5BT5 A;  5DW1 A;  5F25 A;  4Z6H A;  4Z1Q A;  4C66 A;  5FFW A;  5H85 A;  4BHW A;  5IID A;  4AKH A;  5FE1 A;  4ZQL A;  4QNS A;  4XUA A;  4PY6 A;  2G4A A;  5D3J A;  5FE4 A;  4O78 A;  4A9N A;  4LR6 A;  3FKM X;  5HCL A;  5CS8 A;  4MEP A;  5DY7 A;  5E73 A;  5KTX A;  2D9E A;  3S92 A;  4LYS A;  4CFL A;  5LVR A;  3MB4 A;  2E7N A;  3O36 A;  4MR6 A;  3QZS A;  3K2J A;  4YK0 A;  5A7C A;  5EA1 A;  5I80 A;  2KTB B;  2D82 A;  3HMH A;  4HXO A;  3UVY A;  5LJ0 A;  5AD2 A;  4NUE A;  4NRA A;  4RVR A;  3TLP A;  5K29 A;  2E7O A;  4PCE A;  3G0J A;  3LJW A;  4ZW1 A;  4NR5 A;  5IG6 A;  4QR4 A;  5I83 A;  3SVG A;  1PUO A;  3MUK A;  3D7C A;  3U5K A;  4IOR A;  5TB6 A;  4WIV A;  5D26 A;  5EPB A;  4QC1 A;  5E9M A;  4OGJ A;  4QR5 A;  5HRX A;  3AQA A;  4YYH A;  4LZS A;  4YH4 A;  5FFY A;  4A9J A;  4AKI A;  2DVR A;  4IR4 A;  3MQM A;  5FE9 A;  5CQ6 A;  1JM4 B;  5HLS A;  4HXS A;  5EP7 A;  4YYG A;  2RNW A;  2F6N A;  5JI8 A;  3P1F A;  4QBM A;  4QSW A;  4Y03 A;  3UVD A;  4QYL A;  5E9V A;  4CFK A;  5ETB A;  5A83 A;  4N4I A;  2DWW A;  4QST A;  4O7B A;  4A9K A;  4YBM A;  4YYM A;  1F68 A;  3QZV A;  5DBM A;  5ENB A;  3S91 A;  4UIT A;  3HMF A;  5ENE A;  5D3R A;  5CUA A;  4QYD A;  4QSX A;  5FBX A;  3G0L A;  4TZ2 A;  5EPR A;  2DVV A;  4CUT A;  4Z1S A;  5LJ1 A;  4TU6 A;  5DFD A;  2RNY A;  4BW2 A;  5EVA A;  2GRC A;  2I7K A;  5HEN A;  4LYW A;  4NYX A;  5L97 A;  3P1E A;  4PCI A;  5EI4 A;  4CUQ A;  3UVX A;  4A9I A;  5LJ2 A;  5KTW A;  5EWC A;  3O33 A;  5FFV A;  4TQN A;  5E3G A;  5F60 A;  5LKU A;  4AKN A;  5A5N A;  4QB3 A;  1ZKR A;  5J0D A;  5D3N A;  2YW5 A;  3UV5 A;  4NQN A;  4TT2 A;  4O76 A;  4O77 A;  5A5Q A;  4Q0N A;  5LKT A;  4MEO A;  5E9K A;  5EIS A;  4TYL A;  1N72 A;  4YYD A;  4NR8 A;  4FLP A;  5DW2 A;  4QUU A;  5LKZ A;  4O71 A;  4UIX A;  5IGN A;  5CGP A;  4N4H A;  4BW3 A;  2L85 A;  4NR9 A;  5H1V A;  4Q0O A;  5L99 A;  3LXJ A;  4NR7 A;  2R10 A;  5L8T A;  4HXL A;  5FDZ A;  4UIU A;  3NXB A;  4YAX A;  1ZS5 A;  5HQ6 A;  4NYW A;  4O7E A;  5EQ1 A;  5HJC A;  5II1 A;  2OO1 A;  5JWM A;  2RO1 A;  5ETD A;  4LC2 A;  5DLZ A;  3DWY A;  4LYI A;  5D3L A;  2EJN A;  4ZC9 A;  4NUC A;  