2RNYA

Complex structures of cbp bromodomain with h4 ack20 peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 32
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rnyA00
3SVFA 4QSWA 4QUUA 4YATA 5EVAA 4J0SA 5DW1A 5DY7A 2RI7A 4O78A 4PCIA 4TTEA 4NYWA 5F62A 3U5NA 5I7YA 2YQDA 4UYGA 5HQ7A 5FE3A 5F36A 4LYIA 4TT6A 5ENIA 4MEPA 2RFJA 4UIVA 3MUKA 4QR3A 5FG4A 2RNYA 5G4RA 5E0RA 3S91A 5F63A 4BW2A 2YELA 4MENA 4QB3A 5CUBA 4IR5A 5K29A 5ENBA 2GRCA 3MULA 4IR3A 4TT2A 4QSQA 4QY4A 3IU6A 4HXNA 4NRBA 5HRVA 5D0CA 4FLPA 5ETDA 2YW5A 1WUGA 4LZ2A 4YC9A 4CL9A 5D3PA 2RNXA 5IBNA 5FDZA 4QSPA 5BT5A 2KTBB 4QSVA 4NR4A 3U5KA 5D7XA 1F68A 5FFWA 5AD2A 4A9EA 5E7DA 2F6JA 5ENGA 5E74A 5KO4A 5F1HA 5CRMA 3TLPA 4A9OA 5EGUA 3DWYA 4YYJA 4UIUA 2OSSA 4A9IA 5FB0A 5L8UA 2L84A 5CTLA 5D3JA 2RNWA 5HFRA 5II1A 5EPBA 4UYHA 5ACYA 5KTUA 3P1DA 5ENHA 4NXJA 5FE6A 4N4IA 5AMFA 5IIDA 5FH8A 2I8NA 5E9VA 5I86A 4J1PA 5HELA 4LC2A 4YK0A 2NXBA 3FKMX 4DONA 5IGMA 1E6IA 4QSTA 5DKCA 5DYUA 3G0JA 5CRZA 5C87A 5HFQA 4XY9A 5LUUA 3Q2FA 4CUTA 5I88A 4Z6IA 4QZSA 3K2JA 4ALHA 4QSRA 4A9HA 5DFBA 3UV5A 4YAXA 2G4AA 4QBMA 4O71A 5FG6A 5H1TA 2F6NA 5II2A 5A5RA 5KHMA 4HXSA 4NYVA 2DWWA 4J0RA 4TZ8A 4ALGA 4A9NA 4LR6A 4E96A 5J0DA 4N4HA 4TYLA 4MR4A 3MB3A 2DKWA 3D7CA 5LKUA 4YYIA 5TCMA 5EP7A 2DVRA 3UVWA 5HRXA 5F2PA 4TU6A 3G0LA 4QNSA 5F25A 4XUBA 5DFCA 5A82A 5KTWA 5E73A 5I89A 4PTBA 4QR4A 2H60A 4QUTA 4BW4A 4LDFA 2RO1A 5IG6A 4HBVA 5E3DA 5DKDA 4ZW1A 5HENA 3U5OA 2OO1A 5I80A 5EV9A 5A5SA 3JVMA 4N3WA 3P1FA 4QSXA 5EA1A 5CZGA 5H1VA 4BW1A 4BHWA 5C8GA 2WP2A 3MXFA 3QZVA 4QSUA 5DKHA 4NQMA 4Z1SA 5DLZA 4UYFB 3P1CA 5FH7A 4IOQA 5EU1A 4KV4A 2D9EA 4XYAA 4NRCA 4O76A 5D3RA 3O33A 5FFYA 3U5JA 4MR3A 4NR5A 4HXPA 4CFKA 4NS5A 5ETBA 4Q0OA 5HLSA 4IORA 5FE8A 4RVRA 3GG3A 4CURA 5JWMA 4HXOA 3IU5A 5A83A 4HXMA 4MR5A 4NR8A 1EQFA 4UYDA 5D3SA 5A7CA 4HBYA 3AQAA 5FE2A 5DYAA 