5DFDA

Crystal structure of brd2(bd2) w370f mutant with ligand 28 bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
108
structure length
108
Chain Sequence
SEQLKHCNGILKELLSKKHAAYAFPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title New Synthetic Routes to Triazolo-benzodiazepine Analogues: Expanding the Scope of the Bump-and-Hole Approach for Selective Bromo and Extra-Terminal (BET) Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dfdA00
4Y03A 4UIUA 4A9FA 2I7KA 4QYLA 2YW5A 5D7XA 5I89A 4NQNA 3HMFA 4O7CA 4UIXA 4LR6A 4PKLA 3P1CA 5FBXA 3ONIA 4QR4A 5ENJA 5F2PA 4QEVA 4QUTA 4LDFA 2E7OA 4UYDA 4NQMA 5FFVA 4YH3A 4IR6A 4MR4A 5DYUA 2R0VA 2N9GA 5A5QA 4QSXA 5DBMA 5CU8A 2R0SA 4X2IA 5TCMA 5EISA 5IG6A 3DWYA 5FB1A 1JSPB 5FG5A 4BW2A 5E3DA 4J1PA 4LC2A 2G4AA 4QSWA 5HQ7A 5CS8A 5DX4A 3HMEA 5FH7A 5LVQA 2RFJA 5EQ1A 5DKDA 4NYXA 4Q0OA 5II2A 5EGUA 4N4FA 4CUQA 4YYIA 5HFQA 5KO4A 2OSSA 5HLSA 3LQHA 4QSRA 3LQIA 4N4HA 4YK0A 4FLPA 5F61A 5EPBA 4UYHA 4RVRA 4HBYA 4CUTA 4YYDA 4TYLA 3FKMX 5ENBA 5F5ZA 2F6JA 4MR3A 2YDWA 5IIDA 1EQFA 5CQ5A 3UVXA 3QZVA 4UYEA 2E7NA 4Z1QA 4LYSA 4ALHA 5C87A 4TZ2A 5I7XA 2WP1A 4C66A 4TTEA 5KTXA 5LKTA 5A5SA 5D3JA 2OUOA 4OGIA 3QZTA 4QC1A 2R0YA 5L8TA 4LZSA 5ETDA 5DYXA 4YYJA 2I8NA 4PCEA 4A9NA 4O7EA 3G0JA 3U5NA 5DLZA 4CFLA 5EWCA 4UYFB 5HRXA 5JWMA 2L85A 3S91A 5IBNA 4J3IA 4NR8A 4ZC9A 4YABA 3NXBA 4KV1A 3LQJA 3MB3A 4PS5A 4MEOA 2DKWA 4IR5A 4A9IA 5EU1A 5AD2A 1N72A 4IOQA 4Z1SA 4UIZA 2H60A 3U5MA 3U5OA 4XUBA 4QEUA 5H1TA 5LKXA 4N4IA 4BW3A 5ACYA 4HXPA 5CUAA 3HMHA 4GPJA 5EWVA 3MUKA 4KCXA 5DY7A 3DAIA 5CPEA 4UIWA 2L5EA 5DW1A 5E9YA 3LJWA 5F62A 4WHUA 3UV2A 5DFBA 5FE1A 5A83A 4CURA 5HQ6A 5EICA 3UVYA 5FFWA 5F63A 1WUMA 4TZ8A 5H85A 5HELA 4UYFA 2LSPB 2F6NA 5IGKA 4HXKA 4NYVA 5FH8A 5HRWA 1X0JA 3MB4A 3S92A 3IU6A 4YYMA 5C4QA 5D3SA 3UVDA 5CQ3A 4O71A 1E6IA 4HBXA 3MXFA 5DYCA 4F3IA 5HFRA 5L99A 5CRZA 5CQ6A 5D3TA 3U5KA 3P1FA 4YY4A 5CQ8A 5E74A 5C7NA 3O33A 5A5NA 5CQ4A 5HEMA 2OO1A 4CUSA 2E3KA 1F68A 4QSPA 4BHWA 4WIVA 4N4GA 4LZ2A 2RNYA 4Z6HA 5KTUA 4HXNA 4HXMA 3O34A 5ENHA 5DFCA 3D7CA 4A9LA 5DW2A 4ZQLA 4O72A 5LJ2A 4A9HA 4YBSA 4LYWA 4TT4A 4XY8A 4NR9A 5ENGA 4QSVA 5A85A 4O7AA 2R10A 5KTWA 5CUCA 4TT6A 3P1DA 5EWDA 5CFWA 3G0LA 4MR5A 5FFYA 4LYIA 5EV9A 5EP7A 4HXRA 5CZGA 5ENIA 5FE2A 5A82A 2YQDA 4YYGA 4CUUA 3P5OA 2MJVB 5L96A 3LXJA 3SVFA 5KHMA 2D82A 5D3PA 3UV5A 5E9LA 5ENCA 2RNWA 3ZYUA 4QSTA 2RI7A 4TS8A 5CGPA 4PCIA 5DKCA 4UITA 5I1QA 5EK9A 5LKZA 5D25A 3JVJA 5E9IA 4A9EA 4ALGA 5H1VA 4HXLA 2D9EA 5HRVA 4HBWA 4HXSA 5I83A 4QUUA 4O76A 4O77A 5K29A 5CRMA 3SVGA 4DONA 4QSSA 2DVRA 5F60A 4QEWA 4A9JA 3UW9A 4NXJA 2RNXA 4KV4A 4NR7A 2GRCA 5J0DA 5I88A 3O37A 2NXBA 4C67A 5D3LA 4IOOA 5DKHA 5E73A 4BW1A 4QBMA 5DYAA 5I86A 4NUCA 4O7FA 4QR5A 2DVVA 4QY4A 3GG3A 5BT3A 4MEPA 5CTLA 5A7CA 2DATA 4YBMA 4YADA 5FB0A 4Z93A 4J0SA 2DVQA 4O7BA 2KTBB 5F36A 3P1EA 4Q0NA 4YATA 5C8GA 5A5RA 3K2JA 1JM4B 2YYNA 5HJCA 5HQ5A 3JVMA 5E9KA 3U5PA 5FDZA 4YY6A 3JVKA 3AQAA 4E96A 5L97A 5I29A 4NR5A 4A9OA 5DLXA 4CLBA 3JVLA 5I7YA 1ZS5A 5LUUA 5CQAA 3U5LA 2RO1A 5ENFA 4A9KA 5IGNA 5G4SA 5L8UA 5G4RA 4OUFA 4QSQA 1WUGA 4UYGA 5ETBA 5FE4A 5D3HA 4HBVA 4NRAA 5CP5A 4NR4A 5TB6A 5ENEA 3MQMA 4CL9A 4MR6A 5EA1A 5EVAA 3QZSA 2DWWA 4YYHA 4QZSA 5CQTA 4J0RA 5A5PA 5EWHA 5FE9A 4LRGA 3RCWA 4Z6IA 5C89A 4NUEA 5F3AA 5COIA 4YH4A 5I40A 3UVWA 5HENA 5E3GA 4QR3A 5IGMA 2DVSA 4HXOA 5E0RA 5CQ7A 4O75A 4CFKA 5EPRA 4QNSA 3IU5A 5CUBA 4YC9A 4PY6A 5JI8A 4IORA 4O74A 4AKNA 2YELA 5CUDA 4MEQA 5FE0A 5LJ1A 2YEKA 4BJXA 4TQNA 5LVRA 5II1A 5L98A 4IR4A 4NRBA 5F25A 