2RNYA

Complex structures of cbp bromodomain with h4 ack20 peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/nuclear protein
molecule keywords CREB-binding protein
publication title Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rnyA00
5I40A 4YAXA 4IOQA 4YYDA 5FE6A 5CQ7A 5BT4A 4YBTA 4N4IA 4PY6A 4A9LA 4NUDA 2YQDA 5EVAA 4NS5A 2H60A 4QSQA 5HQ5A 5D3PA 4YYHA 4CUTA 5HM0A 4Z1QA 5FB0A 2NXBA 5HFRA 3IU5A 2YYNA 2OUOA 5A5SA 3DAIA 5FE7A 4A9NA 4UYGA 5KTWA 5EP7A 5CTLA 4NR6A 2OSSA 4FLPA 4NR4A 5I88A 4NR7A 4TYLA 5DX4A 4UITA 4DONA 4HXRA 4A9HA 2L84A 4TZ8A 3MB3A 5LKTA 3AQAA 4QBMA 4Y03A 4O7CA 5G4RA 4BHWA 5L96A 4NRCA 4HXMA 4LYIA 3IU6A 5DW1A 4CUUA 5ENIA 4QSRA 5E9LA 4NR5A 5HELA 3UV4A 5I86A 5D3HA 4YABA 4YK0A 5BT5A 5KTXA 5HRWA 5E7DA 5DKHA 5A5RA 5A5NA 4QSUA 5EISA 4YYNA 4PCIA 2G4AA 4YY6A 3HMFA 5HENA 5EWDA 5IBNA 5DYUA 4CURA 5FH7A 3HMHA 4QZSA 5CQ3A 4AKNA 2D82A 5FE0A 4ZW1A 1N72A 3SVHA 5HRXA 4CFLA 5DYCA 4TTEA 5H1TA 5I89A 5IG6A 1F68A 5EPBA 5IGKA 5ENCA 4NYVA 4WIVA 4QR5A 5AMEA 2OO1A 4PS5A 4E96A 5ENJA 2L5EA 3FKMX 5LJ1A 4LZSA 2I7KA 5ENFA 2YEMA 5E3DA 5F60A 4NQMA 4NQNA 5EU1A 5A85A 2I8NA 3LJWA 5CPEA 3ONIA 3UVDA 4X2IA 4MENA 5LVQA 5EA1A 5F3AA 5I83A 5LKZA 4CFKA 4QSTA 3P1EA 5IGMA 4OUFA 4XY8A 5II1A 5L8UA 4Z6IA 4LR6A 5F2PA 5HRVA 5II2A 4QEWA 4UIZA 4LDFA 5CP5A 4UIVA 5DFDA 4QYDA 4IOOA 4A9EA 5KU3A 5ENHA 5HCLA 4Q0NA 4F3IA 4IR4A 5LJ2A 4Z6HA 4MR6A 4UIYA 4HXNA 4YADA 2E7OA 4QY4A 5HJCA 4MR5A 5IIDA 5HLSA 4KCXA 4O78A 5J0DA 4A9KA 1JSPB 5HQ7A 4QUUA 4UYFA 4NUEA 4PKLA 5LUUA 5F63A 5A5QA 5FE5A 2D9EA 2GRCA 4J0SA 2YDWA 2N9GA 4LZ2A 4QEVA 4LYWA 5FE1A 4QC3A 5CQTA 5E9KA 5D0CA 4NRAA 4HBYA 4MEPA 5ENEA 3MQMA 4N4FA 4CUQA 4YYKA 3O34A 4QSVA 3K2JA 4O77A 4N3WA 5CY9A 5LKUA 4YH4A 5E3GA 2RFJA 3LXJA 4Z93A 3UV5A 3U5MA 4QC1A 4YATA 4XYAA 5FE8A 5CQ8A 5EV9A 4UYHA 3UVXA 5C87A 4BW3A 5EWVA 3P1FA 4XY9A 1WUGA 5F62A 5ENGA 4QNSA 4UIWA 4QB3A 5EICA 1E6IA 3P1DA 4O75A 4C66A 4C67A 5D26A 4UYEA 4ALHA 5E9VA 4PTBA 2F6NA 5FFWA 5CRMA 4QSXA 4HXPA 5CQ4A 4TT4A 3U5NA 5FE3A 5D3JA 4O7FA 5AD2A 4LYSA 4UYFB 4WHWA 5D3LA 3P1CA 2RNYA 3O37A 3ZYUA 4KV4A 2E3KA 5CUBA 5FFVA 4YH3A 4XUBA 5DKDA 4O74A 4TU6A 5COIA 3U5PA 4QR4A 5A81A 2RI7A 4O70A 5FH8A 2DVRA 3MB4A 2FSAA 5CGPA 5DYXA 5FE4A 4CLBA 3UVWA 4YYIA 4HBWA 3O33A 5L98A 3DWYA 3O36A 3U5KA 5A82A 4YBMA 5FG5A 5TCMA 2E7NA 5LJ0A 5CUAA 3NXBA 5F1LA 4O7BA 5KTUA 5EGUA 5DW2A 5EM3A 4YYJA 4NRBA 4QSWA 5CS8A 4YYMA 4O72A 1X0JA 4XUAA 4ZQLA 4O71A 5A7CA 3S92A 4LRGA 2RS9B 3QZVA 3I3JA 5EQ1A 4OGJA 3LQHA 5CUGA 2LSPB 5E9YA 5A83A 4RVRA 5KO4A 5ENBA 5D25A 3U5OA 5F36A 5DY7A 5D3SA 5C8GA 3G0LA 5LVRA 4UYDA 4YYGA 4A9IA 5DKCA 3O35A 4TQNA 3AADA 4HBXA 5CQ6A 2DKWA 4PCEA 5H85A 4BW4A 4QYLA 4ALGA 3MXFA 5FE2A 4CUPA 4NYWA 5I7YA 2DATA 5I80A 5AMFA 5K29A 5FB1A 2DWWA 4O7AA 3SVGA 5ACYA 4A9MA 4BW2A 4J3IA 5CUEA 3D7CA 5EWCA 5FFYA 3S91A 3UW9A 3P5OA 5CQAA 5F5ZA 5CU8A 5CUCA 5FG6A 5D3RA 5BT3A 5E9IA 5IGLA 5ETBA 4TS8A 5FBXA 5C7NA 5E9MA 4J1PA 4A9JA 1ZS5A 2R0SA 4NYXA 2YELA 5DLXA 5TB6A 5EPSA 5JI8A 4J0RA 5E74A 4CL9A 5I1QA 2RO1A 5I29A 5E0RA 4QSSA 5EPRA 5F1HA 5DYAA 3LQIA 5DFCA 4HBVA 4NXJA 2RNXA 4NUCA 4UIUA 5D24A 3Q2FA 4HXKA 4Z1SA 5DBMA 5DFBA 5JWMA 4BW1A 2WP1A 5EI4A 1JM4B 5D3NA 4QEUA 4TT6A 2KTBB 2YW5A 5G4SA 5KHMA 4YC9A 5C4QA 4HXLA 4TU4A 5ETDA 2L85A 4A9OA 5L99A 5LKXA 5F25A 3MULA 3U5JA 5C85A 4MEOA 5CZGA 3UV2A 4HXOA 5A5OA 4IR5A 4NR8A 3Q2EA 4NR9A 3JVLA 4TT2A 5D7XA 4KV1A 5FDZA 4UIXA 4LC2A 2R0VA 3SVFA 4IR3A 1WUMA 5CUDA 3JVKA 5DLZA 5EWWA 5CRZA 3G0JA 4Q0OA 5FG4A 2DVVA 4MR4A 2DVSA 5EWHA 5FE9A 4YBSA 4WHUA 4OGIA 2MJVB 5F61A 5CFWA 5A5PA 3UVYA 4MR3A 3MUKA 1EQFA 4CUSA 4QR3A 5I7XA 4ZC9A 4YY4A 5HFQA 3LQJA 2WP2A 3QZTA 4GPJA 5H1UA 3TLPA 2RNWA 3JVMA 5HEMA 5H1VA 4MEQA 5EK9A 4IORA 3GG3A 5L8TA 3HMEA 4O76A 2DVQA 4IR6A 4O7EA 5FH6A 4BJXA 5HQ6A 4A9FA 5L97A 3QZSA 4N4GA 2YEKA 4LZRA 5C89A 2R0YA 5AD3A 4N4HA 3JVJA 2F6JA 5D3TA 3RCWA 4QUTA 5E73A 2R10A 4QSPA 3U5LA 4TZ2A 5IGNA 4HXSA 5CQ5A