5E0R A;  4CL9 A;  2DVS A;  4YAD A;  3LQH A;  5F3A A;  4LDF A;  5C89 A;  3U5N A;  3U5M A;  5EV9 A;  5D3T A;  5I1Q A;  4HBW A;  5KO4 A;  4UIZ A;  3O37 A;  4UYF B;  5E9I A;  3ERR A;  3MUL A;  5DLX A;  3JVM A;  4N3W A;  4AI6 A;  3DAI A;  5CUE A;  4OGI A;  5DFB A;  5CRM A;  5D24 A;  3IU5 A;  1E6I A;  2FSA A;  5FE8 A;  4HBX A;  5ENF A;  4A9F A;  5H1U A;  5CFW A;  4QEW A;  5CQA A;  4TS8 A;  5ENH A;  5EU1 A;  4YYK A;  4UYD A;  5CU8 A;  2YEM A;  3ZYU A;  4IOO A;  5DX4 A;  2L84 A;  5HQ5 A;  2OUO A;  4LZ2 A;  4XYA A;  5A5P A;  5AMF A;  5EWH A;  4ALG A;  4QSS A;  3Q2F A;  5CP5 A;  5CUG A;  2YYN A;  3U5L A;  5FG6 A;  5E74 A;  3JVK A;  4YAT A;  4O7C A;  4QC3 A;  3LQI A;  4YY6 A;  3P1C A;  5FE2 A;  4CLB A;  2I8N A;  5CY9 A;  4BW1 A;  5ENC A;  5D3P A;  4YYN A;  4QSR A;  4BW4 A;  4NRB A;  4O7A A;  5F36 A;  5BT4 A;  5CRZ A;  5F61 A;  4BJX A;  5EWD A;  3GG3 A;  5I40 A;  2YQD A;  3HME A;  5CUC A;  4YBT A;  4UYF A;  5E9Y A;  4NUD A;  3UV2 A;  4YYJ A;  3U5J A;  4Z6I A;  5KHM A;  4UYH A;  4O72 A;  4J0R A;  4E96 A;  5EIC A;  2LSP B;  4HBV A;  2F6J A;  5G4R A;  4LRG A;  4HXP A;  4NXJ A;  4PS5 A;  4TTE A;  3I3J A;  5EK9 A;  5E3D A;  5FE6 A;  4HXM A;  3UVW A;  5I89 A;  4QR3 A;  4QSQ A;  2DAT A;  2YEK A;  4C67 A;  5EWW A;  3ONI A;  5CQ7 A;  5FB0 A;  4NR6 A;  5DFC A;  4MR3 A;  5TCM A;  5L8U A;  4X2I A;  4NQM A;  2L5E A;  5DKH A;  4IR5 A;  4AKG A;  5C8G A;  4CUR A;  5D3S A;  5HM0 A;  5HRW A;  3SVH A;  5A5S A;  4CUU A;  5F1L A;  5LVQ A;  4CUS A;  3VKG A;  4TT6 A;  4HXK A;  5L96 A;  5EPS A;  4NRC A;  5HRV A;  5IBN A;  1WUM A;  4UIW A;  5FH6 A;  3P1D A;  5HQ7 A;  5I7Y A;  3D1D A;  4IR3 A;  4MEN A;  5FG4 A;  5FE5 A;  2N9G A;  4PKL A;  5CQ5 A;  3VKH A;  4OUF A;  2RFJ A;  4N4G A;  1X0J A;  3O35 A;  4HXR A;  4O7F A;  4O70 A;  4MR5 A;  5I88 A;  5CPE A;  3IU6 A;  5FH7 A;  4HBY A;  4QUT A;  5CUB A;  4UIV A;  5BT3 A;  5FE7 A;  2DVQ A;  4YY4 A;  5CQ8 A;  2R0S A;  4A9L A;  5G4S A;  5HEM A;  3Q2E A;  4QZS A;  3O34 A;  4O75 A;  5CQ3 A;  4LZR A;  4QSP A;  5D25 A;  5A85 A;  4TU4 A;  4XY9 A;  3UV4 A;  4QEU A;  5KTU A;  2WP1 A;  5II2 A;  5I29 A;  2YDW A;  4MEQ A;  