4UIYA 5D26A 5EI4A 4NRCA 4CUPA 3I3JA 4MENA 5E9VA 5F1LA 5H1UA 5DFDA 4O70A 4O78A 5F1HA 4NR6A 3U5JA 3O36A 5CY9A 4OGJA 2WP2A 4TT2A 5AMFA 3Q2EA 4NYWA 4YYNA 5BT5A 3Q2FA 4QYDA 5EPSA 5AD3A 4TU6A 5EM3A 3TLPA 4XYAA 5AMEA 5EWWA 2RS9B 4XY9A 5FE7A 5D3RA 4IR3A 5KU3A 5LKUA 5LJ0A 4YYKA 4QC3A 4WHWA 4NS5A 5FE5A 2L84A 5BT4A 5D0CA 5FG4A 5FE8A 5FG6A 3UV4A 2YEMA 5CUGA 5FH6A 4A9MA 5E7DA 3SVHA 5FE6A 5I80A 2FSAA 5D3NA 4PTBA 4QB3A 5A5OA 5CUEA 4YAXA 5A81A 4TU4A 4LZRA 4UIVA 5HCLA 4NUDA 4QSUA 5E9MA 4YBTA 4BW4A 5D24A 5FE3A 4XUAA 3AADA 4ZW1A 5C85A 3MULA 3O35A 4N3WA 5HM0A 5IGLA
chains in the Genus database with same CATH superfamily
4Y03A 4UIUA 4A9FA 2I7KA 4QYLA 2YW5A 5D7XA 5I89A 4NQNA 3HMFA 4O7CA 4UIXA 4LR6A 4PKLA 3P1CA 5FBXA 3ONIA 4QR4A 5ENJA 5F2PA 4QEVA 4QUTA 4LDFA 2E7OA 4UYDA 4NQMA 5FFVA 4YH3A 4IR6A 4MR4A 5DYUA 2R0VA 2N9GA 5A5QA 4QSXA 5DBMA 5CU8A 2R0SA 4X2IA 5TCMA 5EISA 5IG6A 3DWYA 5FB1A 1JSPB 5FG5A 4BW2A 5E3DA 4J1PA 4LC2A 2G4AA 4QSWA 5HQ7A 5CS8A 5DX4A 3HMEA 5FH7A 5LVQA 2RFJA 3D1BA 5EQ1A 5DKDA 4NYXA 4Q0OA 5II2A 5EGUA 4N4FA 4CUQA 4YYIA 5HFQA 5KO4A 2OSSA 5HLSA 3LQHA 4QSRA 3LQIA 4N4HA 4YK0A 4FLPA 5F61A 5EPBA 4UYHA 4RVRA 4HBYA 4CUTA 4YYDA 4TYLA 3FKMX 5ENBA 5F5ZA 2F6JA 4MR3A 2YDWA 5IIDA 1EQFA 5CQ5A 3UVXA 3QZVA 4UYEA 2E7NA 4Z1QA 4LYSA 4ALHA 5C87A 4TZ2A 5I7XA 2WP1A 4C66A 4TTEA 5KTXA 5LKTA 5A5SA 5D3JA 2OUOA 4OGIA 3QZTA 4QC1A 2R0YA 5L8TA 4LZSA 5ETDA 5DYXA 4YYJA 2I8NA 4PCEA 4A9NA 4AKGA 4O7EA 3G0JA 3U5NA 5DLZA 4CFLA 5EWCA 4UYFB 5HRXA 5JWMA 2L85A 3S91A 5IBNA 4J3IA 4NR8A 4ZC9A 4YABA 3NXBA 4KV1A 3LQJA 3MB3A 4PS5A 4MEOA 2DKWA 4IR5A 4A9IA 5EU1A 5AD2A 1N72A 4IOQA 4Z1SA 4UIZA 2H60A 3U5MA 3U5OA 4XUBA 4QEUA 5H1TA 5LKXA 4N4IA 4BW3A 5ACYA 4HXPA 5CUAA 3HMHA 4GPJA 5EWVA 3MUKA 4KCXA 5DY7A 3DAIA 5CPEA 4UIWA 2L5EA 5DW1A 5E9YA 3LJWA 5F62A 4WHUA 3UV2A 5DFBA 5FE1A 5A83A 4CURA 5HQ6A 5EICA 3UVYA 5FFWA 5F63A 1WUMA 4TZ8A 5H85A 5HELA 4UYFA 2LSPB 2F6NA 5IGKA 3VKHA 4HXKA 4NYVA 5FH8A 5HRWA 1X0JA 3MB4A 3S92A 3IU6A 4YYMA 5C4QA 5D3SA 1ZKRA 5CQ3A 3UVDA 4O71A 1E6IA 4HBXA 3MXFA 5DYCA 4F3IA 5HFRA 5L99A 5CRZA 4AKIA 5CQ6A 5D3TA 3U5KA 3P1FA 4YY4A 5CQ8A 5E74A 5C7NA 3O33A 5A5NA 5CQ4A 5HEMA 2OO1A 4CUSA 2E3KA 1F68A 4QSPA 4BHWA 4WIVA 4N4GA 4LZ2A 2RNYA 4Z6HA 5KTUA 4HXNA 4HXMA 3O34A 5ENHA 5DFCA 3D7CA 4A9LA 5DW2A 3D1DA 4ZQLA 4O72A 5LJ2A 4A9HA 4YBSA 4LYWA 4TT4A 4XY8A 4NR9A 5ENGA 4QSVA 5A85A 4O7AA 2R10A 5KTWA 5CUCA 4TT6A 3P1DA 5EWDA 5CFWA 3G0LA 4MR5A 5FFYA 4LYIA 5EV9A 5EP7A 4HXRA 5CZGA 3VKGA 5ENIA 5FE2A 5A82A 2YQDA 4YYGA 4CUUA 3P5OA 2MJVB 5L96A 3LXJA 3SVFA 5KHMA 2D82A 5D3PA 3UV5A 5E9LA 5ENCA 2RNWA 3ZYUA 4QSTA 2RI7A 4TS8A 5CGPA 4PCIA 5DKCA 4UITA 5I1QA 5EK9A 5LKZA 5D25A 3JVJA 5E9IA 4A9EA 4ALGA 5H1VA 4HXLA 2D9EA 5HRVA 4HBWA 4HXSA 5I83A 4QUUA 4O76A 4O77A 5K29A 5CRMA 3SVGA 4DONA 4QSSA 2DVRA 5F60A 4QEWA 4A9JA 3UW9A 4NXJA 2RNXA 4KV4A 4NR7A 2GRCA 5J0DA 5I88A 3O37A 2NXBA 4C67A 5D3LA 4IOOA 5DKHA 5E73A 4BW1A 4QBMA 2EJNA 5DYAA 5I86A 4NUCA 4QY4A 4O7FA 4QR5A 2DVVA 3GG3A 5BT3A 4MEPA 5CTLA 3ERRA 5A7CA 2DATA 4YBMA 4YADA 5FB0A 4J0SA 4Z93A 2DVQA 4O7BA 2KTBB 5F36A 3P1EA 4Q0NA 4YATA 5C8GA 5A5RA 3K2JA 1JM4B 4AI6A 2YYNA 5HJCA 5HQ5A 3JVMA 5E9KA 3U5PA 5FDZA 4YY6A 3JVKA 3AQAA 4E96A 5L97A 5I29A 4NR5A 4A9OA 5DLXA 4CLBA 3JVLA 5I7YA 1ZS5A 5LUUA 5CQAA 3U5LA 2RO1A 5ENFA 4A9KA 5IGNA 5G4SA 5L8UA 5G4RA 1PUOA 4OUFA 4QSQA 1WUGA 4UYGA 5ETBA 5FE4A 5D3HA 4HBVA 4NRAA 5CP5A 4NR4A 5TB6A 5ENEA 3MQMA 4CL9A 4MR6A 5EA1A 5EVAA 3QZSA 2DWWA 4YYHA 4QZSA 5CQTA 4J0RA 5A5PA 5EWHA 5FE9A 4LRGA 3RCWA 4Z6IA 5C89A 4NUEA 5F3AA 5COIA 