5DFDA

Crystal structure of brd2(bd2) w370f mutant with ligand 28 bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
108
structure length
108
Chain Sequence
SEQLKHCNGILKELLSKKHAAYAFPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title New Synthetic Routes to Triazolo-benzodiazepine Analogues: Expanding the Scope of the Bump-and-Hole Approach for Selective Bromo and Extra-Terminal (BET) Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dfdA00
4HBVA 5A5NA 4UITA 5EV9A 5L98A 4YABA 5LUUA 3P5OA 4CLBA 5HRXA 3TLPA 4O77A 5DY7A 4MEPA 5E9IA 5L97A 5HRVA 2KTBB 5IGLA 4NUEA 4QR5A 4BHWA 2R0SA 4NUCA 5CQ6A 4TYLA 4NYVA 5FE5A 4LYWA 4O7BA 4QY4A 5A81A 2R0YA 4QR3A 5A5RA 4O74A 4LC2A 2RNYA 4MEOA 5EWDA 4A9KA 5BT3A 3RCWA 4J1PA 3UVWA 4LDFA 2RNWA 5FBXA 5E9YA 5CQ5A 5CUGA 2L5EA 2OUOA 1WUMA 5D0CA 4TT4A 1JSPB 4NXJA 5F5ZA 5JWMA 3AQAA 5HJCA 5EISA 5AD3A 5LJ2A 5F2PA 5KO4A 4NS5A 5ACYA 2F6JA 5A83A 4O76A 5C85A 4NR9A 3O35A 5II2A 1F68A 4O70A 4QSWA 5F36A 4QBMA 4BW1A 5D3LA 2F6NA 5E3DA 4BJXA 4HXLA 5EU1A 2YDWA 4QSXA 5FE2A 2YEMA 4A9MA 4TT2A 4CUUA 4QEUA 4N4HA 4YATA 5F61A 4TZ8A 4IORA 5CQTA 4UYDA 5F63A 5FH6A 2MJVB 5G4RA 4UIYA 4YYDA 4Y03A 5EWCA 4PKLA 3IU5A 5IBNA 4IOOA 3JVJA 3NXBA 4J0RA 5HELA 3LJWA 4UIZA 5CQ4A 4YYGA 4IR5A 5F60A 4XUBA 4YYKA 4J3IA 4YK0A 5ETBA 3LXJA 4NRCA 4PCIA 4YH3A 2I7KA 4A9NA 5E9VA 4YY6A 4J0SA 4TT6A 1X0JA 4LYIA 5CUAA 3O34A 4N4FA 5A5SA 3JVLA 3G0JA 2YYNA 4QSPA 5DKCA 5ENBA 5IG6A 4OGIA 5HRWA 5TCMA 2LSPB 5D3SA 5HQ6A 5CUEA 5KTUA 3U5LA 4KV1A 5HM0A 3HMEA 5D3PA 5LVQA 3MB3A 4DONA 4QSUA 4O75A 4CUPA 5ENCA 4YBMA 5DW2A 4BW3A 2GRCA 4MR6A 5C7NA 5I80A 4YYHA 5ENGA 1E6IA 5F25A 3UV4A 3ONIA 2R10A 5G4SA 4ALHA 4PS5A 2L84A 5TB6A 5K29A 4NUDA 5HEMA 4UYFB 4YYJA 5AMFA 5CUCA 4XUAA 3LQHA 3MQMA 4AKNA 5ENJA 3DAIA 5LKTA 5D7XA 5FE8A 3HMHA 5EI4A 3I3JA 3P1DA 5DBMA 5FE7A 5LJ1A 4O78A 5EPBA 5EWWA 2DWWA 1ZS5A 5HQ5A 4YADA 5E9MA 4YY4A 5BT5A 3Q2FA 5E74A 2NXBA 5FH8A 5LKXA 4QUTA 4LZRA 5EPSA 4N3WA 2L85A 3P1FA 3QZSA 4N4GA 4F3IA 5CY9A 2H60A 5D3RA 2E7NA 4O72A 4E96A 5EGUA 2OSSA 4IR3A 1WUGA 4QSTA 4X2IA 3U5PA 4QSQA 5CZGA 2RNXA 2DATA 4QSVA 5D3HA 5I86A 5IGKA 3O33A 4QSSA 2G4AA 5BT4A 5ETDA 4NRBA 2DVQA 4NQMA 5EA1A 4QEWA 5DFBA 4O71A 5DKHA 5C89A 5AD2A 4GPJA 5FB0A 4O7CA 5EK9A 4QB3A 4UIWA 3O37A 5DYXA 4PY6A 4C66A 4CFLA 4KV4A 5AMEA 5CP5A 4NR6A 4A9EA 5D3NA 5KU3A 2N9GA 5DLXA 5CFWA 3MB4A 3P1EA 4IR4A 4YBSA 4HXKA 5EPRA 4UIUA 4LR6A 5FG6A 5DKDA 3DWYA 5C87A 5L99A 4RVRA 4CUSA 4Z6HA 5ENFA 1N72A 5E9KA 4Z1QA 2DKWA 5CQ8A 5ENIA 5F62A 4NR5A 5CRMA 3JVKA 5I29A 3K2JA 4MR4A 5D3TA 5FE9A 3MXFA 5FB1A 5H1TA 4UYHA 3O36A 4WIVA 5I83A 5LJ0A 3ZYUA 3JVMA 5EVAA 5HQ7A 4WHUA 5CQ7A 4TQNA 4NR4A 2YEKA 4MR5A 4YH4A 5H85A 4YYMA 5D26A 5CPEA 5D25A 4HXRA 4UYEA 4MENA 5ENHA 5FG5A 4HBWA 4Z1SA 5EQ1A 4UYGA 5I7XA 5D3JA 5LKUA 4A9OA 5L96A 4HBXA 4BW4A 5CUBA 5F3AA 5FG4A 5A85A 2YW5A 4HXMA 4ZC9A 2RFJA 5KHMA 5HLSA 3MULA 4QZSA 5DLZA 3HMFA 4CUTA 4NR7A 5A5PA 5DYCA 4Q0OA 4LZ2A 4TU4A 4A9IA 2RI7A 5EM3A 4Z6IA 5L8UA 4QSRA 3S92A 4A9LA 3U5NA 4ZW1A 2YQDA 5H1UA 2R0VA 4QNSA 4QYLA 4YC9A 5CQAA 4KCXA 4NYWA 5FFVA 4NR8A 2DVRA 4YAXA 4WHWA 4PTBA 5FE3A 4YYIA 3QZVA 5HFQA 5DFDA 5D24A 3LQJA 5E9LA 2OO1A 5EWVA 5F1LA 4NRAA 4OGJA 3UVYA 5KTXA 4XY9A 4NQNA 5I7YA 5IIDA 5C8GA 3P1CA 5I40A 2D9EA 5II1A 3UV5A 5KTWA 4QYDA 5DW1A 4TZ2A 5I89A 2WP2A 4UYFA 3U5OA 2RO1A 4XY8A 5CGPA 4LYSA 4QR4A 4CURA 5E3GA 5I88A 5JI8A 4C67A 2E7OA 4Q0NA 4HXOA 5DX4A 5A82A 3Q2EA 5CQ3A 5DFCA 5E0RA 4LZSA 4YBTA 5CUDA 5FE6A 3MUKA 3LQIA 3QZTA 4HBYA 5EWHA 5FFWA 4UIXA 4A9HA 2DVVA 3UW9A 2FSAA 4MR3A 5ENEA 