5DFDA 4HXLA 4KV1A 5FE9A 5COIA 3LQJA 1ZS5A 4X2IA 5DW2A 5CUGA 3LJWA 5DYXA 2L5EA 3JVLA 3NXBA 5DX4A 5LVQA 4TZ2A 5D3TA 4HXKA 4BW3A 5ENCA 4CUSA 5C7NA 4O7FA 5D24A 4QYLA 5BT4A 4YBSA 5DYCA 4YH4A 5CUEA 5CUDA 4UIXA 5CUAA 3HMFA 4LYWA 4Z93A 4YYHA 4UIYA 5E3GA 2OUOA 4O75A 2E3KA 5HQ6A 5D3HA 4GPJA 4YYKA 4OUFA 5CS8A 5ENFA 5I1QA 4UYEA 4O7BA 3HMEA 4YYDA 3UVDA 4YADA 4LRGA 4YY6A 5EM3A 4NR6A 5FG5A 5HEMA 5CQ3A 3O36A 5CGPA 4YYNA 5EWVA 5LJ2A 5EWWA 4N4GA 3UW9A 5DLXA 3UVXA 1X0JA 5CQ6A 4WHUA 4TT4A 3SVHA 4NR9A 4CFLA 4QC3A 4HBWA 5EISA 5CQ5A 4C67A 4QR5A 4AKNA 3O35A 5CQ8A 5L98A 4TU4A 5A5NA 5FE4A 4J3IA 5EPSA 4HXRA 4CLBA 4Y03A 5IGNA 4UITA 5L99A 4UIZA 2FSAA 5A5PA 4PKLA 5I29A 4IOOA 5ENEA 5F3AA 4QSSA 5FB1A 4OGIA 4NQNA 4MEOA 5CU8A 4HBXA 3RCWA 2LSPB 3P5OA 4QC1A 2YYNA 5CQAA 3QZTA 5A81A 5E9YA 5C4QA 2N9GA 2D82A 5LVRA 5HRWA 4LYSA 4NUEA 4UIWA 4Q0NA 4UYFA 5D26A 5FE5A 4YY4A 2I7KA 5CQ4A 5TB6A 2DATA 5EWHA 5LJ1A 4WHWA 4A9MA 4C66A 5D3LA 4LZSA 4F3IA 5A5OA 4PS5A 1JSPB 3S92A 4TS8A 2WP1A 5EWCA 1JM4B 5AD3A 4LZRA 4O7EA 5EPRA 4A9JA 5D25A 3HMHA 4Z6HA 5FE1A 5DBMA 4QEVA 4YABA 2L85A 5E9MA 5CQTA 2YEMA 4PY6A 5KTXA 5A5QA 3U5MA 4YBTA 5FE0A 5D3NA 1N72A 3UV2A 5I83A 5HM0A 5E9LA 4NUCA 4O7CA 5L97A 4BJXA 4O70A 2R0YA 4O7AA 3JVKA 4TQNA 3SVGA 5CQ7A 4NUDA 5H85A 5IGLA 5F60A 5FFVA 5IGKA 4KCXA 4XY8A 5LKZA 2R0SA 5CPEA 3QZSA 5I7XA 5HCLA 4NR7A 3O37A 5L96A 5F5ZA 5HQ5A 4QYDA 5LKTA 4QEUA 4MR6A 5C85A 2R0VA 5E9KA 5E9IA 2R10A 4PCEA 4YH3A 4YYMA 4O77A 5CUCA 2YDWA 5F1LA 5G4SA 5CFWA 1WUMA 2DVVA 5I40A 5A85A 4NYXA 3AADA 2DVQA 4YBMA 5FE7A 2RS9B 5AMEA 4NRAA 3ZYUA 3U5PA 3LQIA 5EI4A 3U5LA 4O74A 5CP5A 4IR6A 5EWDA 4CUUA 5EQ1A 4YYGA 3ONIA 2YEKA 5FH6A 4A9LA 3DAIA 3LQHA 4ZC9A 5EK9A 3UV4A 2E7OA 3O34A 4QEWA 5LKXA 5EICA 5ENJA 3UVYA 5C89A 3I3JA 4MEQA 5BT3A 3JVJA 4WIVA 5LJ0A 3P1EA 4OGJA 3LXJA 4CUPA 4A9FA 4IR4A 5F61A 3MQMA 4O72A 2E7NA 4A9KA 4CUQA 5JI8A 5HJCA 3Q2EA 4ZQLA 5L8TA 4Z1QA 4XUAA 5H1UA 2MJVB 4N4FA 2DVSA 5FBXA 5CY9A 3MB4A 5KU3A