4YH4A 5I40A 3UVWA 5HENA 5E3GA 4QR3A 5IGMA 2DVSA 4HXOA 5E0RA 5CQ7A 4O75A 4CFKA 5EPRA 4QNSA 3IU5A 5CUBA 4YC9A 4PY6A 5JI8A 4IORA 4O74A 4AKNA 2YELA 5CUDA 4MEQA 5FE0A 5LJ1A 2YEKA 4BJXA 4TQNA 5LVRA 5II1A 5L98A 4IR4A 4NRBA 5F25A 4UIYA 5D26A 5EI4A 4NRCA 4CUPA 3I3JA 4MENA 5E9VA 5F1LA 5H1UA 5DFDA 4O70A 4O78A 5F1HA 4NR6A 3U5JA 3O36A 5CY9A 4OGJA 2WP2A 4TT2A 5AMFA 3Q2EA 4NYWA 4YYNA 5BT5A 4AKHA 3Q2FA 4QYDA 5EPSA 5AD3A 4TU6A 5EM3A 3TLPA 4XYAA 5AMEA 5EWWA 2RS9B 4XY9A 5FE7A 5D3RA 4IR3A 5KU3A 5LKUA 5LJ0A 4YYKA 4QC3A 4WHWA 4NS5A 5FE5A 2L84A 5BT4A 5D0CA 5FG4A 5FE8A 5FG6A 3UV4A 2YEMA 5CUGA 5FH6A 4A9MA 5E7DA 3SVHA 5FE6A 5I80A 2FSAA 5D3NA 4PTBA 4QB3A 5A5OA 5CUEA 4YAXA 5A81A 4TU4A 4LZRA 4UIVA 5HCLA 4NUDA 4QSUA 5E9MA 4YBTA 4BW4A 5D24A 5FE3A 4XUAA 3AADA 4ZW1A 5C85A 3MULA 3O35A 4N3WA 5HM0A 5IGLA
chains in the Genus database with same CATH topology
4Y03A 4UIUA 4A9FA 2I7KA 4QYLA 2YW5A 5D7XA 5I89A 4NQNA 3HMFA 4O7CA 4UIXA 4LR6A 4PKLA 3P1CA 5FBXA 3ONIA 4QR4A 5ENJA 5F2PA 4QEVA 4QUTA 4LDFA 2E7OA 4UYDA 4NQMA 5FFVA 4YH3A 4IR6A 4MR4A 5DYUA 2R0VA 2N9GA 5A5QA 4QSXA 5DBMA 5CU8A 2R0SA 4X2IA 5TCMA 5EISA 5IG6A 3DWYA 5FB1A 1JSPB 5FG5A 4BW2A 5E3DA 4J1PA 4LC2A 2G4AA 4QSWA 5HQ7A 5CS8A 5DX4A 3HMEA 5FH7A 5LVQA 2RFJA 5EQ1A 5DKDA 4NYXA 4Q0OA 5II2A 5EGUA 4N4FA 4CUQA 4YYIA 5HFQA 5KO4A 2OSSA 5HLSA 3LQHA 4QSRA 3LQIA 4N4HA 4YK0A 4FLPA 5F61A 5EPBA 4UYHA 4RVRA 4HBYA 4CUTA 4YYDA 4TYLA 3FKMX 5ENBA 5F5ZA 2F6JA 4MR3A 2YDWA 5IIDA 1EQFA 5CQ5A 3UVXA 3QZVA 4UYEA 2E7NA 4Z1QA 4LYSA 4ALHA 5C87A 4TZ2A 5I7XA 2WP1A 4C66A 4TTEA 5KTXA 5LKTA 5A5SA 5D3JA 2OUOA 4OGIA 3QZTA 4QC1A 2R0YA 5L8TA 4LZSA 5ETDA 5DYXA 4YYJA 2I8NA 4PCEA 4A9NA 4O7EA 3G0JA 3U5NA 5DLZA 4CFLA 5EWCA 4UYFB 5HRXA 5JWMA 2L85A 3S91A 5IBNA 4J3IA 4NR8A 4ZC9A 4YABA 3NXBA 4KV1A 3LQJA 3MB3A 4PS5A 4MEOA 2DKWA 4IR5A 4A9IA 5EU1A 5AD2A 1N72A 4IOQA 4Z1SA 4UIZA 2H60A 3U5MA 3U5OA 4XUBA 4QEUA 5H1TA 5LKXA 4N4IA 4BW3A 5ACYA 4HXPA 5CUAA 3HMHA 4GPJA 5EWVA 3MUKA 4KCXA 5DY7A 3DAIA 5CPEA 4UIWA 2L5EA 5DW1A 5E9YA 3LJWA 5F62A 4WHUA 3UV2A 5DFBA 5FE1A 5A83A 4CURA 5HQ6A 5EICA 3UVYA 5FFWA 5F63A 1WUMA 4TZ8A 5H85A 5HELA 4UYFA 2LSPB 2F6NA 5IGKA 4HXKA 4NYVA 5FH8A 5HRWA 1X0JA 3MB4A 3S92A 3IU6A 4YYMA 5C4QA 5D3SA 3UVDA 5CQ3A 4O71A 1E6IA 4HBXA 3MXFA 5DYCA 4F3IA 5HFRA 5L99A 5CRZA 5CQ6A 5D3TA 3U5KA 3P1FA 4YY4A 5CQ8A 5E74A 5C7NA 3O33A 5A5NA 5CQ4A 5HEMA 2OO1A 4CUSA 2E3KA 1F68A 4QSPA 4BHWA 4WIVA 4N4GA 4LZ2A 2RNYA 4Z6HA 5KTUA 4HXNA 4HXMA 3O34A 5ENHA 5DFCA 3D7CA 4A9LA 5DW2A 4ZQLA 4O72A 5LJ2A 4A9HA 4YBSA 4LYWA 4TT4A 4XY8A 4NR9A 5ENGA 4QSVA 5A85A 4O7AA 2R10A 5KTWA 5CUCA 4TT6A 3P1DA 5EWDA 5CFWA 3G0LA 4MR5A 5FFYA 4LYIA 5EV9A 5EP7A 4HXRA 5CZGA 5ENIA 5FE2A 5A82A 2YQDA 4YYGA 4CUUA 3P5OA 2MJVB 5L96A 3LXJA 3SVFA 5KHMA 2D82A 5D3PA 3UV5A 5E9LA 5ENCA 2RNWA 3ZYUA 4QSTA 2RI7A 4TS8A 5CGPA 4PCIA 5DKCA 4UITA 5I1QA 5EK9A 5LKZA 5D25A 3JVJA 5E9IA 4A9EA 4ALGA 5H1VA 4HXLA 2D9EA 5HRVA 4HBWA 4HXSA 5I83A 4QUUA 4O76A 4O77A 5K29A 5CRMA 3SVGA 4DONA 4QSSA 2DVRA 5F60A 4QEWA 4A9JA 3UW9A 4NXJA 2RNXA 4KV4A 4NR7A 2GRCA 5J0DA 5I88A 3O37A 2NXBA 4C67A 5D3LA 4IOOA 5DKHA 5E73A 4BW1A 4QBMA 5DYAA 5I86A 4NUCA 4O7FA 4QR5A 2DVVA 4QY4A 3GG3A 5BT3A 4MEPA 5CTLA 5A7CA 2DATA 4YBMA 4YADA 5FB0A 4Z93A 4J0SA 2DVQA 4O7BA 2KTBB 5F36A 3P1EA 4Q0NA 4YATA 5C8GA 5A5RA 3K2JA 1JM4B 2YYNA 5HJCA 5HQ5A 3JVMA 5E9KA 3U5PA 5FDZA 4YY6A 3JVKA 3AQAA 4E96A 5L97A 5I29A 4NR5A 4A9OA 5DLXA 4CLBA 3JVLA 5I7YA 1ZS5A 5LUUA 5CQAA 3U5LA 2RO1A 5ENFA 4A9KA 5IGNA 5G4SA 5L8UA 5G4RA 4OUFA 4QSQA 1WUGA 4UYGA 5ETBA 5FE4A 5D3HA 4HBVA 