4O7FA 5F1HA 4TTEA 5I1QA 4QC1A 5C4QA 5IGNA 2YELA 3FKMX 4IOQA 5EP7A 5H1VA 5LKZA 4O7EA 5A5QA 5L8TA 4CUQA 4CFKA 5E73A 5EICA 4QEVA 5FDZA 5FH7A 5E7DA 4ALGA 5IGMA 4MEQA 3D7CA 4O7AA 4UIVA 3U5MA 5A5OA 5FE0A 4IR6A 5CTLA 5CS8A 3SVHA 3GG3A 4PCEA 2E3KA 3UVXA 4FLPA 5HENA 4A9JA 4TU6A 3U5JA 4LRGA 5FE1A 2DVSA 5FE4A 3G0LA 5COIA 5HCLA 4BW2A 4Z93A 5FFYA 5HFRA 3SVGA 2RS9B 4A9FA 2I8NA 4ZQLA 4N4IA 4NYXA 4OUFA 1EQFA 4TS8A 4QUUA 3AADA 4XYAA 2WP1A 3UV2A 5CU8A 2D82A 3SVFA 5DYUA 5DYAA 3IU6A 4HXPA 3S91A 3U5KA 4QC3A 5LVRA 4HXNA 1JM4B 4CL9A 5J0DA 4YYNA 4HXSA 3UVDA 5A7CA 5CRZA
chains in the Genus database with same CATH superfamily
4HBVA 5A5NA 4UITA 5EV9A 5L98A 4YABA 5LUUA 3P5OA 4CLBA 5HRXA 3TLPA 4O77A 5DY7A 1PUOA 4MEPA 5E9IA 5L97A 5HRVA 2KTBB 5IGLA 4NUEA 4QR5A 4BHWA 2R0SA 4NUCA 5CQ6A 4TYLA 4NYVA 5FE5A 4LYWA 4O7BA 4QY4A 5A81A 2R0YA 4QR3A 5A5RA 4O74A 4LC2A 2RNYA 4MEOA 5EWDA 4A9KA 5BT3A 3RCWA 4J1PA 3UVWA 4AI6A 4LDFA 2RNWA 5FBXA 5E9YA 5CQ5A 5CUGA 2L5EA 2OUOA 1WUMA 5D0CA 4TT4A 1JSPB 4NXJA 5F5ZA 5JWMA 3AQAA 5HJCA 5EISA 5AD3A 5LJ2A 5F2PA 5KO4A 4NS5A 5ACYA 2F6JA 5A83A 4O76A 5C85A 4NR9A 3O35A 5II2A 1F68A 4O70A 4QSWA 5F36A 4QBMA 4BW1A 5D3LA 2F6NA 3VKHA 5E3DA 4BJXA 4HXLA 5EU1A 2YDWA 4QSXA 5FE2A 2YEMA 4A9MA 3D1BA 4TT2A 4CUUA 4QEUA 4N4HA 4YATA 5F61A 4TZ8A 4IORA 4AKIA 5CQTA 4UYDA 5F63A 5FH6A 2MJVB 5G4RA 4UIYA 4YYDA 4Y03A 3VKGA 5EWCA 4PKLA 3IU5A 5IBNA 4IOOA 3JVJA 3NXBA 4J0RA 5HELA 3LJWA 4UIZA 5CQ4A 4YYGA 4IR5A 5F60A 4XUBA 4YYKA 4J3IA 4YK0A 5ETBA 3LXJA 4NRCA 4PCIA 4YH3A 2I7KA 4A9NA 5E9VA 4YY6A 4J0SA 4TT6A 1X0JA 4LYIA 5CUAA 3O34A 4N4FA 5A5SA 3JVLA 3G0JA 2YYNA 4QSPA 5DKCA 5ENBA 5IG6A 4OGIA 5HRWA 5TCMA 2LSPB 5D3SA 5HQ6A 5CUEA 5KTUA 3U5LA 4KV1A 5HM0A 3HMEA 5D3PA 5LVQA 3MB3A 4DONA 4QSUA 4O75A 3ERRA 4CUPA 5ENCA 4YBMA 5DW2A 4BW3A 2GRCA 4MR6A 5C7NA 5I80A 4YYHA 5ENGA 1E6IA 5F25A 3UV4A 3ONIA 2R10A 5G4SA 4ALHA 2EJNA 4PS5A 2L84A 5TB6A 5K29A 4NUDA 5HEMA 4UYFB 4YYJA 5AMFA 5CUCA 4XUAA 3LQHA 3MQMA 4AKNA 5ENJA 3DAIA 5LKTA 5D7XA 5FE8A 3HMHA 5EI4A 3I3JA 4AKGA 3P1DA 5DBMA 4AKHA 5FE7A 5LJ1A 4O78A 5EPBA 5EWWA 2DWWA 1ZS5A 5HQ5A 4YADA 5E9MA 4YY4A 5BT5A 3Q2FA 5E74A 2NXBA 5FH8A 5LKXA 4QUTA 4LZRA 5EPSA 4N3WA 2L85A 3P1FA 3QZSA 4N4GA 4F3IA 5CY9A 2H60A 5D3RA 2E7NA 4O72A 4E96A 5EGUA 2OSSA 4IR3A 1WUGA 4QSTA 4X2IA 3U5PA 4QSQA 5CZGA 2RNXA 2DATA 4QSVA 5D3HA 5I86A 5IGKA 3O33A 4QSSA 2G4AA 5BT4A 5ETDA 4NRBA 2DVQA 4NQMA 5EA1A 4QEWA 5DFBA 4O71A 5DKHA 5C89A 5AD2A 4GPJA 5FB0A 4O7CA 5EK9A 4QB3A 4UIWA 3O37A 5DYXA 4PY6A 4C66A 4CFLA 4KV4A 5AMEA 5CP5A 4NR6A 4A9EA 5D3NA 5KU3A 2N9GA 5DLXA 5CFWA 3MB4A 3P1EA 4IR4A 4YBSA 4HXKA 5EPRA 4UIUA 4LR6A 5FG6A 5DKDA 3DWYA 1ZKRA 5C87A 5L99A 4RVRA 4CUSA 4Z6HA 5ENFA 1N72A 5E9KA 4Z1QA 2DKWA 5CQ8A 5ENIA 5F62A 4NR5A 5CRMA 3JVKA 5I29A 3K2JA 4MR4A 5D3TA 5FE9A 3MXFA 5FB1A 5H1TA 4UYHA 3O36A 4WIVA 5I83A 5LJ0A 3ZYUA 3JVMA 5EVAA 5HQ7A 4WHUA 5CQ7A 4TQNA 4NR4A 2YEKA 4MR5A 4YH4A 5H85A 4YYMA 5D26A 5CPEA 5D25A 4HXRA 4UYEA 4MENA 5ENHA 5FG5A 4HBWA 4Z1SA 5EQ1A 4UYGA 5I7XA 5D3JA 5LKUA 4A9OA 5L96A 4HBXA 4BW4A 5CUBA 5F3AA 5FG4A 5A85A 2YW5A 4HXMA 4ZC9A 2RFJA 5KHMA 5HLSA 3MULA 4QZSA 5DLZA 3HMFA 4CUTA 4NR7A 5A5PA 5DYCA 4Q0OA 4LZ2A 4TU4A 4A9IA 2RI7A 5EM3A 4Z6IA 5L8UA 4QSRA 3S92A 4A9LA 3U5NA 4ZW1A 2YQDA 5H1UA 2R0VA 4QNSA 4QYLA 4YC9A 5CQAA 4KCXA 4NYWA 5FFVA 4NR8A 2DVRA 4YAXA 4WHWA 4PTBA 5FE3A 4YYIA 3QZVA 5HFQA 5DFDA 5D24A 3LQJA 5E9LA 2OO1A 5EWVA 5F1LA 4NRAA 4OGJA 3UVYA 5KTXA 4XY9A 4NQNA 5I7YA 5IIDA 5C8GA 3P1CA 5I40A 2D9EA 5II1A 3UV5A 5KTWA 4QYDA 5DW1A 4TZ2A 5I89A 2WP2A 4UYFA 