chains in the Genus database with same CATH superfamily
3SVFA 4QSWA 4QUUA 4YATA 5EVAA 4J0SA 5DW1A 5DY7A 2RI7A 4O78A 4PCIA 4TTEA 4NYWA 5F62A 3U5NA 5I7YA 2YQDA 4UYGA 5HQ7A 5FE3A 5F36A 4LYIA 4TT6A 5ENIA 4MEPA 2RFJA 4UIVA 3MUKA 4QR3A 5FG4A 2RNYA 5G4RA 5E0RA 3S91A 5F63A 4BW2A 2YELA 4MENA 4QB3A 5CUBA 4IR5A 5K29A 5ENBA 2GRCA 3MULA 4IR3A 4TT2A 4QSQA 4QY4A 3IU6A 4HXNA 4NRBA 5HRVA 5D0CA 4FLPA 5ETDA 2YW5A 1WUGA 4LZ2A 4YC9A 4CL9A 5D3PA 2RNXA 5IBNA 5FDZA 4QSPA 5BT5A 2KTBB 4QSVA 4NR4A 3U5KA 3D1BA 5D7XA 1F68A 5FFWA 5AD2A 4A9EA 5E7DA 2F6JA 5ENGA 5E74A 5KO4A 5F1HA 3D1DA 5CRMA 3TLPA 4A9OA 5EGUA 3DWYA 4YYJA 4UIUA 2OSSA 4A9IA 5FB0A 5L8UA 2L84A 5CTLA 5D3JA 2RNWA 5HFRA 5II1A 5EPBA 4UYHA 5ACYA 5KTUA 3P1DA 5ENHA 4NXJA 5FE6A 4N4IA 5AMFA 5IIDA 5FH8A 2I8NA 5E9VA 5I86A 4J1PA 5HELA 4LC2A 4YK0A 2NXBA 3FKMX 4DONA 5IGMA 1E6IA 4QSTA 5DKCA 5DYUA 3G0JA 5CRZA 5C87A 5HFQA 4XY9A 5LUUA 3Q2FA 4CUTA 5I88A 4Z6IA 4QZSA 3K2JA 4ALHA 4QSRA 4A9HA 5DFBA 3UV5A 4YAXA 2G4AA 4QBMA 4O71A 5FG6A 3VKHA 5H1TA 2F6NA 5II2A 5A5RA 5KHMA 4HXSA 4NYVA 2DWWA 4J0RA 4TZ8A 4ALGA 4A9NA 4LR6A 4E96A 5J0DA 4N4HA 4TYLA 4MR4A 3MB3A 2DKWA 3D7CA 5LKUA 4YYIA 5TCMA 5EP7A 2DVRA 3UVWA 5HRXA 5F2PA 4TU6A 3G0LA 4QNSA 5F25A 4XUBA 5DFCA 5A82A 5KTWA 5E73A 5I89A 4PTBA 4QR4A 2H60A 4QUTA 4BW4A 4LDFA 2RO1A 5IG6A 4HBVA 5E3DA 5DKDA 4ZW1A 5HENA 3U5OA 2OO1A 5I80A 5EV9A 5A5SA 3JVMA 4N3WA 3P1FA 4QSXA 5EA1A 5CZGA 5H1VA 4BW1A 4BHWA 5C8GA 2WP2A 3MXFA 3QZVA 4QSUA 5DKHA 4NQMA 4Z1SA 5DLZA 4UYFB 3P1CA 5FH7A 4IOQA 5EU1A 4KV4A 2D9EA 4XYAA 4NRCA 4O76A 5D3RA 3O33A 5FFYA 3U5JA 4MR3A 4NR5A 4HXPA 4CFKA 4NS5A 5ETBA 4Q0OA 5HLSA 4IORA 5FE8A 4RVRA 3GG3A 4CURA 5JWMA 4HXOA 3IU5A 5A83A 4HXMA 4MR5A 4NR8A 1EQFA 4UYDA 5D3SA 5A7CA 4HBYA 3AQAA 5FE2A 5DYAA 5DFDA 