4NRAA 5CP5A 4NR4A 5TB6A 5ENEA 3MQMA 4CL9A 4MR6A 5EA1A 5EVAA 3QZSA 2DWWA 4YYHA 4QZSA 5CQTA 4J0RA 5A5PA 5EWHA 5FE9A 4LRGA 3RCWA 4Z6IA 5C89A 4NUEA 5F3AA 5COIA 4YH4A 5I40A 3UVWA 5HENA 5E3GA 4QR3A 5IGMA 2DVSA 4HXOA 5E0RA 5CQ7A 4O75A 4CFKA 5EPRA 4QNSA 3IU5A 5CUBA 4YC9A 4PY6A 5JI8A 4IORA 4O74A 4AKNA 2YELA 5CUDA 4MEQA 5FE0A 5LJ1A 2YEKA 4BJXA 4TQNA 5LVRA 5II1A 5L98A 4IR4A 4NRBA 5F25A 4UIYA 5D26A 5EI4A 4NRCA 4CUPA 3I3JA 4MENA 5E9VA 5F1LA 5H1UA 5DFDA 4O70A 4O78A 5F1HA 4NR6A 3U5JA 3O36A 5CY9A 4OGJA 2WP2A 4TT2A 5AMFA 3Q2EA 4NYWA 4YYNA 5BT5A 3Q2FA 4QYDA 5EPSA 5AD3A 4TU6A 5EM3A 3TLPA 4XYAA 5AMEA 5EWWA 2RS9B 4XY9A 5FE7A 5D3RA 4IR3A 5KU3A 5LKUA 5LJ0A 4YYKA 4QC3A 4WHWA 4NS5A 5FE5A 2L84A 5BT4A 5D0CA 5FG4A 5FE8A 5FG6A 3UV4A 2YEMA 5CUGA 5FH6A 4A9MA 5E7DA 3SVHA 5FE6A 5I80A 2FSAA 5D3NA 4PTBA 4QB3A 5A5OA 5CUEA 4YAXA 5A81A 4TU4A 4LZRA 4UIVA 5HCLA 4NUDA 4QSUA 5E9MA 4YBTA 4BW4A 5D24A 5FE3A 4XUAA 3AADA 4ZW1A 5C85A 3MULA 3O35A 4N3WA 5HM0A 5IGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y03 A;  4UIU A;  4A9F A;  2I7K A;  4QYL A;  2YW5 A;  5D7X A;  5I89 A;  4NQN A;  3HMF A;  4O7C A;  4UIX A;  4LR6 A;  4PKL A;  3P1C A;  5FBX A;  3ONI A;  4QR4 A;  5ENJ A;  5F2P A;  4QEV A;  4QUT A;  4LDF A;  2E7O A;  4UYD A;  4NQM A;  5FFV A;  4YH3 A;  4IR6 A;  4MR4 A;  5DYU A;  2R0V A;  2N9G A;  5A5Q A;  4QSX A;  5DBM A;  5CU8 A;  2R0S A;  4X2I A;  5TCM A;  5EIS A;  5IG6 A;  3DWY A;  5FB1 A;  1JSP B;  5FG5 A;  4BW2 A;  5E3D A;  4J1P A;  4LC2 A;  2G4A A;  4QSW A;  5HQ7 A;  5CS8 A;  5DX4 A;  3HME A;  5FH7 A;  5LVQ A;  2RFJ A;  5EQ1 A;  5DKD A;  4NYX A;  4Q0O A;  5II2 A;  5EGU A;  4N4F A;  4CUQ A;  4YYI A;  5HFQ A;  5KO4 A;  2OSS A;  5HLS A;  3LQH A;  4QSR A;  3LQI A;  4N4H A;  4YK0 A;  4FLP A;  5F61 A;  5EPB A;  4UYH A;  4RVR A;  4HBY A;  4CUT A;  4YYD A;  4TYL A;  3FKM X;  5ENB A;  5F5Z A;  2F6J A;  4MR3 A;  2YDW A;  5IID A;  1EQF A;  5CQ5 A;  3UVX A;  3QZV A;  4UYE A;  2E7N A;  4Z1Q A;  4LYS A;  4ALH A;  5C87 A;  4TZ2 A;  5I7X A;  2WP1 A;  4C66 A;  4TTE A;  5KTX A;  5LKT A;  5A5S A;  5D3J A;  2OUO A;  4OGI A;  3QZT A;  4QC1 A;  2R0Y A;  5L8T A;  4LZS A;  5ETD A;  5DYX A;  4YYJ A;  2I8N A;  4PCE A;  4A9N A;  4O7E A;  3G0J A;  3U5N A;  5DLZ A;  4CFL A;  5EWC A;  4UYF B;  5HRX A;  5JWM A;  2L85 A;  3S91 A;  5IBN A;  4J3I A;  4NR8 A;  4ZC9 A;  4YAB A;  3NXB A;  4KV1 A;  3LQJ A;  3MB3 A;  4PS5 A;  4MEO A;  2DKW A;  4IR5 A;  4A9I A;  5EU1 A;  5AD2 A;  1N72 A;  4IOQ A;  4Z1S A;  4UIZ A;  2H60 A;  3U5M A;  3U5O A;  4XUB A;  4QEU A;  5H1T A;  5LKX A;  4N4I A;  4BW3 A;  5ACY A;  4HXP A;  5CUA A;  3HMH A;  4GPJ A;  5EWV A;  3MUK A;  4KCX A;  5DY7 A;  3DAI A;  5CPE A;  4UIW A;  2L5E A;  5DW1 A;  5E9Y A;  3LJW A;  5F62 A;  4WHU A;  3UV2 A;  5DFB A;  5FE1 A;  5A83 A;  4CUR A;  5HQ6 A;  5EIC A;  3UVY A;  5FFW A;  5F63 A;  1WUM A;  4TZ8 A;  5H85 A;  5HEL A;  4UYF A;  2LSP B;  2F6N A;  5IGK A;  4HXK A;  4NYV A;  5FH8 A;  5HRW A;  1X0J A;  3MB4 A;  3S92 A;  3IU6 A;  4YYM A;  5C4Q A;  5D3S A;  3UVD A;  5CQ3 A;  4O71 A;  1E6I A;  4HBX A;  3MXF A;  5DYC A;  4F3I A;  5HFR A;  5L99 A;  5CRZ A;  5CQ6 A;  5D3T A;  3U5K A;  3P1F A;  4YY4 A;  5CQ8 A;  5E74 A;  5C7N A;  3O33 A;  5A5N A;  5CQ4 A;  5HEM A;  2OO1 A;  4CUS A;  2E3K A;  1F68 A;  4QSP A;  4BHW A;  4WIV A;  4N4G A;  4LZ2 A;  2RNY A;  4Z6H A;  5KTU A;  4HXN A;  4HXM A;  3O34 A;  5ENH A;  5DFC A;  3D7C A;  4A9L A;  5DW2 A;  4ZQL A;  4O72 A;  5LJ2 A;  4A9H A;  4YBS A;  4LYW A;  4TT4 A;  4XY8 A;  4NR9 A;  