chains in the Genus database with same CATH superfamily
5I40A 4YAXA 4IOQA 4YYDA 5FE6A 5CQ7A 5BT4A 4YBTA 4N4IA 4PY6A 4A9LA 4NUDA 2YQDA 5EVAA 4NS5A 2H60A 4QSQA 5HQ5A 5D3PA 4YYHA 4CUTA 5HM0A 4Z1QA 5FB0A 2NXBA 5HFRA 3IU5A 2YYNA 2OUOA 5A5SA 3DAIA 5FE7A 4A9NA 3VKHA 4UYGA 5KTWA 5EP7A 5CTLA 4NR6A 2OSSA 3D1BA 4FLPA 4NR4A 4NR7A 5I88A 4TYLA 5DX4A 4UITA 4DONA 4HXRA 4A9HA 2L84A 4TZ8A 3MB3A 5LKTA 3AQAA 4QBMA 4Y03A 4O7CA 5G4RA 4BHWA 5L96A 4NRCA 4HXMA 4LYIA 3IU6A 5DW1A 4CUUA 5ENIA 2EJNA 4QSRA 5E9LA 4NR5A 5HELA 3UV4A 5I86A 5D3HA 4YABA 4YK0A 5BT5A 5KTXA 5HRWA 5E7DA 5DKHA 5A5RA 5A5NA 4QSUA 4AKIA 5EISA 4YYNA 4PCIA 2G4AA 4YY6A 3HMFA 5HENA 5EWDA 5IBNA 5DYUA 4CURA 5FH7A 3HMHA 4QZSA 5CQ3A 4AKNA 2D82A 5FE0A 4ZW1A 1N72A 3SVHA 5HRXA 4CFLA 5DYCA 4TTEA 5H1TA 5I89A 5IG6A 1F68A 5EPBA 5IGKA 5ENCA 4NYVA 4WIVA 4QR5A 5AMEA 2OO1A 4PS5A 4E96A 5ENJA 2L5EA 3FKMX 5LJ1A 4LZSA 2I7KA 5ENFA 2YEMA 5E3DA 5F60A 4NQMA 1ZKRA 4NQNA 5EU1A 2I8NA 3LJWA 5CPEA 3ONIA 5A85A 3UVDA 4X2IA 4MENA 5LVQA 5EA1A 5F3AA 5I83A 5LKZA 4CFKA 4QSTA 3P1EA 5IGMA 4OUFA 4XY8A 5II1A 5L8UA 4Z6IA 4LR6A 5F2PA 5HRVA 5II2A 4QEWA 4UIZA 4LDFA 5CP5A 4UIVA 5DFDA 4QYDA 4IOOA 4A9EA 5KU3A 5ENHA 5HCLA 4Q0NA 4F3IA 4IR4A 5LJ2A 4Z6HA 4MR6A 4UIYA 4HXNA 4YADA 2E7OA 4QY4A 5HJCA 4MR5A 5IIDA 5HLSA 4KCXA 4O78A 5J0DA 4A9KA 1JSPB 5HQ7A 4QUUA 4UYFA 4NUEA 4PKLA 5LUUA 5F63A 5A5QA 5FE5A 2D9EA 2GRCA 4J0SA 2YDWA 2N9GA 4LZ2A 4QEVA 4LYWA 5FE1A 4QC3A 5CQTA 5E9KA 5D0CA 4NRAA 4HBYA 4MEPA 5ENEA 3MQMA 4N4FA 4CUQA 4YYKA 3O34A 4QSVA 3K2JA 4O77A 4N3WA 5CY9A 5LKUA 4YH4A 5E3GA 2RFJA 3LXJA 4Z93A 3UV5A 3U5MA 4QC1A 4YATA 4XYAA 5FE8A 5CQ8A 5EV9A 4UYHA 3UVXA 5C87A 4BW3A 5EWVA 3P1FA 4XY9A 1WUGA 5F62A 5ENGA 4QNSA 4UIWA 4QB3A 5EICA 1E6IA 3P1DA 4O75A 4C66A 4C67A 5D26A 4UYEA 4ALHA 5E9VA 4PTBA 2F6NA 3D1DA 5FFWA 5CRMA 4QSXA 4HXPA 5CQ4A 4TT4A 3U5NA 5FE3A 5D3JA 4O7FA 5AD2A 4LYSA 4UYFB 4WHWA 5D3LA 3P1CA 2RNYA 3ERRA 3O37A 3ZYUA 4KV4A 2E3KA 5CUBA 5FFVA 4YH3A 4XUBA 5DKDA 4O74A 4TU6A 5COIA 3U5PA 1PUOA 4QR4A 5A81A 2RI7A 4O70A 5FH8A 2DVRA 3MB4A 2FSAA 5CGPA 5DYXA 5FE4A 4CLBA 4AKHA 3UVWA 4YYIA 4HBWA 3O33A 5L98A 3DWYA 3O36A 3U5KA 5A82A 4YBMA 5FG5A 5TCMA 2E7NA 5LJ0A 5CUAA 3NXBA 5F1LA 4O7BA 5KTUA 5EGUA 5DW2A 5EM3A 4YYJA 4NRBA 4QSWA 5CS8A 4YYMA 4O72A 1X0JA 4XUAA 4ZQLA 4O71A 5A7CA 3S92A 4LRGA 2RS9B 3QZVA 3I3JA 5EQ1A 4OGJA 3LQHA 5CUGA 2LSPB 5E9YA 5A83A 4RVRA 5KO4A 5ENBA 4AI6A 5D25A 3U5OA 5F36A 5DY7A 5D3SA 5C8GA 3G0LA 5LVRA 4UYDA 4YYGA 4A9IA 5DKCA 3O35A 4TQNA 3AADA 4HBXA 5CQ6A 2DKWA 4PCEA 5H85A 4BW4A 4QYLA 4ALGA 3MXFA 5FE2A 4CUPA 4NYWA 5I7YA 2DATA 5I80A 5AMFA 5K29A 5FB1A 2DWWA 4O7AA 3SVGA 5ACYA 4A9MA 4BW2A 4J3IA 5CUEA 3D7CA 5EWCA 5FFYA 3S91A 3UW9A 3P5OA 5CQAA 5F5ZA 5CU8A 5CUCA 5FG6A 5D3RA 5BT3A 5E9IA 5IGLA 5ETBA 4TS8A 5FBXA 5C7NA 5E9MA 4J1PA 4A9JA 1ZS5A 2R0SA 4NYXA 2YELA 5DLXA 5TB6A 5EPSA 5JI8A 4J0RA 5E74A 4CL9A 5I1QA 2RO1A 5I29A 5E0RA 4QSSA 5EPRA 5F1HA 5DYAA 3LQIA 5DFCA 4HBVA 4NXJA 2RNXA 4NUCA 4UIUA 5D24A 3Q2FA 4HXKA 4Z1SA 5DBMA 5DFBA 5JWMA 4BW1A 2WP1A 5EI4A 1JM4B 5D3NA 4QEUA 4TT6A 2KTBB 2YW5A 5G4SA 5KHMA 4YC9A 5C4QA 4HXLA 4TU4A 5ETDA 2L85A 4A9OA 5L99A 