3U5OA 2RO1A 4XY8A 5CGPA 4LYSA 4QR4A 4CURA 5E3GA 5I88A 5JI8A 4C67A 2E7OA 4Q0NA 4HXOA 5DX4A 5A82A 3Q2EA 5CQ3A 5DFCA 5E0RA 4LZSA 4YBTA 5CUDA 5FE6A 3MUKA 3LQIA 3QZTA 4HBYA 5EWHA 5FFWA 4UIXA 4A9HA 2DVVA 3UW9A 2FSAA 4MR3A 5ENEA 4O7FA 5F1HA 4TTEA 5I1QA 4QC1A 5C4QA 5IGNA 2YELA 3FKMX 4IOQA 5EP7A 5H1VA 5LKZA 4O7EA 5A5QA 5L8TA 4CUQA 4CFKA 5E73A 5EICA 4QEVA 5FDZA 5FH7A 5E7DA 4ALGA 5IGMA 4MEQA 3D7CA 4O7AA 4UIVA 3U5MA 5A5OA 5FE0A 4IR6A 5CTLA 5CS8A 3SVHA 3GG3A 4PCEA 2E3KA 3UVXA 4FLPA 5HENA 4A9JA 4TU6A 3D1DA 3U5JA 4LRGA 5FE1A 2DVSA 5FE4A 3G0LA 5COIA 5HCLA 4BW2A 4Z93A 5FFYA 5HFRA 3SVGA 2RS9B 4A9FA 2I8NA 4ZQLA 4N4IA 4NYXA 4OUFA 1EQFA 4TS8A 4QUUA 3AADA 4XYAA 2WP1A 3UV2A 5CU8A 2D82A 3SVFA 5DYUA 5DYAA 3IU6A 4HXPA 3S91A 3U5KA 4QC3A 5LVRA 4HXNA 1JM4B 4CL9A 5J0DA 4YYNA 4HXSA 3UVDA 5A7CA 5CRZA
chains in the Genus database with same CATH topology
4HBVA 5A5NA 4UITA 5EV9A 5L98A 4YABA 5LUUA 3P5OA 4CLBA 5HRXA 3TLPA 4O77A 5DY7A 4MEPA 5E9IA 5L97A 5HRVA 2KTBB 5IGLA 4NUEA 4QR5A 4BHWA 2R0SA 4NUCA 5CQ6A 4TYLA 4NYVA 5FE5A 4LYWA 4O7BA 4QY4A 5A81A 2R0YA 4QR3A 5A5RA 4O74A 4LC2A 2RNYA 4MEOA 5EWDA 4A9KA 5BT3A 3RCWA 4J1PA 3UVWA 4LDFA 2RNWA 5FBXA 5E9YA 5CQ5A 5CUGA 2L5EA 2OUOA 1WUMA 5D0CA 4TT4A 1JSPB 4NXJA 5F5ZA 5JWMA 3AQAA 5HJCA 5EISA 5AD3A 5LJ2A 5F2PA 5KO4A 4NS5A 5ACYA 2F6JA 5A83A 4O76A 5C85A 4NR9A 3O35A 5II2A 1F68A 4O70A 4QSWA 5F36A 4QBMA 4BW1A 5D3LA 2F6NA 5E3DA 4BJXA 4HXLA 5EU1A 2YDWA 4QSXA 5FE2A 2YEMA 4A9MA 4TT2A 4CUUA 4QEUA 4N4HA 4YATA 5F61A 4TZ8A 4IORA 5CQTA 4UYDA 5F63A 5FH6A 2MJVB 5G4RA 4UIYA 4YYDA 4Y03A 5EWCA 4PKLA 3IU5A 5IBNA 4IOOA 3JVJA 3NXBA 4J0RA 5HELA 3LJWA 4UIZA 5CQ4A 4YYGA 4IR5A 5F60A 4XUBA 4YYKA 4J3IA 4YK0A 5ETBA 3LXJA 4NRCA 4PCIA 4YH3A 2I7KA 4A9NA 5E9VA 4YY6A 4J0SA 4TT6A 1X0JA 4LYIA 5CUAA 3O34A 4N4FA 5A5SA 3JVLA 3G0JA 2YYNA 4QSPA 5DKCA 5ENBA 5IG6A 4OGIA 5HRWA 5TCMA 2LSPB 5D3SA 5HQ6A 5CUEA 5KTUA 3U5LA 4KV1A 5HM0A 3HMEA 5D3PA 5LVQA 3MB3A 4DONA 4QSUA 4O75A 4CUPA 5ENCA 4YBMA 5DW2A 4BW3A 2GRCA 4MR6A 5C7NA 5I80A 4YYHA 5ENGA 1E6IA 5F25A 3UV4A 3ONIA 2R10A 5G4SA 4ALHA 4PS5A 2L84A 5TB6A 5K29A 4NUDA 5HEMA 4UYFB 4YYJA 5AMFA 5CUCA 4XUAA 3LQHA 3MQMA 4AKNA 5ENJA 3DAIA 5LKTA 5D7XA 5FE8A 3HMHA 5EI4A 3I3JA 3P1DA 5DBMA 5FE7A 5LJ1A 4O78A 5EPBA 5EWWA 2DWWA 1ZS5A 5HQ5A 4YADA 5E9MA 4YY4A 5BT5A 3Q2FA 5E74A 2NXBA 5FH8A 5LKXA 4QUTA 4LZRA 5EPSA 4N3WA 2L85A 3P1FA 3QZSA 4N4GA 4F3IA 5CY9A 2H60A 5D3RA 2E7NA 4O72A 4E96A 5EGUA 2OSSA 4IR3A 1WUGA 4QSTA 4X2IA 3U5PA 4QSQA 5CZGA 2RNXA 2DATA 4QSVA 5D3HA 5I86A 5IGKA 3O33A 4QSSA 2G4AA 5BT4A 5ETDA 4NRBA 2DVQA 4NQMA 5EA1A 4QEWA 5DFBA 4O71A 5DKHA 5C89A 5AD2A 4GPJA 5FB0A 4O7CA 5EK9A 4QB3A 4UIWA 3O37A 5DYXA 4PY6A 4C66A 4CFLA 4KV4A 5AMEA 5CP5A 4NR6A 4A9EA 5D3NA 5KU3A 2N9GA 5DLXA 5CFWA 3MB4A 3P1EA 4IR4A 4YBSA 4HXKA 5EPRA 4UIUA 4LR6A 5FG6A 5DKDA 3DWYA 5C87A 5L99A 4RVRA 4CUSA 4Z6HA 5ENFA 1N72A 5E9KA 4Z1QA 2DKWA 5CQ8A 5ENIA 5F62A 4NR5A 5CRMA 3JVKA 5I29A 3K2JA 4MR4A 5D3TA 5FE9A 3MXFA 5FB1A 5H1TA 4UYHA 3O36A 4WIVA 5I83A 5LJ0A 3ZYUA 3JVMA 5EVAA 5HQ7A 4WHUA 5CQ7A 4TQNA 4NR4A 2YEKA 4MR5A 4YH4A 5H85A 4YYMA 5D26A 5CPEA 5D25A 4HXRA 4UYEA 4MENA 5ENHA 5FG5A 4HBWA 4Z1SA 5EQ1A 4UYGA 5I7XA 5D3JA 5LKUA 4A9OA 5L96A 4HBXA 4BW4A 5CUBA 5F3AA 5FG4A 5A85A 2YW5A 4HXMA 4ZC9A 2RFJA 5KHMA 5HLSA 3MULA 4QZSA 5DLZA 3HMFA 4CUTA 4NR7A 5A5PA 5DYCA 4Q0OA 4LZ2A 4TU4A 4A9IA 2RI7A 5EM3A 4Z6IA 5L8UA 4QSRA 3S92A 4A9LA 3U5NA 4ZW1A 2YQDA 5H1UA 2R0VA 4QNSA 4QYLA 4YC9A 5CQAA 4KCXA 4NYWA 5FFVA 4NR8A 2DVRA 4YAXA 4WHWA 4PTBA 5FE3A 4YYIA 3QZVA 5HFQA 5DFDA 5D24A 