5ENG A;  4QSV A;  5A85 A;  4O7A A;  2R10 A;  5KTW A;  5CUC A;  4TT6 A;  3P1D A;  5EWD A;  5CFW A;  3G0L A;  4MR5 A;  5FFY A;  4LYI A;  5EV9 A;  5EP7 A;  4HXR A;  5CZG A;  5ENI A;  5FE2 A;  5A82 A;  2YQD A;  4YYG A;  4CUU A;  3P5O A;  2MJV B;  5L96 A;  3LXJ A;  3SVF A;  5KHM A;  2D82 A;  5D3P A;  3UV5 A;  5E9L A;  5ENC A;  2RNW A;  3ZYU A;  4QST A;  2RI7 A;  4TS8 A;  5CGP A;  4PCI A;  5DKC A;  4UIT A;  5I1Q A;  5EK9 A;  5LKZ A;  5D25 A;  3JVJ A;  5E9I A;  4A9E A;  4ALG A;  5H1V A;  4HXL A;  2D9E A;  5HRV A;  4HBW A;  4HXS A;  5I83 A;  4QUU A;  4O76 A;  4O77 A;  5K29 A;  5CRM A;  3SVG A;  4DON A;  4QSS A;  2DVR A;  5F60 A;  4QEW A;  4A9J A;  3UW9 A;  4NXJ A;  2RNX A;  4KV4 A;  4NR7 A;  2GRC A;  5J0D A;  5I88 A;  3O37 A;  2NXB A;  4C67 A;  5D3L A;  4IOO A;  5DKH A;  5E73 A;  4BW1 A;  4QBM A;  5DYA A;  5I86 A;  4NUC A;  4O7F A;  4QR5 A;  2DVV A;  4QY4 A;  3GG3 A;  5BT3 A;  4MEP A;  5CTL A;  5A7C A;  2DAT A;  4YBM A;  4YAD A;  5FB0 A;  4Z93 A;  4J0S A;  2DVQ A;  4O7B A;  2KTB B;  5F36 A;  3P1E A;  4Q0N A;  4YAT A;  5C8G A;  5A5R A;  3K2J A;  1JM4 B;  2YYN A;  5HJC A;  5HQ5 A;  3JVM A;  5E9K A;  3U5P A;  5FDZ A;  4YY6 A;  3JVK A;  3AQA A;  4E96 A;  5L97 A;  5I29 A;  4NR5 A;  4A9O A;  5DLX A;  4CLB A;  3JVL A;  5I7Y A;  1ZS5 A;  5LUU A;  5CQA A;  3U5L A;  2RO1 A;  5ENF A;  4A9K A;  5IGN A;  5G4S A;  5L8U A;  5G4R A;  4OUF A;  4QSQ A;  1WUG A;  4UYG A;  5ETB A;  5FE4 A;  5D3H A;  4HBV A;  4NRA A;  5CP5 A;  4NR4 A;  5TB6 A;  5ENE A;  3MQM A;  4CL9 A;  4MR6 A;  5EA1 A;  5EVA A;  3QZS A;  2DWW A;  4YYH A;  4QZS A;  5CQT A;  4J0R A;  5A5P A;  5EWH A;  5FE9 A;  4LRG A;  3RCW A;  4Z6I A;  5C89 A;  4NUE A;  5F3A A;  5COI A;  4YH4 A;  5I40 A;  3UVW A;  5HEN A;  5E3G A;  4QR3 A;  5IGM A;  2DVS A;  4HXO A;  5E0R A;  5CQ7 A;  4O75 A;  4CFK A;  5EPR A;  4QNS A;  3IU5 A;  5CUB A;  4YC9 A;  4PY6 A;  5JI8 A;  4IOR A;  4O74 A;  4AKN A;  2YEL A;  5CUD A;  4MEQ A;  5FE0 A;  5LJ1 A;  2YEK A;  4BJX A;  4TQN A;  5LVR A;  5II1 A;  5L98 A;  4IR4 A;  4NRB A;  5F25 A;  4UIY A;  5D26 A;  5EI4 A;  4NRC A;  4CUP A;  3I3J A;  4MEN A;  5E9V A;  5F1L A;  5H1U A;  5DFD A;  4O70 A;  4O78 A;  5F1H A;  4NR6 A;  3U5J A;  3O36 A;  5CY9 A;  4OGJ A;  2WP2 A;  4TT2 A;  5AMF A;  3Q2E A;  4NYW A;  4YYN A;  5BT5 A;  3Q2F A;  4QYD A;  5EPS A;  5AD3 A;  4TU6 A;  5EM3 A;  3TLP A;  4XYA A;  5AME A;  5EWW A;  2RS9 B;  4XY9 A;  5FE7 A;  5D3R A;  4IR3 A;  5KU3 A;  5LKU A;  5LJ0 A;  4YYK A;  4QC3 A;  4WHW A;  4NS5 A;  5FE5 A;  2L84 A;  5BT4 A;  5D0C A;  5FG4 A;  5FE8 A;  5FG6 A;  3UV4 A;  2YEM A;  5CUG A;  5FH6 A;  4A9M A;  5E7D A;  3SVH A;  5FE6 A;  5I80 A;  2FSA A;  5D3N A;  4PTB A;  4QB3 A;  5A5O A;  5CUE A;  4YAX A;  5A81 A;  4TU4 A;  4LZR A;  4UIV A;  5HCL A;  4NUD A;  4QSU A;  5E9M A;  4YBT A;  4BW4 A;  5D24 A;  5FE3 A;  4XUA A;  3AAD A;  4ZW1 A;  5C85 A;  3MUL A;  3O35 A;  4N3W A;  5HM0 A;  5IGL A; 
#chains in the Genus database with same CATH topology