5LKXA 5F25A 3MULA 3U5JA 5C85A 4MEOA 5CZGA 3UV2A 4HXOA 5A5OA 4IR5A 4NR8A 3Q2EA 4NR9A 4AKGA 3JVLA 4TT2A 5D7XA 4KV1A 5FDZA 4UIXA 4LC2A 2R0VA 3SVFA 4IR3A 1WUMA 5CUDA 3JVKA 5DLZA 5EWWA 5CRZA 3G0JA 4Q0OA 5FG4A 2DVVA 4MR4A 2DVSA 5EWHA 5FE9A 4YBSA 4WHUA 4OGIA 2MJVB 5F61A 5CFWA 5A5PA 3UVYA 4MR3A 3MUKA 1EQFA 4CUSA 4QR3A 5I7XA 4ZC9A 4YY4A 5HFQA 3LQJA 2WP2A 3QZTA 4GPJA 5H1UA 3TLPA 2RNWA 3JVMA 5HEMA 5H1VA 4MEQA 5EK9A 4IORA 3GG3A 5L8TA 3HMEA 4O76A 2DVQA 4IR6A 4O7EA 5FH6A 4BJXA 5HQ6A 4A9FA 5L97A 3QZSA 4N4GA 2YEKA 4LZRA 5C89A 2R0YA 5AD3A 4N4HA 3JVJA 2F6JA 5D3TA 3RCWA 4QUTA 5E73A 2R10A 4QSPA 3U5LA 4TZ2A 5IGNA 3VKGA 4HXSA 5CQ5A
chains in the Genus database with same CATH topology
5I40A 4YAXA 4IOQA 4YYDA 5FE6A 5CQ7A 5BT4A 4YBTA 4N4IA 4PY6A 4A9LA 4NUDA 2YQDA 5EVAA 4NS5A 2H60A 4QSQA 5HQ5A 5D3PA 4YYHA 4CUTA 5HM0A 4Z1QA 5FB0A 2NXBA 5HFRA 3IU5A 2YYNA 2OUOA 5A5SA 3DAIA 5FE7A 4A9NA 4UYGA 5KTWA 5EP7A 5CTLA 4NR6A 2OSSA 4FLPA 4NR4A 5I88A 4NR7A 4TYLA 5DX4A 4UITA 4DONA 4HXRA 4A9HA 2L84A 4TZ8A 3MB3A 5LKTA 3AQAA 4QBMA 4Y03A 4O7CA 5G4RA 4BHWA 5L96A 4NRCA 4HXMA 4LYIA 3IU6A 5DW1A 4CUUA 5ENIA 4QSRA 5E9LA 4NR5A 5HELA 3UV4A 5I86A 5D3HA 4YABA 4YK0A 5BT5A 5KTXA 5HRWA 5E7DA 5DKHA 5A5RA 5A5NA 4QSUA 5EISA 4YYNA 4PCIA 2G4AA 4YY6A 3HMFA 5HENA 5EWDA 5IBNA 5DYUA 4CURA 5FH7A 3HMHA 4QZSA 5CQ3A 4AKNA 2D82A 5FE0A 4ZW1A 1N72A 3SVHA 5HRXA 4CFLA 5DYCA 4TTEA 5H1TA 5I89A 5IG6A 1F68A 5EPBA 5IGKA 5ENCA 4NYVA 4WIVA 4QR5A 5AMEA 2OO1A 4PS5A 4E96A 5ENJA 2L5EA 3FKMX 5LJ1A 4LZSA 2I7KA 5ENFA 2YEMA 5E3DA 5F60A 4NQMA 4NQNA 5EU1A 5A85A 2I8NA 3LJWA 5CPEA 3ONIA 3UVDA 4X2IA 4MENA 5LVQA 5EA1A 5F3AA 5I83A 5LKZA 4CFKA 4QSTA 3P1EA 5IGMA 4OUFA 4XY8A 5II1A 5L8UA 4Z6IA 4LR6A 5F2PA 5HRVA 5II2A 4QEWA 4UIZA 4LDFA 5CP5A 4UIVA 5DFDA 4QYDA 4IOOA 4A9EA 5KU3A 5ENHA 5HCLA 4Q0NA 4F3IA 4IR4A 5LJ2A 4Z6HA 4MR6A 4UIYA 4HXNA 4YADA 2E7OA 4QY4A 5HJCA 4MR5A 5IIDA 5HLSA 4KCXA 4O78A 5J0DA 4A9KA 1JSPB 5HQ7A 4QUUA 4UYFA 4NUEA 4PKLA 5LUUA 5F63A 5A5QA 5FE5A 2D9EA 2GRCA 4J0SA 2YDWA 2N9GA 4LZ2A 4QEVA 4LYWA 5FE1A 4QC3A 5CQTA 5E9KA 5D0CA 4NRAA 4HBYA 4MEPA 5ENEA 3MQMA 4N4FA 4CUQA 4YYKA 3O34A 4QSVA 3K2JA 4O77A 4N3WA 5CY9A 5LKUA 4YH4A 5E3GA 2RFJA 3LXJA 4Z93A 3UV5A 3U5MA 4QC1A 4YATA 4XYAA 5FE8A 5CQ8A 5EV9A 4UYHA 3UVXA 5C87A 4BW3A 5EWVA 3P1FA 4XY9A 1WUGA 5F62A 5ENGA 4QNSA 4UIWA 4QB3A 5EICA 1E6IA 3P1DA 4O75A 4C66A 4C67A 5D26A 4UYEA 4ALHA 5E9VA 4PTBA 2F6NA 5FFWA 5CRMA 4QSXA 4HXPA 5CQ4A 4TT4A 3U5NA 5FE3A 5D3JA 4O7FA 5AD2A 4LYSA 4UYFB 4WHWA 5D3LA 3P1CA 2RNYA 3O37A 3ZYUA 4KV4A 2E3KA 5CUBA 5FFVA 4YH3A 4XUBA 5DKDA 4O74A 4TU6A 5COIA 3U5PA 4QR4A 5A81A 2RI7A 4O70A 5FH8A 2DVRA 3MB4A 2FSAA 5CGPA 5DYXA 5FE4A 4CLBA 3UVWA 4YYIA 4HBWA 3O33A 5L98A 3DWYA 3O36A 3U5KA 5A82A 4YBMA 5FG5A 5TCMA 2E7NA 5LJ0A 5CUAA 3NXBA 5F1LA 4O7BA 5KTUA 5EGUA 5DW2A 5EM3A 4YYJA 4NRBA 4QSWA 5CS8A 4YYMA 4O72A 1X0JA 4XUAA 4ZQLA 4O71A 5A7CA 3S92A 4LRGA 2RS9B 3QZVA 3I3JA 5EQ1A 4OGJA 3LQHA 5CUGA 2LSPB 5E9YA 5A83A 4RVRA 5KO4A 5ENBA 5D25A 3U5OA 5F36A 5DY7A 5D3SA 5C8GA 3G0LA 5LVRA 4UYDA 4YYGA 4A9IA 5DKCA 3O35A 4TQNA 3AADA 4HBXA 5CQ6A 2DKWA 4PCEA 5H85A 4BW4A 4QYLA 4ALGA 3MXFA 5FE2A 4CUPA 4NYWA 5I7YA 2DATA 5I80A 5AMFA 5K29A 5FB1A 2DWWA 4O7AA 3SVGA 5ACYA 4A9MA 4BW2A 4J3IA 5CUEA 3D7CA 5EWCA 5FFYA 3S91A 3UW9A 3P5OA 5CQAA 5F5ZA 5CU8A 5CUCA 5FG6A 5D3RA 5BT3A 5E9IA 5IGLA 5ETBA 4TS8A 5FBXA 5C7NA 5E9MA 4J1PA 4A9JA 1ZS5A 2R0SA 4NYXA 2YELA 5DLXA 5TB6A 5EPSA 5JI8A 4J0RA 5E74A 4CL9A 5I1QA 2RO1A 5I29A 5E0RA 4QSSA 5EPRA 5F1HA 5DYAA 3LQIA 