4HXLA 4KV1A 5FE9A 5COIA 3LQJA 1ZS5A 4X2IA 5DW2A 5CUGA 3LJWA 5DYXA 2L5EA 3JVLA 3NXBA 5DX4A 5LVQA 4TZ2A 4AKIA 5D3TA 4HXKA 4BW3A 5ENCA 4CUSA 5C7NA 4O7FA 5D24A 4QYLA 5BT4A 4YBSA 5DYCA 4YH4A 4AI6A 5CUEA 5CUDA 4UIXA 5CUAA 3HMFA 4LYWA 4Z93A 4YYHA 4UIYA 5E3GA 2OUOA 4O75A 2E3KA 5HQ6A 5D3HA 4GPJA 4YYKA 4OUFA 5CS8A 5ENFA 5I1QA 4UYEA 4O7BA 3HMEA 4YYDA 3UVDA 4YADA 4LRGA 4YY6A 5EM3A 4NR6A 5FG5A 5HEMA 5CQ3A 3O36A 5CGPA 4YYNA 5EWVA 5LJ2A 5EWWA 4N4GA 3UW9A 5DLXA 3UVXA 1X0JA 5CQ6A 4WHUA 4TT4A 3SVHA 4NR9A 4CFLA 4QC3A 4HBWA 5EISA 5CQ5A 4C67A 4QR5A 4AKNA 3O35A 5CQ8A 5L98A 4TU4A 2EJNA 5A5NA 5FE4A 4AKHA 4J3IA 5EPSA 4HXRA 4CLBA 4Y03A 5IGNA 4UITA 5L99A 4UIZA 2FSAA 5A5PA 4PKLA 5I29A 4IOOA 5ENEA 5F3AA 4QSSA 5FB1A 4OGIA 4NQNA 4MEOA 5CU8A 4AKGA 4HBXA 3RCWA 2LSPB 3P5OA 4QC1A 2YYNA 5CQAA 3QZTA 5A81A 5E9YA 5C4QA 2N9GA 2D82A 5LVRA 5HRWA 4LYSA 4NUEA 4UIWA 4Q0NA 4UYFA 5D26A 5FE5A 4YY4A 2I7KA 5CQ4A 5TB6A 2DATA 5EWHA 5LJ1A 4WHWA 4A9MA 4C66A 5D3LA 4LZSA 4F3IA 5A5OA 4PS5A 1JSPB 3S92A 4TS8A 2WP1A 5EWCA 1JM4B 5AD3A 1PUOA 4LZRA 4O7EA 5EPRA 4A9JA 5D25A 3HMHA 4Z6HA 5FE1A 5DBMA 4QEVA 4YABA 2L85A 5E9MA 5CQTA 2YEMA 4PY6A 5KTXA 5A5QA 3U5MA 4YBTA 5FE0A 5D3NA 1N72A 3UV2A 5I83A 5HM0A 5E9LA 4NUCA 4O7CA 5L97A 4BJXA 4O70A 2R0YA 4O7AA 3JVKA 4TQNA 3SVGA 5CQ7A 4NUDA 5H85A 5IGLA 5F60A 5FFVA 5IGKA 3VKGA 4KCXA 4XY8A 5LKZA 2R0SA 5CPEA 3QZSA 5I7XA 5HCLA 4NR7A 1ZKRA 3O37A 5L96A 5F5ZA 5HQ5A 4QYDA 5LKTA 4QEUA 4MR6A 5C85A 2R0VA 5E9KA 5E9IA 2R10A 4PCEA 4YH3A 4YYMA 4O77A 5CUCA 2YDWA 5F1LA 5G4SA 5CFWA 1WUMA 2DVVA 5I40A 5A85A 4NYXA 3AADA 2DVQA 4YBMA 5FE7A 2RS9B 5AMEA 4NRAA 3ZYUA 3U5PA 3LQIA 5EI4A 3U5LA 4O74A 5CP5A 4IR6A 5EWDA 4CUUA 5EQ1A 4YYGA 3ONIA 2YEKA 5FH6A 4A9LA 3DAIA 3LQHA 4ZC9A 5EK9A 3UV4A 2E7OA 3O34A 4QEWA 5LKXA 5EICA 5ENJA 3UVYA 5C89A 3I3JA 4MEQA 5BT3A 3ERRA 3JVJA 4WIVA 5LJ0A 3P1EA 4OGJA 3LXJA 4CUPA 4A9FA 4IR4A 5F61A 3MQMA 4O72A 2E7NA 4A9KA 4CUQA 5JI8A 5HJCA 3Q2EA 4ZQLA 5L8TA 4Z1QA 4XUAA 5H1UA 2MJVB 4N4FA 2DVSA 5FBXA 5CY9A 3MB4A 5KU3A