 4Y03 A;  4UIU A;  4A9F A;  2I7K A;  4QYL A;  2YW5 A;  5D7X A;  5I89 A;  4NQN A;  3HMF A;  4O7C A;  4UIX A;  4LR6 A;  4PKL A;  3P1C A;  5FBX A;  3ONI A;  4QR4 A;  5ENJ A;  5F2P A;  4QEV A;  4QUT A;  4LDF A;  2E7O A;  4UYD A;  4NQM A;  5FFV A;  4YH3 A;  4IR6 A;  4MR4 A;  5DYU A;  2R0V A;  2N9G A;  5A5Q A;  4QSX A;  5DBM A;  5CU8 A;  2R0S A;  4X2I A;  5TCM A;  5EIS A;  5IG6 A;  3DWY A;  5FB1 A;  1JSP B;  5FG5 A;  4BW2 A;  5E3D A;  4J1P A;  4LC2 A;  2G4A A;  4QSW A;  5HQ7 A;  5CS8 A;  5DX4 A;  3HME A;  5FH7 A;  5LVQ A;  2RFJ A;  3D1B A;  5EQ1 A;  5DKD A;  4NYX A;  4Q0O A;  5II2 A;  5EGU A;  4N4F A;  4CUQ A;  4YYI A;  5HFQ A;  5KO4 A;  2OSS A;  5HLS A;  3LQH A;  4QSR A;  3LQI A;  4N4H A;  4YK0 A;  4FLP A;  5F61 A;  5EPB A;  4UYH A;  4RVR A;  4HBY A;  4CUT A;  4YYD A;  4TYL A;  3FKM X;  5ENB A;  5F5Z A;  2F6J A;  4MR3 A;  2YDW A;  5IID A;  1EQF A;  5CQ5 A;  3UVX A;  3QZV A;  4UYE A;  2E7N A;  4Z1Q A;  4LYS A;  4ALH A;  5C87 A;  4TZ2 A;  5I7X A;  2WP1 A;  4C66 A;  4TTE A;  5KTX A;  5LKT A;  5A5S A;  5D3J A;  2OUO A;  4OGI A;  3QZT A;  4QC1 A;  2R0Y A;  5L8T A;  4LZS A;  5ETD A;  5DYX A;  4YYJ A;  2I8N A;  4PCE A;  4A9N A;  4AKG A;  4O7E A;  3G0J A;  3U5N A;  5DLZ A;  4CFL A;  5EWC A;  4UYF B;  5HRX A;  5JWM A;  2L85 A;  3S91 A;  5IBN A;  4J3I A;  4NR8 A;  4ZC9 A;  4YAB A;  3NXB A;  4KV1 A;  3LQJ A;  3MB3 A;  4PS5 A;  4MEO A;  2DKW A;  4IR5 A;  4A9I A;  5EU1 A;  5AD2 A;  1N72 A;  4IOQ A;  4Z1S A;  4UIZ A;  2H60 A;  3U5M A;  3U5O A;  4XUB A;  4QEU A;  5H1T A;  5LKX A;  4N4I A;  4BW3 A;  5ACY A;  4HXP A;  5CUA A;  3HMH A;  4GPJ A;  5EWV A;  3MUK A;  4KCX A;  5DY7 A;  3DAI A;  5CPE A;  4UIW A;  2L5E A;  5DW1 A;  5E9Y A;  3LJW A;  5F62 A;  4WHU A;  3UV2 A;  5DFB A;  5FE1 A;  5A83 A;  4CUR A;  5HQ6 A;  5EIC A;  3UVY A;  5FFW A;  5F63 A;  1WUM A;  4TZ8 A;  5H85 A;  5HEL A;  4UYF A;  2LSP B;  2F6N A;  5IGK A;  3VKH A;  4HXK A;  4NYV A;  5FH8 A;  5HRW A;  1X0J A;  3MB4 A;  3S92 A;  3IU6 A;  4YYM A;  5C4Q A;  5D3S A;  1ZKR A;  5CQ3 A;  3UVD A;  4O71 A;  1E6I A;  4HBX A;  3MXF A;  5DYC A;  4F3I A;  5HFR A;  5L99 A;  5CRZ A;  4AKI A;  5CQ6 A;  5D3T A;  3U5K A;  3P1F A;  4YY4 A;  5CQ8 A;  5E74 A;  5C7N A;  3O33 A;  5A5N A;  5CQ4 A;  5HEM A;  2OO1 A;  4CUS A;  2E3K A;  1F68 A;  4QSP A;  4BHW A;  4WIV A;  4N4G A;  4LZ2 A;  2RNY A;  4Z6H A;  5KTU A;  4HXN A;  4HXM A;  3O34 A;  5ENH A;  5DFC A;  3D7C A;  4A9L A;  5DW2 A;  3D1D A;  4ZQL A;  4O72 A;  5LJ2 A;  4A9H A;  4YBS A;  4LYW A;  4TT4 A;  4XY8 A;  4NR9 A;  5ENG A;  4QSV A;  5A85 A;  4O7A A;  2R10 A;  5KTW A;  5CUC A;  4TT6 A;  3P1D A;  5EWD A;  5CFW A;  3G0L A;  4MR5 A;  5FFY A;  4LYI A;  5EV9 A;  5EP7 A;  4HXR A;  5CZG A;  3VKG A;  5ENI A;  5FE2 A;  5A82 A;  2YQD A;  4YYG A;  4CUU A;  3P5O A;  2MJV B;  5L96 A;  3LXJ A;  3SVF A;  5KHM A;  2D82 A;  5D3P A;  3UV5 A;  5E9L A;  5ENC A;  2RNW A;  3ZYU A;  4QST A;  2RI7 A;  4TS8 A;  5CGP A;  4PCI A;  5DKC A;  4UIT A;  5I1Q A;  5EK9 A;  5LKZ A;  5D25 A;  3JVJ A;  5E9I A;  4A9E A;  4ALG A;  5H1V A;  4HXL A;  2D9E A;  5HRV A;  4HBW A;  4HXS A;  5I83 A;  4QUU A;  4O76 A;  4O77 A;  5K29 A;  5CRM A;  3SVG A;  4DON A;  4QSS A;  2DVR A;  5F60 A;  4QEW A;  4A9J A;  3UW9 A;  4NXJ A;  2RNX A;  4KV4 A;  4NR7 A;  2GRC A;  5J0D A;  5I88 A;  3O37 A;  2NXB A;  4C67 A;  5D3L A;  4IOO A;  5DKH A;  5E73 A;  4BW1 A;  4QBM A;  2EJN A;  5DYA A;  5I86 A;  4NUC A;  4QY4 A;  4O7F A;  4QR5 A;  2DVV A;  3GG3 A;  5BT3 A;  4MEP A;  5CTL A;  3ERR A;  5A7C A;  2DAT A;  4YBM A;  4YAD A;  5FB0 A;  4J0S A;  4Z93 A;  2DVQ A;  4O7B A;  2KTB B;  5F36 A;  3P1E A;  4Q0N A;  4YAT A;  5C8G A;  5A5R A;  3K2J A;  1JM4 B;  4AI6 A;  2YYN A;  5HJC A;  5HQ5 A;  3JVM A;  5E9K A;  3U5P A;  5FDZ A;  4YY6 A;  3JVK A;  3AQA A;  4E96 A;  5L97 A;  5I29 A;  4NR5 A;  4A9O A;  5DLX A;  4CLB A;  3JVL A;  5I7Y A;  1ZS5 A;  5LUU A;  5CQA A;  3U5L A;  2RO1 A;  5ENF A;  4A9K A;  5IGN A;  5G4S A;  5L8U A;  5G4R A;  1PUO A;  4OUF A;  4QSQ A;  1WUG A;  4UYG A;  5ETB A;  5FE4 