3LQJA 5E9LA 2OO1A 5EWVA 5F1LA 4NRAA 4OGJA 3UVYA 5KTXA 4XY9A 4NQNA 5I7YA 5IIDA 5C8GA 3P1CA 5I40A 2D9EA 5II1A 3UV5A 5KTWA 4QYDA 5DW1A 4TZ2A 5I89A 2WP2A 4UYFA 3U5OA 2RO1A 4XY8A 5CGPA 4LYSA 4QR4A 4CURA 5E3GA 5I88A 5JI8A 4C67A 2E7OA 4Q0NA 4HXOA 5DX4A 5A82A 3Q2EA 5CQ3A 5DFCA 5E0RA 4LZSA 4YBTA 5CUDA 5FE6A 3MUKA 3LQIA 3QZTA 4HBYA 5EWHA 5FFWA 4UIXA 4A9HA 2DVVA 3UW9A 2FSAA 4MR3A 5ENEA 4O7FA 5F1HA 4TTEA 5I1QA 4QC1A 5C4QA 5IGNA 2YELA 3FKMX 4IOQA 5EP7A 5H1VA 5LKZA 4O7EA 5A5QA 5L8TA 4CUQA 4CFKA 5E73A 5EICA 4QEVA 5FDZA 5FH7A 5E7DA 4ALGA 5IGMA 4MEQA 3D7CA 4O7AA 4UIVA 3U5MA 5A5OA 5FE0A 4IR6A 5CTLA 5CS8A 3SVHA 3GG3A 4PCEA 2E3KA 3UVXA 4FLPA 5HENA 4A9JA 4TU6A 3U5JA 4LRGA 5FE1A 2DVSA 5FE4A 3G0LA 5COIA 5HCLA 4BW2A 4Z93A 5FFYA 5HFRA 3SVGA 2RS9B 4A9FA 2I8NA 4ZQLA 4N4IA 4NYXA 4OUFA 1EQFA 4TS8A 4QUUA 3AADA 4XYAA 2WP1A 3UV2A 5CU8A 2D82A 3SVFA 5DYUA 5DYAA 3IU6A 4HXPA 3S91A 3U5KA 4QC3A 5LVRA 4HXNA 1JM4B 4CL9A 5J0DA 4YYNA 4HXSA 3UVDA 5A7CA 5CRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBV A;  5A5N A;  4UIT A;  5EV9 A;  5L98 A;  4YAB A;  5LUU A;  3P5O A;  4CLB A;  5HRX A;  3TLP A;  4O77 A;  5DY7 A;  4MEP A;  5E9I A;  5L97 A;  5HRV A;  2KTB B;  5IGL A;  4NUE A;  4QR5 A;  4BHW A;  2R0S A;  4NUC A;  5CQ6 A;  4TYL A;  4NYV A;  5FE5 A;  4LYW A;  4O7B A;  4QY4 A;  5A81 A;  2R0Y A;  4QR3 A;  5A5R A;  4O74 A;  4LC2 A;  2RNY A;  4MEO A;  5EWD A;  4A9K A;  5BT3 A;  3RCW A;  4J1P A;  3UVW A;  4LDF A;  2RNW A;  5FBX A;  5E9Y A;  5CQ5 A;  5CUG A;  2L5E A;  2OUO A;  1WUM A;  5D0C A;  4TT4 A;  1JSP B;  4NXJ A;  5F5Z A;  5JWM A;  3AQA A;  5HJC A;  5EIS A;  5AD3 A;  5LJ2 A;  5F2P A;  5KO4 A;  4NS5 A;  5ACY A;  2F6J A;  5A83 A;  4O76 A;  5C85 A;  4NR9 A;  3O35 A;  5II2 A;  1F68 A;  4O70 A;  4QSW A;  5F36 A;  4QBM A;  4BW1 A;  5D3L A;  2F6N A;  5E3D A;  4BJX A;  4HXL A;  5EU1 A;  2YDW A;  4QSX A;  5FE2 A;  2YEM A;  4A9M A;  4TT2 A;  4CUU A;  4QEU A;  4N4H A;  4YAT A;  5F61 A;  4TZ8 A;  4IOR A;  5CQT A;  4UYD A;  5F63 A;  5FH6 A;  2MJV B;  5G4R A;  4UIY A;  4YYD A;  4Y03 A;  5EWC A;  4PKL A;  3IU5 A;  5IBN A;  4IOO A;  3JVJ A;  3NXB A;  4J0R A;  5HEL A;  3LJW A;  4UIZ A;  5CQ4 A;  4YYG A;  4IR5 A;  5F60 A;  4XUB A;  4YYK A;  4J3I A;  4YK0 A;  5ETB A;  3LXJ A;  4NRC A;  4PCI A;  4YH3 A;  2I7K A;  4A9N A;  5E9V A;  4YY6 A;  4J0S A;  4TT6 A;  1X0J A;  4LYI A;  5CUA A;  3O34 A;  4N4F A;  5A5S A;  3JVL A;  3G0J A;  2YYN A;  4QSP A;  5DKC A;  5ENB A;  5IG6 A;  4OGI A;  5HRW A;  5TCM A;  2LSP B;  5D3S A;  5HQ6 A;  5CUE A;  5KTU A;  3U5L A;  4KV1 A;  5HM0 A;  3HME A;  5D3P A;  5LVQ A;  3MB3 A;  4DON A;  4QSU A;  4O75 A;  4CUP A;  5ENC A;  4YBM A;  5DW2 A;  4BW3 A;  2GRC A;  4MR6 A;  5C7N A;  5I80 A;  4YYH A;  5ENG A;  1E6I A;  5F25 A;  3UV4 A;  3ONI A;  2R10 A;  5G4S A;  4ALH A;  4PS5 A;  2L84 A;  5TB6 A;  5K29 A;  4NUD A;  5HEM A;  4UYF B;  4YYJ A;  5AMF A;  5CUC A;  4XUA A;  3LQH A;  3MQM A;  4AKN A;  5ENJ A;  3DAI A;  5LKT A;  5D7X A;  5FE8 A;  3HMH A;  5EI4 A;  3I3J A;  3P1D A;  5DBM A;  5FE7 A;  5LJ1 A;  4O78 A;  5EPB A;  5EWW A;  2DWW A;  1ZS5 A;  5HQ5 A;  4YAD A;  5E9M A;  4YY4 A;  5BT5 A;  3Q2F A;  5E74 A;  2NXB A;  5FH8 A;  5LKX A;  4QUT A;  4LZR A;  5EPS A;  4N3W A;  2L85 A;  3P1F A;  3QZS A;  4N4G A;  4F3I A;  5CY9 A;  2H60 A;  5D3R A;  2E7N A;  4O72 A;  4E96 A;  5EGU A;  2OSS A;  4IR3 A;  1WUG A;  4QST A;  4X2I A;  3U5P A;  4QSQ A;  5CZG A;  2RNX A;  2DAT A;  4QSV A;  5D3H A;  5I86 A;  5IGK A;  3O33 A;  4QSS A;  2G4A A;  5BT4 A;  