5DFCA 4HBVA 4NXJA 2RNXA 4NUCA 4UIUA 5D24A 3Q2FA 4HXKA 4Z1SA 5DBMA 5DFBA 5JWMA 4BW1A 2WP1A 5EI4A 1JM4B 5D3NA 4QEUA 4TT6A 2KTBB 2YW5A 5G4SA 5KHMA 4YC9A 5C4QA 4HXLA 4TU4A 5ETDA 2L85A 4A9OA 5L99A 5LKXA 5F25A 3MULA 3U5JA 5C85A 4MEOA 5CZGA 3UV2A 4HXOA 5A5OA 4IR5A 4NR8A 3Q2EA 4NR9A 3JVLA 4TT2A 5D7XA 4KV1A 5FDZA 4UIXA 4LC2A 2R0VA 3SVFA 4IR3A 1WUMA 5CUDA 3JVKA 5DLZA 5EWWA 5CRZA 3G0JA 4Q0OA 5FG4A 2DVVA 4MR4A 2DVSA 5EWHA 5FE9A 4YBSA 4WHUA 4OGIA 2MJVB 5F61A 5CFWA 5A5PA 3UVYA 4MR3A 3MUKA 1EQFA 4CUSA 4QR3A 5I7XA 4ZC9A 4YY4A 5HFQA 3LQJA 2WP2A 3QZTA 4GPJA 5H1UA 3TLPA 2RNWA 3JVMA 5HEMA 5H1VA 4MEQA 5EK9A 4IORA 3GG3A 5L8TA 3HMEA 4O76A 2DVQA 4IR6A 4O7EA 5FH6A 4BJXA 5HQ6A 4A9FA 5L97A 3QZSA 4N4GA 2YEKA 4LZRA 5C89A 2R0YA 5AD3A 4N4HA 3JVJA 2F6JA 5D3TA 3RCWA 4QUTA 5E73A 2R10A 4QSPA 3U5LA 4TZ2A 5IGNA 4HXSA 5CQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I40 A;  4YAX A;  4IOQ A;  4YYD A;  5FE6 A;  5CQ7 A;  5BT4 A;  4YBT A;  4N4I A;  4PY6 A;  4A9L A;  4NUD A;  2YQD A;  5EVA A;  4NS5 A;  2H60 A;  4QSQ A;  5HQ5 A;  5D3P A;  4YYH A;  4CUT A;  5HM0 A;  4Z1Q A;  5FB0 A;  2NXB A;  5HFR A;  3IU5 A;  2YYN A;  2OUO A;  5A5S A;  3DAI A;  5FE7 A;  4A9N A;  4UYG A;  5KTW A;  5EP7 A;  5CTL A;  4NR6 A;  2OSS A;  4FLP A;  4NR4 A;  5I88 A;  4NR7 A;  4TYL A;  5DX4 A;  4UIT A;  4DON A;  4HXR A;  4A9H A;  2L84 A;  4TZ8 A;  3MB3 A;  5LKT A;  3AQA A;  4QBM A;  4Y03 A;  4O7C A;  5G4R A;  4BHW A;  5L96 A;  4NRC A;  4HXM A;  4LYI A;  3IU6 A;  5DW1 A;  4CUU A;  5ENI A;  4QSR A;  5E9L A;  4NR5 A;  5HEL A;  3UV4 A;  5I86 A;  5D3H A;  4YAB A;  4YK0 A;  5BT5 A;  5KTX A;  5HRW A;  5E7D A;  5DKH A;  5A5R A;  5A5N A;  4QSU A;  5EIS A;  4YYN A;  4PCI A;  2G4A A;  4YY6 A;  3HMF A;  5HEN A;  5EWD A;  5IBN A;  5DYU A;  4CUR A;  5FH7 A;  3HMH A;  4QZS A;  5CQ3 A;  4AKN A;  2D82 A;  5FE0 A;  4ZW1 A;  1N72 A;  3SVH A;  5HRX A;  4CFL A;  5DYC A;  4TTE A;  5H1T A;  5I89 A;  5IG6 A;  1F68 A;  5EPB A;  5IGK A;  5ENC A;  4NYV A;  4WIV A;  4QR5 A;  5AME A;  2OO1 A;  4PS5 A;  4E96 A;  5ENJ A;  2L5E A;  3FKM X;  5LJ1 A;  4LZS A;  2I7K A;  5ENF A;  2YEM A;  5E3D A;  5F60 A;  4NQM A;  4NQN A;  5EU1 A;  5A85 A;  2I8N A;  3LJW A;  5CPE A;  3ONI A;  3UVD A;  4X2I A;  4MEN A;  5LVQ A;  5EA1 A;  5F3A A;  5I83 A;  5LKZ A;  4CFK A;  4QST A;  3P1E A;  5IGM A;  4OUF A;  4XY8 A;  5II1 A;  5L8U A;  4Z6I A;  4LR6 A;  5F2P A;  5HRV A;  5II2 A;  4QEW A;  4UIZ A;  4LDF A;  5CP5 A;  4UIV A;  5DFD A;  4QYD A;  4IOO A;  4A9E A;  5KU3 A;  5ENH A;  5HCL A;  4Q0N A;  4F3I A;  4IR4 A;  5LJ2 A;  4Z6H A;  4MR6 A;  4UIY A;  4HXN A;  4YAD A;  2E7O A;  4QY4 A;  5HJC A;  4MR5 A;  5IID A;  5HLS A;  4KCX A;  4O78 A;  5J0D A;  4A9K A;  1JSP B;  5HQ7 A;  4QUU A;  4UYF A;  4NUE A;  4PKL A;  5LUU A;  5F63 A;  5A5Q A;  5FE5 A;  2D9E A;  2GRC A;  4J0S A;  2YDW A;  2N9G A;  4LZ2 A;  4QEV A;  4LYW A;  5FE1 A;  4QC3 A;  5CQT A;  5E9K A;  5D0C A;  4NRA A;  4HBY A;  4MEP A;  5ENE A;  3MQM A;  4N4F A;  4CUQ A;  4YYK A;  3O34 A;  4QSV A;  3K2J A;  4O77 A;  4N3W A;  5CY9 A;  5LKU A;  4YH4 A;  5E3G A;  2RFJ A;  3LXJ A;  4Z93 A;  3UV5 A;  3U5M A;  4QC1 A;  4YAT A;  4XYA A;  5FE8 A;  5CQ8 A;  5EV9 A;  4UYH A;  3UVX A;  5C87 A;  4BW3 A;  5EWV A;  3P1F A;  4XY9 A;  1WUG A;  5F62 A;  5ENG A;  4QNS A;  4UIW A;  4QB3 A;  5EIC A;  1E6I A;  3P1D A;  4O75 A;  4C66 A;  4C67 A;  5D26 A;  4UYE A;  4ALH A;  5E9V A;  4PTB A;  2F6N A;  5FFW A;  5CRM A;  4QSX A;  4HXP A;  5CQ4 A;  4TT4 A;  3U5N A;  