chains in the Genus database with same CATH topology
3SVFA 4QSWA 4QUUA 4YATA 5EVAA 4J0SA 5DW1A 5DY7A 2RI7A 4O78A 4PCIA 4TTEA 4NYWA 5F62A 3U5NA 5I7YA 2YQDA 4UYGA 5HQ7A 5FE3A 5F36A 4LYIA 4TT6A 5ENIA 4MEPA 2RFJA 4UIVA 3MUKA 4QR3A 5FG4A 2RNYA 5G4RA 5E0RA 3S91A 5F63A 4BW2A 2YELA 4MENA 4QB3A 5CUBA 4IR5A 5K29A 5ENBA 2GRCA 3MULA 4IR3A 4TT2A 4QSQA 4QY4A 3IU6A 4HXNA 4NRBA 5HRVA 5D0CA 4FLPA 5ETDA 2YW5A 1WUGA 4LZ2A 4YC9A 4CL9A 5D3PA 2RNXA 5IBNA 5FDZA 4QSPA 5BT5A 2KTBB 4QSVA 4NR4A 3U5KA 5D7XA 1F68A 5FFWA 5AD2A 4A9EA 5E7DA 2F6JA 5ENGA 5E74A 5KO4A 5F1HA 5CRMA 3TLPA 4A9OA 5EGUA 3DWYA 4YYJA 4UIUA 2OSSA 4A9IA 5FB0A 5L8UA 2L84A 5CTLA 5D3JA 2RNWA 5HFRA 5II1A 5EPBA 4UYHA 5ACYA 5KTUA 3P1DA 5ENHA 4NXJA 5FE6A 4N4IA 5AMFA 5IIDA 5FH8A 2I8NA 5E9VA 5I86A 4J1PA 5HELA 4LC2A 4YK0A 2NXBA 3FKMX 4DONA 5IGMA 1E6IA 4QSTA 5DKCA 5DYUA 3G0JA 5CRZA 5C87A 5HFQA 4XY9A 5LUUA 3Q2FA 4CUTA 5I88A 4Z6IA 4QZSA 3K2JA 4ALHA 4QSRA 4A9HA 5DFBA 3UV5A 4YAXA 2G4AA 4QBMA 4O71A 5FG6A 5H1TA 2F6NA 5II2A 5A5RA 5KHMA 4HXSA 4NYVA 2DWWA 4J0RA 4TZ8A 4ALGA 4A9NA 4LR6A 4E96A 5J0DA 4N4HA 4TYLA 4MR4A 3MB3A 2DKWA 3D7CA 5LKUA 4YYIA 5TCMA 5EP7A 2DVRA 3UVWA 5HRXA 5F2PA 4TU6A 3G0LA 4QNSA 5F25A 4XUBA 5DFCA 5A82A 5KTWA 5E73A 5I89A 4PTBA 4QR4A 2H60A 4QUTA 4BW4A 4LDFA 2RO1A 5IG6A 4HBVA 5E3DA 5DKDA 4ZW1A 5HENA 3U5OA 2OO1A 5I80A 5EV9A 5A5SA 3JVMA 4N3WA 3P1FA 4QSXA 5EA1A 5CZGA 5H1VA 4BW1A 4BHWA 5C8GA 2WP2A 3MXFA 3QZVA 4QSUA 5DKHA 4NQMA 4Z1SA 5DLZA 4UYFB 3P1CA 5FH7A 4IOQA 5EU1A 4KV4A 2D9EA 4XYAA 4NRCA 4O76A 5D3RA 3O33A 5FFYA 3U5JA 4MR3A 4NR5A 4HXPA 4CFKA 4NS5A 5ETBA 4Q0OA 5HLSA 4IORA 5FE8A 4RVRA 3GG3A 4CURA 5JWMA 4HXOA 3IU5A 5A83A 4HXMA 4MR5A 4NR8A 1EQFA 4UYDA 5D3SA 5A7CA 4HBYA 3AQAA 