A;  5D3H A;  4HBV A;  4NRA A;  5CP5 A;  4NR4 A;  5TB6 A;  5ENE A;  3MQM A;  4CL9 A;  4MR6 A;  5EA1 A;  5EVA A;  3QZS A;  2DWW A;  4YYH A;  4QZS A;  5CQT A;  4J0R A;  5A5P A;  5EWH A;  5FE9 A;  4LRG A;  3RCW A;  4Z6I A;  5C89 A;  4NUE A;  5F3A A;  5COI A;  4YH4 A;  5I40 A;  3UVW A;  5HEN A;  5E3G A;  4QR3 A;  5IGM A;  2DVS A;  4HXO A;  5E0R A;  5CQ7 A;  4O75 A;  4CFK A;  5EPR A;  4QNS A;  3IU5 A;  5CUB A;  4YC9 A;  4PY6 A;  5JI8 A;  4IOR A;  4O74 A;  4AKN A;  2YEL A;  5CUD A;  4MEQ A;  5FE0 A;  5LJ1 A;  2YEK A;  4BJX A;  4TQN A;  5LVR A;  5II1 A;  5L98 A;  4IR4 A;  4NRB A;  5F25 A;  4UIY A;  5D26 A;  5EI4 A;  4NRC A;  4CUP A;  3I3J A;  4MEN A;  5E9V A;  5F1L A;  5H1U A;  5DFD A;  4O70 A;  4O78 A;  5F1H A;  4NR6 A;  3U5J A;  3O36 A;  5CY9 A;  4OGJ A;  2WP2 A;  4TT2 A;  5AMF A;  3Q2E A;  4NYW A;  4YYN A;  5BT5 A;  4AKH A;  3Q2F A;  4QYD A;  5EPS A;  5AD3 A;  4TU6 A;  5EM3 A;  3TLP A;  4XYA A;  5AME A;  5EWW A;  2RS9 B;  4XY9 A;  5FE7 A;  5D3R A;  4IR3 A;  5KU3 A;  5LKU A;  5LJ0 A;  4YYK A;  4QC3 A;  4WHW A;  4NS5 A;  5FE5 A;  2L84 A;  5BT4 A;  5D0C A;  5FG4 A;  5FE8 A;  5FG6 A;  3UV4 A;  2YEM A;  5CUG A;  5FH6 A;  4A9M A;  5E7D A;  3SVH A;  5FE6 A;  5I80 A;  2FSA A;  5D3N A;  4PTB A;  4QB3 A;  5A5O A;  5CUE A;  4YAX A;  5A81 A;  4TU4 A;  4LZR A;  4UIV A;  5HCL A;  4NUD A;  4QSU A;  5E9M A;  4YBT A;  4BW4 A;  5D24 A;  5FE3 A;  4XUA A;  3AAD A;  4ZW1 A;  5C85 A;  3MUL A;  3O35 A;  4N3W A;  5HM0 A;  5IGL A; 
#chains in the Genus database with same CATH homology
 4Y03 A;  4UIU A;  4A9F A;  2I7K A;  4QYL A;  2YW5 A;  5D7X A;  5I89 A;  4NQN A;  3HMF A;  4O7C A;  4UIX A;  4LR6 A;  4PKL A;  3P1C A;  5FBX A;  3ONI A;  4QR4 A;  5ENJ A;  5F2P A;  4QEV A;  4QUT A;  4LDF A;  2E7O A;  4UYD A;  4NQM A;  5FFV A;  4YH3 A;  4IR6 A;  4MR4 A;  5DYU A;  2R0V A;  2N9G A;  5A5Q A;  4QSX A;  5DBM A;  5CU8 A;  2R0S A;  4X2I A;  5TCM A;  5EIS A;  5IG6 A;  3DWY A;  5FB1 A;  1JSP B;  5FG5 A;  4BW2 A;  5E3D A;  4J1P A;  4LC2 A;  2G4A A;  4QSW A;  5HQ7 A;  5CS8 A;  5DX4 A;  3HME A;  5FH7 A;  5LVQ A;  2RFJ A;  5EQ1 A;  5DKD A;  4NYX A;  4Q0O A;  5II2 A;  5EGU A;  4N4F A;  4CUQ A;  4YYI A;  5HFQ A;  5KO4 A;  2OSS A;  5HLS A;  3LQH A;  4QSR A;  3LQI A;  4N4H A;  4YK0 A;  4FLP A;  5F61 A;  5EPB A;  4UYH A;  4RVR A;  4HBY A;  4CUT A;  4YYD A;  4TYL A;  3FKM X;  5ENB A;  5F5Z A;  2F6J A;  4MR3 A;  2YDW A;  5IID A;  1EQF A;  5CQ5 A;  3UVX A;  3QZV A;  4UYE A;  2E7N A;  4Z1Q A;  4LYS A;  4ALH A;  5C87 A;  4TZ2 A;  5I7X A;  2WP1 A;  4C66 A;  4TTE A;  5KTX A;  5LKT A;  5A5S A;  5D3J A;  2OUO A;  4OGI A;  3QZT A;  4QC1 A;  2R0Y A;  5L8T A;  4LZS A;  5ETD A;  5DYX A;  4YYJ A;  2I8N A;  4PCE A;  4A9N A;  4O7E A;  3G0J A;  3U5N A;  5DLZ A;  4CFL A;  5EWC A;  4UYF B;  5HRX A;  5JWM A;  2L85 A;  3S91 A;  5IBN A;  4J3I A;  4NR8 A;  4ZC9 A;  4YAB A;  3NXB A;  4KV1 A;  3LQJ A;  3MB3 A;  4PS5 A;  4MEO A;  2DKW A;  4IR5 A;  4A9I A;  5EU1 A;  5AD2 A;  1N72 A;  4IOQ A;  4Z1S A;  4UIZ A;  2H60 A;  3U5M A;  3U5O A;  4XUB A;  4QEU A;  5H1T A;  5LKX A;  4N4I A;  4BW3 A;  5ACY A;  4HXP A;  5CUA A;  3HMH A;  4GPJ A;  5EWV A;  3MUK A;  4KCX A;  5DY7 A;  3DAI A;  5CPE A;  4UIW A;  2L5E A;  5DW1 A;  5E9Y A;  3LJW A;  5F62 A;  4WHU A;  3UV2 A;  5DFB A;  5FE1 A;  5A83 A;  4CUR A;  5HQ6 A;  5EIC A;  3UVY A;  5FFW A;  5F63 A;  1WUM A;  4TZ8 A;  5H85 A;  5HEL A;  4UYF A;  2LSP B;  2F6N A;  5IGK A;  4HXK A;  4NYV A;  5FH8 A;  5HRW A;  1X0J A;  3MB4 A;  3S92 A;  