5FE3 A;  5D3J A;  4O7F A;  5AD2 A;  4LYS A;  4UYF B;  4WHW A;  5D3L A;  3P1C A;  2RNY A;  3O37 A;  3ZYU A;  4KV4 A;  2E3K A;  5CUB A;  5FFV A;  4YH3 A;  4XUB A;  5DKD A;  4O74 A;  4TU6 A;  5COI A;  3U5P A;  4QR4 A;  5A81 A;  2RI7 A;  4O70 A;  5FH8 A;  2DVR A;  3MB4 A;  2FSA A;  5CGP A;  5DYX A;  5FE4 A;  4CLB A;  3UVW A;  4YYI A;  4HBW A;  3O33 A;  5L98 A;  3DWY A;  3O36 A;  3U5K A;  5A82 A;  4YBM A;  5FG5 A;  5TCM A;  2E7N A;  5LJ0 A;  5CUA A;  3NXB A;  5F1L A;  4O7B A;  5KTU A;  5EGU A;  5DW2 A;  5EM3 A;  4YYJ A;  4NRB A;  4QSW A;  5CS8 A;  4YYM A;  4O72 A;  1X0J A;  4XUA A;  4ZQL A;  4O71 A;  5A7C A;  3S92 A;  4LRG A;  2RS9 B;  3QZV A;  3I3J A;  5EQ1 A;  4OGJ A;  3LQH A;  5CUG A;  2LSP B;  5E9Y A;  5A83 A;  4RVR A;  5KO4 A;  5ENB A;  5D25 A;  3U5O A;  5F36 A;  5DY7 A;  5D3S A;  5C8G A;  3G0L A;  5LVR A;  4UYD A;  4YYG A;  4A9I A;  5DKC A;  3O35 A;  4TQN A;  3AAD A;  4HBX A;  5CQ6 A;  2DKW A;  4PCE A;  5H85 A;  4BW4 A;  4QYL A;  4ALG A;  3MXF A;  5FE2 A;  4CUP A;  4NYW A;  5I7Y A;  2DAT A;  5I80 A;  5AMF A;  5K29 A;  5FB1 A;  2DWW A;  4O7A A;  3SVG A;  5ACY A;  4A9M A;  4BW2 A;  4J3I A;  5CUE A;  3D7C A;  5EWC A;  5FFY A;  3S91 A;  3UW9 A;  3P5O A;  5CQA A;  5F5Z A;  5CU8 A;  5CUC A;  5FG6 A;  5D3R A;  5BT3 A;  5E9I A;  5IGL A;  5ETB A;  4TS8 A;  5FBX A;  5C7N A;  5E9M A;  4J1P A;  4A9J A;  1ZS5 A;  2R0S A;  4NYX A;  2YEL A;  5DLX A;  5TB6 A;  5EPS A;  5JI8 A;  4J0R A;  5E74 A;  4CL9 A;  5I1Q A;  2RO1 A;  5I29 A;  5E0R A;  4QSS A;  5EPR A;  5F1H A;  5DYA A;  3LQI A;  5DFC A;  4HBV A;  4NXJ A;  2RNX A;  4NUC A;  4UIU A;  5D24 A;  3Q2F A;  4HXK A;  4Z1S A;  5DBM A;  5DFB A;  5JWM A;  4BW1 A;  2WP1 A;  5EI4 A;  1JM4 B;  5D3N A;  4QEU A;  4TT6 A;  2KTB B;  2YW5 A;  5G4S A;  5KHM A;  4YC9 A;  5C4Q A;  4HXL A;  4TU4 A;  5ETD A;  2L85 A;  4A9O A;  5L99 A;  5LKX A;  5F25 A;  3MUL A;  3U5J A;  5C85 A;  4MEO A;  5CZG A;  3UV2 A;  4HXO A;  5A5O A;  4IR5 A;  4NR8 A;  3Q2E A;  4NR9 A;  3JVL A;  4TT2 A;  5D7X A;  4KV1 A;  5FDZ A;  4UIX A;  4LC2 A;  2R0V A;  3SVF A;  4IR3 A;  1WUM A;  5CUD A;  3JVK A;  5DLZ A;  5EWW A;  5CRZ A;  3G0J A;  4Q0O A;  5FG4 A;  2DVV A;  4MR4 A;  2DVS A;  5EWH A;  5FE9 A;  4YBS A;  4WHU A;  4OGI A;  2MJV B;  5F61 A;  5CFW A;  5A5P A;  3UVY A;  4MR3 A;  3MUK A;  1EQF A;  4CUS A;  4QR3 A;  5I7X A;  4ZC9 A;  4YY4 A;  5HFQ A;  3LQJ A;  2WP2 A;  3QZT A;  4GPJ A;  5H1U A;  3TLP A;  2RNW A;  3JVM A;  5HEM A;  5H1V A;  4MEQ A;  5EK9 A;  4IOR A;  3GG3 A;  5L8T A;  3HME A;  4O76 A;  2DVQ A;  4IR6 A;  4O7E A;  5FH6 A;  4BJX A;  5HQ6 A;  4A9F A;  5L97 A;  3QZS A;  4N4G A;  2YEK A;  4LZR A;  5C89 A;  2R0Y A;  5AD3 A;  4N4H A;  3JVJ A;  2F6J A;  5D3T A;  3RCW A;  4QUT A;  5E73 A;  2R10 A;  4QSP A;  3U5L A;  4TZ2 A;  5IGN A;  4HXS A;  5CQ5 A; 
#chains in the Genus database with same CATH topology
 5I40 A;  4YAX A;  4IOQ A;  4YYD A;  5FE6 A;  5CQ7 A;  5BT4 A;  4YBT A;  4N4I A;  4PY6 A;  4A9L A;  4NUD A;  2YQD A;  5EVA A;  4NS5 A;  2H60 A;  4QSQ A;  5HQ5 A;  5D3P A;  4YYH A;  4CUT A;  5HM0 A;  4Z1Q A;  5FB0 A;  2NXB A;  5HFR A;  3IU5 A;  2YYN A;  2OUO A;  5A5S A;  3DAI A;  5FE7 A;  4A9N A;  3VKH A;  4UYG A;  5KTW A;  5EP7 A;  5CTL A;  4NR6 A;  2OSS A;  3D1B A;  4FLP A;  4NR4 A;  4NR7 A;  5I88 A;  4TYL A;  5DX4 A;  4UIT A;  4DON A;  4HXR A;  4A9H A;  2L84 A;  4TZ8 A;  3MB3 A;  5LKT A;  3AQA A;  4QBM A;  4Y03 A;  4O7C A;  5G4R A;  4BHW A;  5L96 A;  4NRC A;  4HXM A;  4LYI