5ETD A;  4NRB A;  2DVQ A;  4NQM A;  5EA1 A;  4QEW A;  5DFB A;  4O71 A;  5DKH A;  5C89 A;  5AD2 A;  4GPJ A;  5FB0 A;  4O7C A;  5EK9 A;  4QB3 A;  4UIW A;  3O37 A;  5DYX A;  4PY6 A;  4C66 A;  4CFL A;  4KV4 A;  5AME A;  5CP5 A;  4NR6 A;  4A9E A;  5D3N A;  5KU3 A;  2N9G A;  5DLX A;  5CFW A;  3MB4 A;  3P1E A;  4IR4 A;  4YBS A;  4HXK A;  5EPR A;  4UIU A;  4LR6 A;  5FG6 A;  5DKD A;  3DWY A;  5C87 A;  5L99 A;  4RVR A;  4CUS A;  4Z6H A;  5ENF A;  1N72 A;  5E9K A;  4Z1Q A;  2DKW A;  5CQ8 A;  5ENI A;  5F62 A;  4NR5 A;  5CRM A;  3JVK A;  5I29 A;  3K2J A;  4MR4 A;  5D3T A;  5FE9 A;  3MXF A;  5FB1 A;  5H1T A;  4UYH A;  3O36 A;  4WIV A;  5I83 A;  5LJ0 A;  3ZYU A;  3JVM A;  5EVA A;  5HQ7 A;  4WHU A;  5CQ7 A;  4TQN A;  4NR4 A;  2YEK A;  4MR5 A;  4YH4 A;  5H85 A;  4YYM A;  5D26 A;  5CPE A;  5D25 A;  4HXR A;  4UYE A;  4MEN A;  5ENH A;  5FG5 A;  4HBW A;  4Z1S A;  5EQ1 A;  4UYG A;  5I7X A;  5D3J A;  5LKU A;  4A9O A;  5L96 A;  4HBX A;  4BW4 A;  5CUB A;  5F3A A;  5FG4 A;  5A85 A;  2YW5 A;  4HXM A;  4ZC9 A;  2RFJ A;  5KHM A;  5HLS A;  3MUL A;  4QZS A;  5DLZ A;  3HMF A;  4CUT A;  4NR7 A;  5A5P A;  5DYC A;  4Q0O A;  4LZ2 A;  4TU4 A;  4A9I A;  2RI7 A;  5EM3 A;  4Z6I A;  5L8U A;  4QSR A;  3S92 A;  4A9L A;  3U5N A;  4ZW1 A;  2YQD A;  5H1U A;  2R0V A;  4QNS A;  4QYL A;  4YC9 A;  5CQA A;  4KCX A;  4NYW A;  5FFV A;  4NR8 A;  2DVR A;  4YAX A;  4WHW A;  4PTB A;  5FE3 A;  4YYI A;  3QZV A;  5HFQ A;  5DFD A;  5D24 A;  3LQJ A;  5E9L A;  2OO1 A;  5EWV A;  5F1L A;  4NRA A;  4OGJ A;  3UVY A;  5KTX A;  4XY9 A;  4NQN A;  5I7Y A;  5IID A;  5C8G A;  3P1C A;  5I40 A;  2D9E A;  5II1 A;  3UV5 A;  5KTW A;  4QYD A;  5DW1 A;  4TZ2 A;  5I89 A;  2WP2 A;  4UYF A;  3U5O A;  2RO1 A;  4XY8 A;  5CGP A;  4LYS A;  4QR4 A;  4CUR A;  5E3G A;  5I88 A;  5JI8 A;  4C67 A;  2E7O A;  4Q0N A;  4HXO A;  5DX4 A;  5A82 A;  3Q2E A;  5CQ3 A;  5DFC A;  5E0R A;  4LZS A;  4YBT A;  5CUD A;  5FE6 A;  3MUK A;  3LQI A;  3QZT A;  4HBY A;  5EWH A;  5FFW A;  4UIX A;  4A9H A;  2DVV A;  3UW9 A;  2FSA A;  4MR3 A;  5ENE A;  4O7F A;  5F1H A;  4TTE A;  5I1Q A;  4QC1 A;  5C4Q A;  5IGN A;  2YEL A;  3FKM X;  4IOQ A;  5EP7 A;  5H1V A;  5LKZ A;  4O7E A;  5A5Q A;  5L8T A;  4CUQ A;  4CFK A;  5E73 A;  5EIC A;  4QEV A;  5FDZ A;  5FH7 A;  5E7D A;  4ALG A;  5IGM A;  4MEQ A;  3D7C A;  4O7A A;  4UIV A;  3U5M A;  5A5O A;  5FE0 A;  4IR6 A;  5CTL A;  5CS8 A;  3SVH A;  3GG3 A;  4PCE A;  2E3K A;  3UVX A;  4FLP A;  5HEN A;  4A9J A;  4TU6 A;  3U5J A;  4LRG A;  5FE1 A;  2DVS A;  5FE4 A;  3G0L A;  5COI A;  5HCL A;  4BW2 A;  4Z93 A;  5FFY A;  5HFR A;  3SVG A;  2RS9 B;  4A9F A;  2I8N A;  4ZQL A;  4N4I A;  4NYX A;  4OUF A;  1EQF A;  4TS8 A;  4QUU A;  3AAD A;  4XYA A;  2WP1 A;  3UV2 A;  5CU8 A;  2D82 A;  3SVF A;  5DYU A;  5DYA A;  3IU6 A;  4HXP A;  3S91 A;  3U5K A;  4QC3 A;  5LVR A;  4HXN A;  1JM4 B;  4CL9 A;  5J0D A;  4YYN A;  4HXS A;  3UVD A;  5A7C A;  5CRZ A; 
#chains in the Genus database with same CATH topology