5FE2A 5DYAA 5DFDA 4HXLA 4KV1A 5FE9A 5COIA 3LQJA 1ZS5A 4X2IA 5DW2A 5CUGA 3LJWA 5DYXA 2L5EA 3JVLA 3NXBA 5DX4A 5LVQA 4TZ2A 5D3TA 4HXKA 4BW3A 5ENCA 4CUSA 5C7NA 4O7FA 5D24A 4QYLA 5BT4A 4YBSA 5DYCA 4YH4A 5CUEA 5CUDA 4UIXA 5CUAA 3HMFA 4LYWA 4Z93A 4YYHA 4UIYA 5E3GA 2OUOA 4O75A 2E3KA 5HQ6A 5D3HA 4GPJA 4YYKA 4OUFA 5CS8A 5ENFA 5I1QA 4UYEA 4O7BA 3HMEA 4YYDA 3UVDA 4YADA 4LRGA 4YY6A 5EM3A 4NR6A 5FG5A 5HEMA 5CQ3A 3O36A 5CGPA 4YYNA 5EWVA 5LJ2A 5EWWA 4N4GA 3UW9A 5DLXA 3UVXA 1X0JA 5CQ6A 4WHUA 4TT4A 3SVHA 4NR9A 4CFLA 4QC3A 4HBWA 5EISA 5CQ5A 4C67A 4QR5A 4AKNA 3O35A 5CQ8A 5L98A 4TU4A 5A5NA 5FE4A 4J3IA 5EPSA 4HXRA 4CLBA 4Y03A 5IGNA 4UITA 5L99A 4UIZA 2FSAA 5A5PA 4PKLA 5I29A 4IOOA 5ENEA 5F3AA 4QSSA 5FB1A 4OGIA 4NQNA 4MEOA 5CU8A 4HBXA 3RCWA 2LSPB 3P5OA 4QC1A 2YYNA 5CQAA 3QZTA 5A81A 5E9YA 5C4QA 2N9GA 2D82A 5LVRA 5HRWA 4LYSA 4NUEA 4UIWA 4Q0NA 4UYFA 5D26A 5FE5A 4YY4A 2I7KA 5CQ4A 5TB6A 2DATA 5EWHA 5LJ1A 4WHWA 4A9MA 4C66A 5D3LA 4LZSA 4F3IA 5A5OA 4PS5A 1JSPB 3S92A 4TS8A 2WP1A 5EWCA 1JM4B 5AD3A 4LZRA 4O7EA 5EPRA 4A9JA 5D25A 3HMHA 4Z6HA 5FE1A 5DBMA 4QEVA 4YABA 2L85A 5E9MA 5CQTA 2YEMA 4PY6A 5KTXA 5A5QA 3U5MA 4YBTA 5FE0A 5D3NA 1N72A 3UV2A 5I83A 5HM0A 5E9LA 4NUCA 4O7CA 5L97A 4BJXA 4O70A 2R0YA 4O7AA 3JVKA 4TQNA 3SVGA 5CQ7A 4NUDA 5H85A 5IGLA 5F60A 5FFVA 5IGKA 4KCXA 4XY8A 5LKZA 2R0SA 5CPEA 3QZSA 5I7XA 5HCLA 4NR7A 3O37A 5L96A 5F5ZA 5HQ5A 4QYDA 5LKTA 4QEUA 4MR6A 5C85A 2R0VA 5E9KA 5E9IA 2R10A 4PCEA 4YH3A 4YYMA 4O77A 5CUCA 2YDWA 5F1LA 5G4SA 5CFWA 1WUMA 2DVVA 5I40A 5A85A 4NYXA 3AADA 2DVQA 4YBMA 5FE7A 2RS9B 5AMEA 4NRAA 3ZYUA 3U5PA 3LQIA 5EI4A 3U5LA 4O74A 5CP5A 4IR6A 5EWDA 4CUUA 5EQ1A 4YYGA 3ONIA 2YEKA 5FH6A 4A9LA 3DAIA 3LQHA 4ZC9A 5EK9A 3UV4A 2E7OA 3O34A 4QEWA 5LKXA 5EICA 5ENJA 3UVYA 5C89A 3I3JA 4MEQA 5BT3A 3JVJA 4WIVA 5LJ0A 3P1EA 4OGJA 3LXJA 4CUPA 4A9FA 4IR4A 5F61A 3MQMA 4O72A 