A;  3IU6 A;  5DW1 A;  4CUU A;  5ENI A;  2EJN A;  4QSR A;  5E9L A;  4NR5 A;  5HEL A;  3UV4 A;  5I86 A;  5D3H A;  4YAB A;  4YK0 A;  5BT5 A;  5KTX A;  5HRW A;  5E7D A;  5DKH A;  5A5R A;  5A5N A;  4QSU A;  4AKI A;  5EIS A;  4YYN A;  4PCI A;  2G4A A;  4YY6 A;  3HMF A;  5HEN A;  5EWD A;  5IBN A;  5DYU A;  4CUR A;  5FH7 A;  3HMH A;  4QZS A;  5CQ3 A;  4AKN A;  2D82 A;  5FE0 A;  4ZW1 A;  1N72 A;  3SVH A;  5HRX A;  4CFL A;  5DYC A;  4TTE A;  5H1T A;  5I89 A;  5IG6 A;  1F68 A;  5EPB A;  5IGK A;  5ENC A;  4NYV A;  4WIV A;  4QR5 A;  5AME A;  2OO1 A;  4PS5 A;  4E96 A;  5ENJ A;  2L5E A;  3FKM X;  5LJ1 A;  4LZS A;  2I7K A;  5ENF A;  2YEM A;  5E3D A;  5F60 A;  4NQM A;  1ZKR A;  4NQN A;  5EU1 A;  2I8N A;  3LJW A;  5CPE A;  3ONI A;  5A85 A;  3UVD A;  4X2I A;  4MEN A;  5LVQ A;  5EA1 A;  5F3A A;  5I83 A;  5LKZ A;  4CFK A;  4QST A;  3P1E A;  5IGM A;  4OUF A;  4XY8 A;  5II1 A;  5L8U A;  4Z6I A;  4LR6 A;  5F2P A;  5HRV A;  5II2 A;  4QEW A;  4UIZ A;  4LDF A;  5CP5 A;  4UIV A;  5DFD A;  4QYD A;  4IOO A;  4A9E A;  5KU3 A;  5ENH A;  5HCL A;  4Q0N A;  4F3I A;  4IR4 A;  5LJ2 A;  4Z6H A;  4MR6 A;  4UIY A;  4HXN A;  4YAD A;  2E7O A;  4QY4 A;  5HJC A;  4MR5 A;  5IID A;  5HLS A;  4KCX A;  4O78 A;  5J0D A;  4A9K A;  1JSP B;  5HQ7 A;  4QUU A;  4UYF A;  4NUE A;  4PKL A;  5LUU A;  5F63 A;  5A5Q A;  5FE5 A;  2D9E A;  2GRC A;  4J0S A;  2YDW A;  2N9G A;  4LZ2 A;  4QEV A;  4LYW A;  5FE1 A;  4QC3 A;  5CQT A;  5E9K A;  5D0C A;  4NRA A;  4HBY A;  4MEP A;  5ENE A;  3MQM A;  4N4F A;  4CUQ A;  4YYK A;  3O34 A;  4QSV A;  3K2J A;  4O77 A;  4N3W A;  5CY9 A;  5LKU A;  4YH4 A;  5E3G A;  2RFJ A;  3LXJ A;  4Z93 A;  3UV5 A;  3U5M A;  4QC1 A;  4YAT A;  4XYA A;  5FE8 A;  5CQ8 A;  5EV9 A;  4UYH A;  3UVX A;  5C87 A;  4BW3 A;  5EWV A;  3P1F A;  4XY9 A;  1WUG A;  5F62 A;  5ENG A;  4QNS A;  4UIW A;  4QB3 A;  5EIC A;  1E6I A;  3P1D A;  4O75 A;  4C66 A;  4C67 A;  5D26 A;  4UYE A;  4ALH A;  5E9V A;  4PTB A;  2F6N A;  3D1D A;  5FFW A;  5CRM A;  4QSX A;  4HXP A;  5CQ4 A;  4TT4 A;  3U5N A;  5FE3 A;  5D3J A;  4O7F A;  5AD2 A;  4LYS A;  4UYF B;  4WHW A;  5D3L A;  3P1C A;  2RNY A;  3ERR A;  3O37 A;  3ZYU A;  4KV4 A;  2E3K A;  5CUB A;  5FFV A;  4YH3 A;  4XUB A;  5DKD A;  4O74 A;  4TU6 A;  5COI A;  3U5P A;  1PUO A;  4QR4 A;  5A81 A;  2RI7 A;  4O70 A;  5FH8 A;  2DVR A;  3MB4 A;  2FSA A;  5CGP A;  5DYX A;  5FE4 A;  4CLB A;  4AKH A;  3UVW A;  4YYI A;  4HBW A;  3O33 A;  5L98 A;  3DWY A;  3O36 A;  3U5K A;  5A82 A;  4YBM A;  5FG5 A;  5TCM A;  2E7N A;  5LJ0 A;  5CUA A;  3NXB A;  5F1L A;  4O7B A;  5KTU A;  5EGU A;  5DW2 A;  5EM3 A;  4YYJ A;  4NRB A;  4QSW A;  5CS8 A;  4YYM A;  4O72 A;  1X0J A;  4XUA A;  4ZQL A;  4O71 A;  5A7C A;  3S92 A;  4LRG A;  2RS9 B;  3QZV A;  3I3J A;  5EQ1 A;  4OGJ A;  3LQH A;  5CUG A;  2LSP B;  5E9Y A;  5A83 A;  4RVR A;  5KO4 A;  5ENB A;  4AI6 A;  5D25 A;  3U5O A;  5F36 A;  5DY7 A;  5D3S A;  5C8G A;  3G0L A;  5LVR A;  4UYD A;  4YYG A;  4A9I A;  5DKC A;  3O35 A;  4TQN A;  3AAD A;  4HBX A;  5CQ6 A;  2DKW A;  4PCE A;  5H85 A;  4BW4 A;  4QYL A;  4ALG A;  3MXF A;  5FE2 A;  4CUP A;  4NYW A;  5I7Y A;  2DAT A;  5I80 A;  5AMF A;  5K29 A;  5FB1 A;  2DWW A;  4O7A A;  3SVG A;  5ACY A;  4A9M A;  4BW2 A;  4J3I A;  5CUE A;  3D7C A;  5EWC A;  5FFY A;  3S91 A;  3UW9 A;  3P5O A;  5CQA A;  5F5Z A;  5CU8 A;  5CUC A;  5FG6 A;  5D3R A;  5BT3 A;  5E9I A;  5IGL A;  5ETB A;  4TS8 A;  5FBX A;  5C7N A;  5E9M A;  4J1P A;  4A9J A;  1ZS5 A;  2R0S A;  