 4HBV A;  5A5N A;  4UIT A;  5EV9 A;  5L98 A;  4YAB A;  5LUU A;  3P5O A;  4CLB A;  5HRX A;  3TLP A;  4O77 A;  5DY7 A;  1PUO A;  4MEP A;  5E9I A;  5L97 A;  5HRV A;  2KTB B;  5IGL A;  4NUE A;  4QR5 A;  4BHW A;  2R0S A;  4NUC A;  5CQ6 A;  4TYL A;  4NYV A;  5FE5 A;  4LYW A;  4O7B A;  4QY4 A;  5A81 A;  2R0Y A;  4QR3 A;  5A5R A;  4O74 A;  4LC2 A;  2RNY A;  4MEO A;  5EWD A;  4A9K A;  5BT3 A;  3RCW A;  4J1P A;  3UVW A;  4AI6 A;  4LDF A;  2RNW A;  5FBX A;  5E9Y A;  5CQ5 A;  5CUG A;  2L5E A;  2OUO A;  1WUM A;  5D0C A;  4TT4 A;  1JSP B;  4NXJ A;  5F5Z A;  5JWM A;  3AQA A;  5HJC A;  5EIS A;  5AD3 A;  5LJ2 A;  5F2P A;  5KO4 A;  4NS5 A;  5ACY A;  2F6J A;  5A83 A;  4O76 A;  5C85 A;  4NR9 A;  3O35 A;  5II2 A;  1F68 A;  4O70 A;  4QSW A;  5F36 A;  4QBM A;  4BW1 A;  5D3L A;  2F6N A;  3VKH A;  5E3D A;  4BJX A;  4HXL A;  5EU1 A;  2YDW A;  4QSX A;  5FE2 A;  2YEM A;  4A9M A;  3D1B A;  4TT2 A;  4CUU A;  4QEU A;  4N4H A;  4YAT A;  5F61 A;  4TZ8 A;  4IOR A;  4AKI A;  5CQT A;  4UYD A;  5F63 A;  5FH6 A;  2MJV B;  5G4R A;  4UIY A;  4YYD A;  4Y03 A;  3VKG A;  5EWC A;  4PKL A;  3IU5 A;  5IBN A;  4IOO A;  3JVJ A;  3NXB A;  4J0R A;  5HEL A;  3LJW A;  4UIZ A;  5CQ4 A;  4YYG A;  4IR5 A;  5F60 A;  4XUB A;  4YYK A;  4J3I A;  4YK0 A;  5ETB A;  3LXJ A;  4NRC A;  4PCI A;  4YH3 A;  2I7K A;  4A9N A;  5E9V A;  4YY6 A;  4J0S A;  4TT6 A;  1X0J A;  4LYI A;  5CUA A;  3O34 A;  4N4F A;  5A5S A;  3JVL A;  3G0J A;  2YYN A;  4QSP A;  5DKC A;  5ENB A;  5IG6 A;  4OGI A;  5HRW A;  5TCM A;  2LSP B;  5D3S A;  5HQ6 A;  5CUE A;  5KTU A;  3U5L A;  4KV1 A;  5HM0 A;  3HME A;  5D3P A;  5LVQ A;  3MB3 A;  4DON A;  4QSU A;  4O75 A;  3ERR A;  4CUP A;  5ENC A;  4YBM A;  5DW2 A;  4BW3 A;  2GRC A;  4MR6 A;  5C7N A;  5I80 A;  4YYH A;  5ENG A;  1E6I A;  5F25 A;  3UV4 A;  3ONI A;  2R10 A;  5G4S A;  4ALH A;  2EJN A;  4PS5 A;  2L84 A;  5TB6 A;  5K29 A;  4NUD A;  5HEM A;  4UYF B;  4YYJ A;  5AMF A;  5CUC A;  4XUA A;  3LQH A;  3MQM A;  4AKN A;  5ENJ A;  3DAI A;  5LKT A;  5D7X A;  5FE8 A;  3HMH A;  5EI4 A;  3I3J A;  4AKG A;  3P1D A;  5DBM A;  4AKH A;  5FE7 A;  5LJ1 A;  4O78 A;  5EPB A;  5EWW A;  2DWW A;  1ZS5 A;  5HQ5 A;  4YAD A;  5E9M A;  4YY4 A;  5BT5 A;  3Q2F A;  5E74 A;  2NXB A;  5FH8 A;  5LKX A;  4QUT A;  4LZR A;  5EPS A;  4N3W A;  2L85 A;  3P1F A;  3QZS A;  4N4G A;  4F3I A;  5CY9 A;  2H60 A;  5D3R A;  2E7N A;  4O72 A;  4E96 A;  5EGU A;  2OSS A;  4IR3 A;  1WUG A;  4QST A;  4X2I A;  3U5P A;  4QSQ A;  5CZG A;  2RNX A;  2DAT A;  4QSV A;  5D3H A;  5I86 A;  5IGK A;  3O33 A;  4QSS A;  2G4A A;  5BT4 A;  5ETD A;  4NRB A;  2DVQ A;  4NQM A;  5EA1 A;  4QEW A;  5DFB A;  4O71 A;  5DKH A;  5C89 A;  5AD2 A;  4GPJ A;  5FB0 A;  4O7C A;  5EK9 A;  4QB3 A;  4UIW A;  3O37 A;  5DYX A;  4PY6 A;  4C66 A;  4CFL A;  4KV4 A;  5AME A;  5CP5 A;  4NR6 A;  4A9E A;  5D3N A;  5KU3 A;  2N9G A;  5DLX A;  5CFW A;  3MB4 A;  3P1E A;  4IR4 A;  4YBS A;  4HXK A;  5EPR A;  4UIU A;  4LR6 A;  5FG6 A;  5DKD A;  3DWY A;  1ZKR A;  5C87 A;  5L99 A;  4RVR A;  4CUS A;  4Z6H A;  5ENF A;  1N72 A;  5E9K A;  4Z1Q A;  2DKW A;  5CQ8 A;  5ENI A;  5F62 A;  4NR5 A;  5CRM A;  3JVK A;  5I29 A;  3K2J A;  4MR4 A;  5D3T A;  5FE9 A;  3MXF A;  5FB1 A;  5H1T A;  4UYH A;  3O36 A;  4WIV A;  5I83 A;  5LJ0 A;  3ZYU A;  3JVM A;  5EVA A;  5HQ7 A;  4WHU A;  5CQ7 A;  4TQN A;  4NR4 A;  2YEK A;  4MR5 A;  4YH4 A;  5H85 A;  4YYM A;  5D26 A;  5CPE A;  5D25 A;  4HXR A;  4UYE A;  4MEN A;  5ENH A;  5FG5 A;  4HBW A;  4Z1S A;  5EQ1 A;  4UYG A;  5I7X A;  5D3J A;  5LKU A;  4A9O A;  5L96 A;  4HBX A;  4BW4 A;  5CUB A;  5F3A A;  5FG4 A;  5A85 A;  2YW5 A;  4HXM A;  4ZC9 A;  2RFJ A;  5KHM A;  5HLS A;  3MUL A;  4QZS A;  5DLZ A;  3HMF A;  4CUT A;  4NR7 A;  5A5P A;  5DYC A;  4Q0O A;  4LZ2 A;  4TU4 A;  4A9I A;  2RI7 A;  5EM3 A;  4Z6I A;  5L8U A;  4QSR A;  3S92 A;  4A9L A;  3U5N A;  4ZW1 A;  2YQD A;  5H1U A;  2R0V A;  4QNS A;  4QYL A;  4YC9 A;  5CQA A;  4KCX A;  4NYW A;  5FFV A;  4NR8 A;  2DVR A;  4YAX A;  4WHW A;  4PTB A;  5FE3 A;  4YYI A;  3QZV A;  5HFQ A;  5DFD A;  5D24 A;  3LQJ A;  5E9L A;  2OO1 A;  5EWV A;  5F1L A;  4NRA A;  4OGJ A;  3UVY A;  5KTX A;  4XY9 A;  4NQN A;  5I7Y A;  5IID A;  5C8G A;  3P1C A;  5I40 A;  2D9E A;  5II1 A;  3UV5 A;  5KTW A;  4QYD A;  5DW1 A;  4TZ2 A;  5I89 A;  2WP2 A;  4UYF A;  3U5O A;  2RO1 A;  4XY8 A;  5CGP A;  4LYS A;  4QR4 A;  4CUR A;  5E3G A;  5I88 A;  5JI8 A;  4C67 A;  2E7O A;  4Q0N A;  4HXO A;  5DX4 A;  5A82 A;  3Q2E A;  5CQ3 A;  5DFC A;  5E0R A;  4LZS A;  4YBT A;  5CUD A;  5FE6 A;  3MUK A;  3LQI A;  3QZT A;  4HBY A;  5EWH A;  5FFW A;  4UIX A;  4A9H A;  2DVV A;  3UW9 A;  2FSA A;  4MR3 A;  5ENE A;  4O7F A;  5F1H A;  4TTE A;  5I1Q A;  4QC1 A;  5C4Q A;  5IGN A;  2YEL A;  3FKM X;  4IOQ A;  5EP7 A;  5H1V A;  5LKZ A;  4O7E A;  5A5Q A;  5L8T A;  4CUQ A;  4CFK A;  5E73 A;  5EIC A;  4QEV A;  5FDZ A;  5FH7 A;  5E7D A;  4ALG A;  5IGM A;  4MEQ A;  3D7C A;  4O7A A;  4UIV A;  3U5M A;  5A5O A;  5FE0 A;  4IR6 A;  5CTL A;  5CS8 A;  3SVH A;  3GG3 A;  4PCE A;  2E3K A;  3UVX A;  4FLP A;  5HEN A;  4A9J A;  4TU6 A;  3D1D A;  3U5J A;  4LRG A;  5FE1 A;  2DVS A;  5FE4 A;  3G0L A;  5COI A;  5HCL A;  4BW2 A;  4Z93 A;  5FFY A;  5HFR A;  3SVG A;  2RS9 B;  4A9F A;  2I8N A;  4ZQL A;  4N4I A;  4NYX A;  4OUF A;  1EQF A;  4TS8 A;  4QUU A;  3AAD A;  4XYA A;  2WP1 A;  3UV2 A;  5CU8 A;  2D82 A;  3SVF A;  5DYU A;  5DYA A;  3IU6 A;  4HXP A;  3S91 A;  3U5K A;  4QC3 A;  5LVR A;  4HXN A;  1JM4 B;  4CL9 A;  5J0D A;  4YYN A;  4HXS A;  3UVD A;  5A7C A;  5CRZ A; 
#chains in the Genus database with same CATH homology
 4HBV A;  5A5N A;  4UIT A;  5EV9 A;  5L98 A;  4YAB A;  5LUU A;  3P5O A;  4CLB A;  5HRX A;  3TLP A;  4O77 A;  5DY7 A;  4MEP A;  5E9I A;  5L97 A;  5HRV A;  2KTB B;  5IGL A;  4NUE A;  4QR5 A;  4BHW A;  2R0S A;  4NUC A;  5CQ6 A;  4TYL A;  4NYV A;  5FE5 A;  4LYW A;  4O7B A;  4QY4 A;  5A81 A;  2R0Y A;  4QR3 A;  5A5R A;  4O74 A;  4LC2 A;  2RNY A;  4MEO A;  5EWD A;  4A9K A;  5BT3 A;  3RCW A;  4J1P A;  3UVW A;  4LDF A;  2RNW A;  5FBX A;  5E9Y A;  5CQ5 A;  5CUG A;  2L5E A;  2OUO A;  1WUM A;  5D0C A;  4TT4 A;  1JSP B;  4NXJ A;  5F5Z A;  5JWM A;  3AQA A;  5HJC A;  5EIS A;  5AD3 A;  5LJ2 A;  5F2P A;  5KO4 A;  4NS5 A;  5ACY A;  2F6J A;  5A83 A;  4O76 A;  5C85 A;  4NR9 A;  3O35 A;  5II2 A;  1F68 A;  4O70 A;  4QSW A;  5F36 A;  4QBM A;  4BW1 A;  5D3L A;  2F6N A;  5E3D A;  4BJX A;  4HXL A;  5EU1 A;  2YDW A;  4QSX A;  5FE2 A;  2YEM A;  4A9M A;  4TT2 A;  4CUU A;  4QEU A;  4N4H A;  4YAT A;  5F61 A;  4TZ8 A;  4IOR A;  5CQT A;  4UYD A;  5F63 A;  5FH6 A;  2MJV B;  5G4R A;  4UIY A;  4YYD A;  4Y03 A;  5EWC A;  4PKL A;  3IU5 A;  5IBN A;  4IOO A;  3JVJ A;  3NXB A;  4J0R A;  5HEL A;  3LJW A;  4UIZ A;  5CQ4 A;  4YYG A;  4IR5 A;  5F60 A;  4XUB A;  4YYK A;  4J3I A;  4YK0 A;  5ETB A;  3LXJ A;  4NRC A;  4PCI A;  4YH3 A;  2I7K A;  4A9N A;  5E9V A;  4YY6 A;  4J0S A;  4TT6 A;  1X0J A;  4LYI A;  5CUA A;  3O34 A;  4N4F A;  5A5S A;  3JVL A;  3G0J A;  2YYN A;  4QSP A;  5DKC A;  5ENB A;  5IG6 A;  4OGI A;  5HRW A;  5TCM A;  2LSP B;  5D3S A;  5HQ6 A;  5CUE A;  5KTU A;  3U5L A;  4KV1 A;  5HM0 A;  3HME A;  5D3P A;  5LVQ A;  3MB3 A;  4DON A;  4QSU A;  4O75 A;  4CUP A;  5ENC A;  4YBM A;  5DW2 A;  4BW3 A;  2GRC A;  4MR6 A;  5C7N A;  5I80 A;  4YYH A;  5ENG A;  1E6I A;  5F25 A;  3UV4 A;  3ONI A;  2R10 A;  5G4S A;  4ALH A;  4PS5 A;  2L84 A;  5TB6 A;  5K29 A;  4NUD A;  5HEM A;  4UYF B;  4YYJ A;  5AMF A;  5CUC A;  4XUA A;  3LQH A;  3MQM A;  4AKN A;  5ENJ A;  3DAI A;  5LKT A;  5D7X A;  5FE8 A;  