4UYG A;  5DKC A;  3U5O A;  5IGM A;  2WP2 A;  5A5O A;  5CZG A;  4XUB A;  2YEL A;  3UW9 A;  5COI A;  5C87 A;  4CUP A;  5AME A;  4KV1 A;  5C85 A;  4QY4 A;  2DKW A;  5CQ4 A;  4Z93 A;  4QSU A;  5CUD A;  2E3K A;  4NYV A;  4WHU A;  4J0S A;  4TZ8 A;  5ENJ A;  3U5P A;  4J1P A;  4A9O A;  5FG5 A;  4IOQ A;  5F2P A;  4YAB A;  3SVF A;  3AAD A;  4A9M A;  5F5Z A;  5FH8 A;  4DON A;  2R0V A;  5I86 A;  5CQT A;  5D3H A;  4O74 A;  3LQJ A;  2OSS A;  5HEL A;  5DYU A;  2RI7 A;  5D0C A;  4UIY A;  5DKD A;  4YH3 A;  4NR4 A;  4YBS A;  3D1B A;  4GPJ A;  5ACY A;  5D7X A;  5EWV A;  5AD3 A;  5DYC A;  5C7N A;  5F1H A;  4WHW A;  5ENI A;  4A9E A;  1EQF A;  5KU3 A;  3P5O A;  5EM3 A;  4NS5 A;  4MR4 A;  2RNX A;  5I7X A;  5A81 A;  5L98 A;  5LUU A;  2R0Y A;  4KV4 A;  5F63 A;  4QEV A;  4J3I A;  4A9H A;  3MXF A;  1JSP B;  3RCW A;  5H1T A;  3JVL A;  4QSV A;  4UYE A;  5CTL A;  4IR6 A;  5EGU A;  4ALH A;  3MB3 A; 
#chains in the Genus database with same CATH homology
 2MJV B;  5HFQ A;  5HFR A;  5F62 A;  4YC9 A;  5E9L A;  4HXN A;  2RS9 B;  2H60 A;  4F3I A;  5A5R A;  4XY8 A;  5A82 A;  5IGK A;  3JVJ A;  3QZT A;  5LKX A;  5FE0 A;  5FE3 A;  4YYI A;  4KCX A;  5ENG A;  5DYX A;  5IGL A;  2NXB A;  4N4F A;  5FB1 A;  5C4Q A;  4TT4 A;  4PTB A;  5DYA A;  1WUG A;  5E7D A;  5BT5 A;  5DW1 A;  5F25 A;  4Z6H A;  4Z1Q A;  4C66 A;  5FFW A;  5H85 A;  4BHW A;  5IID A;  5FE1 A;  4ZQL A;  4QNS A;  4XUA A;  4PY6 A;  2G4A A;  5D3J A;  5FE4 A;  4O78 A;  4A9N A;  4LR6 A;  3FKM X;  5HCL A;  5CS8 A;  4MEP A;  5DY7 A;  5E73 A;  5KTX A;  2D9E A;  3S92 A;  4LYS A;  4CFL A;  5LVR A;  3MB4 A;  2E7N A;  3O36 A;  4MR6 A;  3QZS A;  3K2J A;  4YK0 A;  5A7C A;  5EA1 A;  5I80 A;  2KTB B;  2D82 A;  3HMH A;  4HXO A;  3UVY A;  5LJ0 A;  5AD2 A;  4NUE A;  4NRA A;  4RVR A;  3TLP A;  5K29 A;  2E7O A;  4PCE A;  3G0J A;  3LJW A;  4ZW1 A;  4NR5 A;  5IG6 A;  4QR4 A;  5I83 A;  3SVG A;  3MUK A;  3D7C A;  3U5K A;  4IOR A;  5TB6 A;  4WIV A;  5D26 A;  5EPB A;  4QC1 A;  5E9M A;  4OGJ A;  4QR5 A;  5HRX A;  3AQA A;  4YYH A;  4LZS A;  4YH4 A;  5FFY A;  4A9J A;  2DVR A;  4IR4 A;  3MQM A;  5FE9 A;  5CQ6 A;  1JM4 B;  5HLS A;  4HXS