4NYX A;  2YEL A;  5DLX A;  5TB6 A;  5EPS A;  5JI8 A;  4J0R A;  5E74 A;  4CL9 A;  5I1Q A;  2RO1 A;  5I29 A;  5E0R A;  4QSS A;  5EPR A;  5F1H A;  5DYA A;  3LQI A;  5DFC A;  4HBV A;  4NXJ A;  2RNX A;  4NUC A;  4UIU A;  5D24 A;  3Q2F A;  4HXK A;  4Z1S A;  5DBM A;  5DFB A;  5JWM A;  4BW1 A;  2WP1 A;  5EI4 A;  1JM4 B;  5D3N A;  4QEU A;  4TT6 A;  2KTB B;  2YW5 A;  5G4S A;  5KHM A;  4YC9 A;  5C4Q A;  4HXL A;  4TU4 A;  5ETD A;  2L85 A;  4A9O A;  5L99 A;  5LKX A;  5F25 A;  3MUL A;  3U5J A;  5C85 A;  4MEO A;  5CZG A;  3UV2 A;  4HXO A;  5A5O A;  4IR5 A;  4NR8 A;  3Q2E A;  4NR9 A;  4AKG A;  3JVL A;  4TT2 A;  5D7X A;  4KV1 A;  5FDZ A;  4UIX A;  4LC2 A;  2R0V A;  3SVF A;  4IR3 A;  1WUM A;  5CUD A;  3JVK A;  5DLZ A;  5EWW A;  5CRZ A;  3G0J A;  4Q0O A;  5FG4 A;  2DVV A;  4MR4 A;  2DVS A;  5EWH A;  5FE9 A;  4YBS A;  4WHU A;  4OGI A;  2MJV B;  5F61 A;  5CFW A;  5A5P A;  3UVY A;  4MR3 A;  3MUK A;  1EQF A;  4CUS A;  4QR3 A;  5I7X A;  4ZC9 A;  4YY4 A;  5HFQ A;  3LQJ A;  2WP2 A;  3QZT A;  4GPJ A;  5H1U A;  3TLP A;  2RNW A;  3JVM A;  5HEM A;  5H1V A;  4MEQ A;  5EK9 A;  4IOR A;  3GG3 A;  5L8T A;  3HME A;  4O76 A;  2DVQ A;  4IR6 A;  4O7E A;  5FH6 A;  4BJX A;  5HQ6 A;  4A9F A;  5L97 A;  3QZS A;  4N4G A;  2YEK A;  4LZR A;  5C89 A;  2R0Y A;  5AD3 A;  4N4H A;  3JVJ A;  2F6J A;  5D3T A;  3RCW A;  4QUT A;  5E73 A;  2R10 A;  4QSP A;  3U5L A;  4TZ2 A;  5IGN A;  3VKG A;  4HXS A;  5CQ5 A; 
#chains in the Genus database with same CATH homology
 5I40 A;  4YAX A;  4IOQ A;  4YYD A;  5FE6 A;  5CQ7 A;  5BT4 A;  4YBT A;  4N4I A;  4PY6 A;  4A9L A;  4NUD A;  2YQD A;  5EVA A;  4NS5 A;  2H60 A;  4QSQ A;  5HQ5 A;  5D3P A;  4YYH A;  4CUT A;  5HM0 A;  4Z1Q A;  5FB0 A;  2NXB A;  5HFR A;  3IU5 A;  2YYN A;  2OUO A;  5A5S A;  3DAI A;  5FE7 A;  4A9N A;  4UYG A;  5KTW A;  5EP7 A;  5CTL A;  4NR6 A;  2OSS A;  4FLP A;  4NR4 A;  5I88 A;  4NR7 A;  4TYL A;  5DX4 A;  4UIT A;  4DON A;  4HXR A;  4A9H A;  2L84 A;  4TZ8 A;  3MB3 A;  5LKT A;  3AQA A;  4QBM A;  4Y03 A;  4O7C A;  5G4R A;  4BHW A;  5L96 A;  4NRC A;  4HXM A;  4LYI A;  3IU6 A;  5DW1 A;  4CUU A;  5ENI A;  4QSR A;  5E9L A;  4NR5 A;  5HEL A;  3UV4 A;  5I86 A;  5D3H A;  4YAB A;  4YK0 A;  5BT5 A;  5KTX A;  5HRW A;  5E7D A;  5DKH A;  5A5R A;  5A5N A;  4QSU A;  5EIS A;  4YYN A;  4PCI A;  2G4A A;  4YY6 A;  3HMF A;  5HEN A;  5EWD A;  5IBN A;  5DYU A;  4CUR A;  5FH7 A;  3HMH A;  4QZS A;  5CQ3 A;  4AKN A;  2D82 A;  5FE0 A;  4ZW1 A;  1N72 A;  3SVH A;  5HRX A;  4CFL A;  5DYC A;  4TTE A;  5H1T A;  5I89 A;  5IG6 A;  1F68 A;  5EPB A;  5IGK A;  5ENC A;  4NYV A;  4WIV A;  4QR5 A;  5AME A;  2OO1 A;  4PS5 A;  4E96 A;  5ENJ A;  2L5E A;  3FKM X;  5LJ1 A;  4LZS A;  2I7K A;  5ENF A;  2YEM A;  5E3D A;  5F60 A;  4NQM A;  4NQN A;  5EU1 A;  5A85 A;  2I8N A;  3LJW A;  5CPE A;  3ONI A;  3UVD A;  4X2I A;  4MEN A;  5LVQ A;  5EA1 A;  5F3A A;  5I83 A;  5LKZ A;  4CFK A;  4QST A;  3P1E A;  5IGM A;  4OUF A;  4XY8 A;  5II1 A;  5L8U A;  4Z6I A;  4LR6 A;  5F2P A;  5HRV A;  5II2 A;  4QEW A;  4UIZ A;  4LDF A;  5CP5 A;  4UIV A;  5DFD A;  4QYD A;  4IOO A;  4A9E A;  5KU3 A;  5ENH A;  5HCL A;  4Q0N A;  4F3I A;  4IR4 A;  5LJ2 A;  4Z6H A;  4MR6 A;  4UIY A;  4HXN A;  4YAD A;  2E7O A;  4QY4 A;  5HJC A;  4MR5 A;  5IID A;  5HLS A;  4KCX A;  4O78 A;  5J0D A;  4A9K A;  1JSP B;  5HQ7 A;  4QUU A;  4UYF A;  4NUE A;  4PKL A;  5LUU A;  5F63 A;  5A5Q A;  5FE5 A;  2D9E A;  2GRC A;  4J0S A;  2YDW A;  2N9G A;  4LZ2 A;  4QEV A;  4LYW A;  