3HMH A;  5EI4 A;  3I3J A;  3P1D A;  5DBM A;  5FE7 A;  5LJ1 A;  4O78 A;  5EPB A;  5EWW A;  2DWW A;  1ZS5 A;  5HQ5 A;  4YAD A;  5E9M A;  4YY4 A;  5BT5 A;  3Q2F A;  5E74 A;  2NXB A;  5FH8 A;  5LKX A;  4QUT A;  4LZR A;  5EPS A;  4N3W A;  2L85 A;  3P1F A;  3QZS A;  4N4G A;  4F3I A;  5CY9 A;  2H60 A;  5D3R A;  2E7N A;  4O72 A;  4E96 A;  5EGU A;  2OSS A;  4IR3 A;  1WUG A;  4QST A;  4X2I A;  3U5P A;  4QSQ A;  5CZG A;  2RNX A;  2DAT A;  4QSV A;  5D3H A;  5I86 A;  5IGK A;  3O33 A;  4QSS A;  2G4A A;  5BT4 A;  5ETD A;  4NRB A;  2DVQ A;  4NQM A;  5EA1 A;  4QEW A;  5DFB A;  4O71 A;  5DKH A;  5C89 A;  5AD2 A;  4GPJ A;  5FB0 A;  4O7C A;  5EK9 A;  4QB3 A;  4UIW A;  3O37 A;  5DYX A;  4PY6 A;  4C66 A;  4CFL A;  4KV4 A;  5AME A;  5CP5 A;  4NR6 A;  4A9E A;  5D3N A;  5KU3 A;  2N9G A;  5DLX A;  5CFW A;  3MB4 A;  3P1E A;  4IR4 A;  4YBS A;  4HXK A;  5EPR A;  4UIU A;  4LR6 A;  5FG6 A;  5DKD A;  3DWY A;  5C87 A;  5L99 A;  4RVR A;  4CUS A;  4Z6H A;  5ENF A;  1N72 A;  5E9K A;  4Z1Q A;  2DKW A;  5CQ8 A;  5ENI A;  5F62 A;  4NR5 A;  5CRM A;  3JVK A;  5I29 A;  3K2J A;  4MR4 A;  5D3T A;  5FE9 A;  3MXF A;  5FB1 A;  5H1T A;  4UYH A;  3O36 A;  4WIV A;  5I83 A;  5LJ0 A;  3ZYU A;  3JVM A;  5EVA A;  5HQ7 A;  4WHU A;  5CQ7 A;  4TQN A;  4NR4 A;  2YEK A;  4MR5 A;  4YH4 A;  5H85 A;  4YYM A;  5D26 A;  5CPE A;  5D25 A;  4HXR A;  4UYE A;  4MEN A;  5ENH A;  5FG5 A;  4HBW A;  4Z1S A;  5EQ1 A;  4UYG A;  5I7X A;  5D3J A;  5LKU A;  4A9O A;  5L96 A;  4HBX A;  4BW4 A;  5CUB A;  5F3A A;  5FG4 A;  5A85 A;  2YW5 A;  4HXM A;  4ZC9 A;  2RFJ A;  5KHM A;  5HLS A;  3MUL A;  4QZS A;  5DLZ A;  3HMF A;  4CUT A;  4NR7 A;  5A5P A;  5DYC A;  4Q0O A;  4LZ2 A;  4TU4 A;  4A9I A;  2RI7 A;  5EM3 A;  4Z6I A;  5L8U A;  4QSR A;  3S92 A;  4A9L A;  3U5N A;  4ZW1 A;  2YQD A;  5H1U A;  2R0V A;  4QNS A;  4QYL A;  4YC9 A;  5CQA A;  4KCX A;  4NYW A;  5FFV A;  4NR8 A;  2DVR A;  4YAX A;  4WHW A;  4PTB A;  5FE3 A;  4YYI A;  3QZV A;  5HFQ A;  5DFD A;  5D24 A;  3LQJ A;  5E9L A;  2OO1 A;  5EWV A;  5F1L A;  4NRA A;  4OGJ A;  3UVY A;  5KTX A;  4XY9 A;  4NQN A;  5I7Y A;  5IID A;  5C8G A;  3P1C A;  5I40 A;  2D9E A;  5II1 A;  3UV5 A;  5KTW A;  4QYD A;  5DW1 A;  4TZ2 A;  5I89 A;  2WP2 A;  4UYF A;  3U5O A;  2RO1 A;  4XY8 A;  5CGP A;  4LYS A;  4QR4 A;  4CUR A;  5E3G A;  5I88 A;  5JI8 A;  4C67 A;  2E7O A;  4Q0N A;  4HXO A;  5DX4 A;  5A82 A;  3Q2E A;  5CQ3 A;  5DFC A;  5E0R A;  4LZS A;  4YBT A;  5CUD A;  5FE6 A;  3MUK A;  3LQI A;  3QZT A;  4HBY A;  5EWH A;  5FFW A;  4UIX A;  4A9H A;  2DVV A;  3UW9 A;  2FSA A;  4MR3 A;  5ENE A;  4O7F A;  5F1H A;  4TTE A;  5I1Q A;  4QC1 A;  5C4Q A;  5IGN A;  2YEL A;  3FKM X;  4IOQ A;  5EP7 A;  5H1V A;  5LKZ A;  4O7E A;  5A5Q A;  5L8T A;  4CUQ A;  4CFK A;  5E73 A;  5EIC A;  4QEV A;  5FDZ A;  5FH7 A;  5E7D A;  4ALG A;  5IGM A;  4MEQ A;  3D7C A;  4O7A A;  4UIV A;  3U5M A;  5A5O A;  5FE0 A;  4IR6 A;  5CTL A;  5CS8 A;  3SVH A;  3GG3 A;  4PCE A;  2E3K A;  3UVX A;  4FLP A;  5HEN A;  4A9J A;  4TU6 A;  3U5J A;  4LRG A;  5FE1 A;  2DVS A;  5FE4 A;  3G0L A;  5COI A;  5HCL A;  4BW2 A;  4Z93 A;  5FFY A;  5HFR A;  3SVG A;  2RS9 B;  4A9F A;  2I8N A;  4ZQL A;  4N4I A;  4NYX A;  4OUF A;  1EQF A;  4TS8 A;  4QUU A;  3AAD A;  4XYA A;  2WP1 A;  3UV2 A;  5CU8 A;  2D82 A;  3SVF A;  5DYU A;  5DYA A;  3IU6 A;  4HXP A;  3S91 A;  3U5K A;  4QC3 A;  5LVR A;  4HXN A;  1JM4 B;  4CL9 A;  5J0D A;  4YYN A;  4HXS A;  3UVD A;  5A7C A;  5CRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...