A;  5EP7 A;  4YYG A;  2RNW A;  2F6N A;  5JI8 A;  3P1F A;  4QBM A;  4QSW A;  4Y03 A;  3UVD A;  4QYL A;  5E9V A;  4CFK A;  5ETB A;  5A83 A;  4N4I A;  2DWW A;  4QST A;  4O7B A;  4A9K A;  4YBM A;  4YYM A;  1F68 A;  3QZV A;  5DBM A;  5ENB A;  3S91 A;  4UIT A;  3HMF A;  5ENE A;  5D3R A;  5CUA A;  4QYD A;  4QSX A;  5FBX A;  3G0L A;  4TZ2 A;  5EPR A;  2DVV A;  4CUT A;  4Z1S A;  5LJ1 A;  4TU6 A;  5DFD A;  2RNY A;  4BW2 A;  5EVA A;  2GRC A;  2I7K A;  5HEN A;  4LYW A;  4NYX A;  5L97 A;  3P1E A;  4PCI A;  5EI4 A;  4CUQ A;  3UVX A;  4A9I A;  5LJ2 A;  5KTW A;  5EWC A;  3O33 A;  5FFV A;  4TQN A;  5E3G A;  5F60 A;  5LKU A;  4AKN A;  5A5N A;  4QB3 A;  5J0D A;  5D3N A;  2YW5 A;  3UV5 A;  4NQN A;  4TT2 A;  4O76 A;  4O77 A;  5A5Q A;  4Q0N A;  5LKT A;  4MEO A;  5E9K A;  5EIS A;  4TYL A;  1N72 A;  4YYD A;  4NR8 A;  4FLP A;  5DW2 A;  4QUU A;  5LKZ A;  4O71 A;  4UIX A;  5IGN A;  5CGP A;  4N4H A;  4BW3 A;  2L85 A;  4NR9 A;  5H1V A;  4Q0O A;  5L99 A;  3LXJ A;  4NR7 A;  2R10 A;  5L8T A;  4HXL A;  5FDZ A;  4UIU A;  3NXB A;  4YAX A;  1ZS5 A;  5HQ6 A;  4NYW A;  4O7E A;  5EQ1 A;  5HJC A;  5II1 A;  2OO1 A;  5JWM A;  2RO1 A;  5ETD A;  4LC2 A;  5DLZ A;  3DWY A;  4LYI A;  5D3L A;  4ZC9 A;  4NUC A;  5E0R A;  4CL9 A;  2DVS A;  4YAD A;  3LQH A;  5F3A A;  4LDF A;  5C89 A;  3U5N A;  3U5M A;  5EV9 A;  5D3T A;  5I1Q A;  4HBW A;  5KO4 A;  4UIZ A;  3O37 A;  4UYF B;  5E9I A;  3MUL A;  5DLX A;  3JVM A;  4N3W A;  3DAI A;  5CUE A;  4OGI A;  5DFB A;  5CRM A;  5D24 A;  3IU5 A;  1E6I A;  2FSA A;  5FE8 A;  4HBX A;  5ENF A;  4A9F A;  5H1U A;  5CFW A;  4QEW A;  5CQA A;  4TS8 A;  5ENH A;  5EU1 A;  4YYK A;  4UYD A;  5CU8 A;  2YEM A;  3ZYU A;  4IOO A;  5DX4 A;  2L84 A;  5HQ5 A;  2OUO A;  4LZ2 A;  4XYA A;  5A5P A;  5AMF A;  5EWH A;  4ALG A;  4QSS A;  3Q2F A;  5CP5 A;  5CUG A;  2YYN A;  3U5L A;  5FG6 A;  5E74 A;  3JVK A;  4YAT A;  4O7C A;  4QC3 A;  3LQI A;  4YY6 A;  3P1C A;  5FE2 A;  4CLB A;  2I8N A;  5CY9 A;  4BW1 A;  5ENC A;  5D3P A;  4YYN A;  4QSR A;  4BW4 A;  4NRB A;  4O7A A;  5F36 A;  5BT4 A;  5CRZ A;  5F61 A;  4BJX A;  5EWD A;  3GG3 A;  5I40 A;  2YQD A;  3HME A;  5CUC A;  4YBT A;  4UYF A;  5E9Y A;  4NUD A;  3UV2 A;  4YYJ A;  3U5J A;  4Z6I A;  5KHM A;  4UYH A;  4O72 A;  4J0R A;  4E96 A;  5EIC A;  2LSP B;  4HBV A;  2F6J A;  5G4R A;  4LRG A;  4HXP A;  4NXJ A;  4PS5 A;  4TTE A;  3I3J A;  5EK9 A;  5E3D A;  5FE6 A;  4HXM A;  3UVW A;  5I89 A;  4QR3 A;  4QSQ A;  2DAT A;  2YEK A;  4C67 A;  5EWW A;  3ONI A;  5CQ7 A;  5FB0 A;  4NR6 A;  5DFC A;  4MR3 A;  5TCM A;  5L8U A;  4X2I A;  4NQM A;  2L5E A;  5DKH A;  4IR5 A;  5C8G A;  4CUR A;  5D3S A;  5HM0 A;  5HRW A;  3SVH A;  5A5S A;  4CUU A;  5F1L A;  5LVQ A;  4CUS A;  4TT6 A;  4HXK A;  5L96 A;  5EPS A;  4NRC A;  5HRV A;  5IBN A;  1WUM A;  4UIW A;  5FH6 A;  3P1D A;  5HQ7 A;  5I7Y A;  4IR3 A;  4MEN A;  5FG4 A;  5FE5 A;  2N9G A;  4PKL A;  5CQ5 A;  4OUF A;  2RFJ A;  4N4G A;  1X0J A;  3O35 A;  4HXR A;  4O7F A;  4O70 A;  4MR5 A;  5I88 A;  5CPE A;  3IU6 A;  5FH7 A;  4HBY A;  4QUT A;  5CUB A;  4UIV A;  5BT3 A;  5FE7 A;  2DVQ A;  4YY4 A;  5CQ8 A;  2R0S A;  4A9L A;  5G4S A;  5HEM A;  3Q2E A;  4QZS A;  3O34 A;  4O75 A;  5CQ3 A;  4LZR A;  4QSP A;  5D25 A;  5A85 A;  4TU4 A;  4XY9 A;  3UV4 A;  4QEU A;  5KTU A;  2WP1 A;  5II2 A;  5I29 A;  2YDW A;  4MEQ A;  4UYG A;  5DKC A;  3U5O A;  5IGM A;  2WP2 A;  5A5O A;  5CZG A;  4XUB A;  2YEL A;  3UW9 A;  5COI A;  5C87 A;  4CUP A;  5AME A;  4KV1 A;  5C85 A;  4QY4 A;  2DKW A;  5CQ4 A;  4Z93 A;  4QSU A;  5CUD A;  2E3K A;  4NYV A;  4WHU A;  4J0S A;  4TZ8 A;  5ENJ A;  3U5P A;  4J1P A;  4A9O A;  5FG5 A;  4IOQ A;  5F2P A;  4YAB A;  3SVF A;  3AAD A;  4A9M A;  5F5Z A;  5FH8 A;  4DON A;  2R0V A;  5I86 A;  5CQT A;  5D3H A;  4O74 A;  3LQJ A;  2OSS A;  5HEL A;  5DYU A;  2RI7 A;  5D0C A;  4UIY A;  5DKD A;  4YH3 A;  4NR4 A;  4YBS A;  4GPJ A;  5ACY A;  5D7X A;  5EWV A;  5AD3 A;  5DYC A;  5C7N A;  5F1H A;  4WHW A;  5ENI A;  4A9E A;  1EQF A;  5KU3 A;  3P5O A;  5EM3 A;  4NS5 A;  4MR4 A;  2RNX A;  5I7X A;  5A81 A;  5L98 A;  5LUU A;  2R0Y A;  4KV4 A;  5F63 A;  4QEV A;  4J3I A;  4A9H A;  3MXF A;  1JSP B;  3RCW A;  5H1T A;  3JVL A;  4QSV A;  4UYE A;  5CTL A;  4IR6 A;  5EGU A;  4ALH A;  3MB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...