5FE1 A;  4QC3 A;  5CQT A;  5E9K A;  5D0C A;  4NRA A;  4HBY A;  4MEP A;  5ENE A;  3MQM A;  4N4F A;  4CUQ A;  4YYK A;  3O34 A;  4QSV A;  3K2J A;  4O77 A;  4N3W A;  5CY9 A;  5LKU A;  4YH4 A;  5E3G A;  2RFJ A;  3LXJ A;  4Z93 A;  3UV5 A;  3U5M A;  4QC1 A;  4YAT A;  4XYA A;  5FE8 A;  5CQ8 A;  5EV9 A;  4UYH A;  3UVX A;  5C87 A;  4BW3 A;  5EWV A;  3P1F A;  4XY9 A;  1WUG A;  5F62 A;  5ENG A;  4QNS A;  4UIW A;  4QB3 A;  5EIC A;  1E6I A;  3P1D A;  4O75 A;  4C66 A;  4C67 A;  5D26 A;  4UYE A;  4ALH A;  5E9V A;  4PTB A;  2F6N A;  5FFW A;  5CRM A;  4QSX A;  4HXP A;  5CQ4 A;  4TT4 A;  3U5N A;  5FE3 A;  5D3J A;  4O7F A;  5AD2 A;  4LYS A;  4UYF B;  4WHW A;  5D3L A;  3P1C A;  2RNY A;  3O37 A;  3ZYU A;  4KV4 A;  2E3K A;  5CUB A;  5FFV A;  4YH3 A;  4XUB A;  5DKD A;  4O74 A;  4TU6 A;  5COI A;  3U5P A;  4QR4 A;  5A81 A;  2RI7 A;  4O70 A;  5FH8 A;  2DVR A;  3MB4 A;  2FSA A;  5CGP A;  5DYX A;  5FE4 A;  4CLB A;  3UVW A;  4YYI A;  4HBW A;  3O33 A;  5L98 A;  3DWY A;  3O36 A;  3U5K A;  5A82 A;  4YBM A;  5FG5 A;  5TCM A;  2E7N A;  5LJ0 A;  5CUA A;  3NXB A;  5F1L A;  4O7B A;  5KTU A;  5EGU A;  5DW2 A;  5EM3 A;  4YYJ A;  4NRB A;  4QSW A;  5CS8 A;  4YYM A;  4O72 A;  1X0J A;  4XUA A;  4ZQL A;  4O71 A;  5A7C A;  3S92 A;  4LRG A;  2RS9 B;  3QZV A;  3I3J A;  5EQ1 A;  4OGJ A;  3LQH A;  5CUG A;  2LSP B;  5E9Y A;  5A83 A;  4RVR A;  5KO4 A;  5ENB A;  5D25 A;  3U5O A;  5F36 A;  5DY7 A;  5D3S A;  5C8G A;  3G0L A;  5LVR A;  4UYD A;  4YYG A;  4A9I A;  5DKC A;  3O35 A;  4TQN A;  3AAD A;  4HBX A;  5CQ6 A;  2DKW A;  4PCE A;  5H85 A;  4BW4 A;  4QYL A;  4ALG A;  3MXF A;  5FE2 A;  4CUP A;  4NYW A;  5I7Y A;  2DAT A;  5I80 A;  5AMF A;  5K29 A;  5FB1 A;  2DWW A;  4O7A A;  3SVG A;  5ACY A;  4A9M A;  4BW2 A;  4J3I A;  5CUE A;  3D7C A;  5EWC A;  5FFY A;  3S91 A;  3UW9 A;  3P5O A;  5CQA A;  5F5Z A;  5CU8 A;  5CUC A;  5FG6 A;  5D3R A;  5BT3 A;  5E9I A;  5IGL A;  5ETB A;  4TS8 A;  5FBX A;  5C7N A;  5E9M A;  4J1P A;  4A9J A;  1ZS5 A;  2R0S A;  4NYX A;  2YEL A;  5DLX A;  5TB6 A;  5EPS A;  5JI8 A;  4J0R A;  5E74 A;  4CL9 A;  5I1Q A;  2RO1 A;  5I29 A;  5E0R A;  4QSS A;  5EPR A;  5F1H A;  5DYA A;  3LQI A;  5DFC A;  4HBV A;  4NXJ A;  2RNX A;  4NUC A;  4UIU A;  5D24 A;  3Q2F A;  4HXK A;  4Z1S A;  5DBM A;  5DFB A;  5JWM A;  4BW1 A;  2WP1 A;  5EI4 A;  1JM4 B;  5D3N A;  4QEU A;  4TT6 A;  2KTB B;  2YW5 A;  5G4S A;  5KHM A;  4YC9 A;  5C4Q A;  4HXL A;  4TU4 A;  5ETD A;  2L85 A;  4A9O A;  5L99 A;  5LKX A;  5F25 A;  3MUL A;  3U5J A;  5C85 A;  4MEO A;  5CZG A;  3UV2 A;  4HXO A;  5A5O A;  4IR5 A;  4NR8 A;  3Q2E A;  4NR9 A;  3JVL A;  4TT2 A;  5D7X A;  4KV1 A;  5FDZ A;  4UIX A;  4LC2 A;  2R0V A;  3SVF A;  4IR3 A;  1WUM A;  5CUD A;  3JVK A;  5DLZ A;  5EWW A;  5CRZ A;  3G0J A;  4Q0O A;  5FG4 A;  2DVV A;  4MR4 A;  2DVS A;  5EWH A;  5FE9 A;  4YBS A;  4WHU A;  4OGI A;  2MJV B;  5F61 A;  5CFW A;  5A5P A;  3UVY A;  4MR3 A;  3MUK A;  1EQF A;  4CUS A;  4QR3 A;  5I7X A;  4ZC9 A;  4YY4 A;  5HFQ A;  3LQJ A;  2WP2 A;  3QZT A;  4GPJ A;  5H1U A;  3TLP A;  2RNW A;  3JVM A;  5HEM A;  5H1V A;  4MEQ A;  5EK9 A;  4IOR A;  3GG3 A;  5L8T A;  3HME A;  4O76 A;  2DVQ A;  4IR6 A;  4O7E A;  5FH6 A;  4BJX A;  5HQ6 A;  4A9F A;  5L97 A;  3QZS A;  4N4G A;  2YEK A;  4LZR A;  5C89 A;  2R0Y A;  5AD3 A;  4N4H A;  3JVJ A;  2F6J A;  5D3T A;  3RCW A;  4QUT A;  5E73 A;  2R10 A;  4QSP A;  3U5L A;  4TZ2 A;  5IGN A;  4HXS A;  5CQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...