3IU6 A;  4YYM A;  5C4Q A;  5D3S A;  3UVD A;  5CQ3 A;  4O71 A;  1E6I A;  4HBX A;  3MXF A;  5DYC A;  4F3I A;  5HFR A;  5L99 A;  5CRZ A;  5CQ6 A;  5D3T A;  3U5K A;  3P1F A;  4YY4 A;  5CQ8 A;  5E74 A;  5C7N A;  3O33 A;  5A5N A;  5CQ4 A;  5HEM A;  2OO1 A;  4CUS A;  2E3K A;  1F68 A;  4QSP A;  4BHW A;  4WIV A;  4N4G A;  4LZ2 A;  2RNY A;  4Z6H A;  5KTU A;  4HXN A;  4HXM A;  3O34 A;  5ENH A;  5DFC A;  3D7C A;  4A9L A;  5DW2 A;  4ZQL A;  4O72 A;  5LJ2 A;  4A9H A;  4YBS A;  4LYW A;  4TT4 A;  4XY8 A;  4NR9 A;  5ENG A;  4QSV A;  5A85 A;  4O7A A;  2R10 A;  5KTW A;  5CUC A;  4TT6 A;  3P1D A;  5EWD A;  5CFW A;  3G0L A;  4MR5 A;  5FFY A;  4LYI A;  5EV9 A;  5EP7 A;  4HXR A;  5CZG A;  5ENI A;  5FE2 A;  5A82 A;  2YQD A;  4YYG A;  4CUU A;  3P5O A;  2MJV B;  5L96 A;  3LXJ A;  3SVF A;  5KHM A;  2D82 A;  5D3P A;  3UV5 A;  5E9L A;  5ENC A;  2RNW A;  3ZYU A;  4QST A;  2RI7 A;  4TS8 A;  5CGP A;  4PCI A;  5DKC A;  4UIT A;  5I1Q A;  5EK9 A;  5LKZ A;  5D25 A;  3JVJ A;  5E9I A;  4A9E A;  4ALG A;  5H1V A;  4HXL A;  2D9E A;  5HRV A;  4HBW A;  4HXS A;  5I83 A;  4QUU A;  4O76 A;  4O77 A;  5K29 A;  5CRM A;  3SVG A;  4DON A;  4QSS A;  2DVR A;  5F60 A;  4QEW A;  4A9J A;  3UW9 A;  4NXJ A;  2RNX A;  4KV4 A;  4NR7 A;  2GRC A;  5J0D A;  5I88 A;  3O37 A;  2NXB A;  4C67 A;  5D3L A;  4IOO A;  5DKH A;  5E73 A;  4BW1 A;  4QBM A;  5DYA A;  5I86 A;  4NUC A;  4O7F A;  4QR5 A;  2DVV A;  4QY4 A;  3GG3 A;  5BT3 A;  4MEP A;  5CTL A;  5A7C A;  2DAT A;  4YBM A;  4YAD A;  5FB0 A;  4Z93 A;  4J0S A;  2DVQ A;  4O7B A;  2KTB B;  5F36 A;  3P1E A;  4Q0N A;  4YAT A;  5C8G A;  5A5R A;  3K2J A;  1JM4 B;  2YYN A;  5HJC A;  5HQ5 A;  3JVM A;  5E9K A;  3U5P A;  5FDZ A;  4YY6 A;  3JVK A;  3AQA A;  4E96 A;  5L97 A;  5I29 A;  4NR5 A;  4A9O A;  5DLX A;  4CLB A;  3JVL A;  5I7Y A;  1ZS5 A;  5LUU A;  5CQA A;  3U5L A;  2RO1 A;  5ENF A;  4A9K A;  5IGN A;  5G4S A;  5L8U A;  5G4R A;  4OUF A;  4QSQ A;  1WUG A;  4UYG A;  5ETB A;  5FE4 A;  5D3H A;  4HBV A;  4NRA A;  5CP5 A;  4NR4 A;  5TB6 A;  5ENE A;  3MQM A;  4CL9 A;  4MR6 A;  5EA1 A;  5EVA A;  3QZS A;  2DWW A;  4YYH A;  4QZS A;  5CQT A;  4J0R A;  5A5P A;  5EWH A;  5FE9 A;  4LRG A;  3RCW A;  4Z6I A;  5C89 A;  4NUE A;  5F3A A;  5COI A;  4YH4 A;  5I40 A;  3UVW A;  5HEN A;  5E3G A;  4QR3 A;  5IGM A;  2DVS A;  4HXO A;  5E0R A;  5CQ7 A;  4O75 A;  4CFK A;  5EPR A;  4QNS A;  3IU5 A;  5CUB A;  4YC9 A;  4PY6 A;  5JI8 A;  4IOR A;  4O74 A;  4AKN A;  2YEL A;  5CUD A;  4MEQ A;  5FE0 A;  5LJ1 A;  2YEK A;  4BJX A;  4TQN A;  5LVR A;  5II1 A;  5L98 A;  4IR4 A;  4NRB A;  5F25 A;  4UIY A;  5D26 A;  5EI4 A;  4NRC A;  4CUP A;  3I3J A;  4MEN A;  5E9V A;  5F1L A;  5H1U A;  5DFD A;  4O70 A;  4O78 A;  5F1H A;  4NR6 A;  3U5J A;  3O36 A;  5CY9 A;  4OGJ A;  2WP2 A;  4TT2 A;  5AMF A;  3Q2E A;  4NYW A;  4YYN A;  5BT5 A;  3Q2F A;  4QYD A;  5EPS A;  5AD3 A;  4TU6 A;  5EM3 A;  3TLP A;  4XYA A;  5AME A;  5EWW A;  2RS9 B;  4XY9 A;  5FE7 A;  5D3R A;  4IR3 A;  5KU3 A;  5LKU A;  5LJ0 A;  4YYK A;  4QC3 A;  4WHW A;  4NS5 A;  5FE5 A;  2L84 A;  5BT4 A;  5D0C A;  5FG4 A;  5FE8 A;  5FG6 A;  3UV4 A;  2YEM A;  5CUG A;  5FH6 A;  4A9M A;  5E7D A;  3SVH A;  5FE6 A;  5I80 A;  2FSA A;  5D3N A;  4PTB A;  4QB3 A;  5A5O A;  5CUE A;  4YAX A;  5A81 A;  4TU4 A;  4LZR A;  4UIV A;  5HCL A;  4NUD A;  4QSU A;  5E9M A;  4YBT A;  4BW4 A;  5D24 A;  5FE3 A;  4XUA A;  3AAD A;  4ZW1 A;  5C85 A;  3MUL A;  3O35 A;  4N3W A;  5HM0 A;  5IGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...