2E7NA 4A9KA 4CUQA 5JI8A 5HJCA 3Q2EA 4ZQLA 5L8TA 4Z1QA 4XUAA 5H1UA 2MJVB 4N4FA 2DVSA 5FBXA 5CY9A 3MB4A 5KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVF A;  4QSW A;  4QUU A;  4YAT A;  5EVA A;  4J0S A;  5DW1 A;  5DY7 A;  2RI7 A;  4O78 A;  4PCI A;  4TTE A;  4NYW A;  5F62 A;  3U5N A;  5I7Y A;  2YQD A;  4UYG A;  5HQ7 A;  5FE3 A;  5F36 A;  4LYI A;  4TT6 A;  5ENI A;  4MEP A;  2RFJ A;  4UIV A;  3MUK A;  4QR3 A;  5FG4 A;  2RNY A;  5G4R A;  5E0R A;  3S91 A;  5F63 A;  4BW2 A;  2YEL A;  4MEN A;  4QB3 A;  5CUB A;  4IR5 A;  5K29 A;  5ENB A;  2GRC A;  3MUL A;  4IR3 A;  4TT2 A;  4QSQ A;  4QY4 A;  3IU6 A;  4HXN A;  4NRB A;  5HRV A;  5D0C A;  4FLP A;  5ETD A;  2YW5 A;  1WUG A;  4LZ2 A;  4YC9 A;  4CL9 A;  5D3P A;  2RNX A;  5IBN A;  5FDZ A;  4QSP A;  5BT5 A;  2KTB B;  4QSV A;  4NR4 A;  3U5K A;  5D7X A;  1F68 A;  5FFW A;  5AD2 A;  4A9E A;  5E7D A;  2F6J A;  5ENG A;  5E74 A;  5KO4 A;  5F1H A;  5CRM A;  3TLP A;  4A9O A;  5EGU A;  3DWY A;  4YYJ A;  4UIU A;  2OSS A;  4A9I A;  5FB0 A;  5L8U A;  2L84 A;  5CTL A;  5D3J A;  2RNW A;  5HFR A;  5II1 A;  5EPB A;  4UYH A;  5ACY A;  5KTU A;  3P1D A;  5ENH A;  4NXJ A;  5FE6 A;  4N4I A;  5AMF A;  5IID A;  5FH8 A;  2I8N A;  5E9V A;  5I86 A;  4J1P A;  5HEL A;  4LC2 A;  4YK0 A;  2NXB A;  3FKM X;  4DON A;  5IGM A;  1E6I A;  4QST A;  5DKC A;  5DYU A;  3G0J A;  5CRZ A;  5C87 A;  5HFQ A;  4XY9 A;  5LUU A;  3Q2F A;  4CUT A;  5I88 A;  4Z6I A;  4QZS A;  3K2J A;  4ALH A;  4QSR A;  4A9H A;  5DFB A;  3UV5 A;  4YAX A;  2G4A A;  4QBM A;  4O71 A;  5FG6 A;  5H1T A;  2F6N A;  5II2 A;  5A5R A;  5KHM A;  4HXS A;  4NYV A;  2DWW A;  4J0R A;  4TZ8 A;  4ALG A;  4A9N A;  4LR6 A;  4E96 A;  5J0D A;  4N4H A;  4TYL A;  4MR4 A;  3MB3 A;  2DKW A;  3D7C A;  5LKU A;  4YYI A;  5TCM A;  5EP7 A;  2DVR A;  3UVW A;  5HRX A;  5F2P A;  4TU6 A;  3G0L A;  4QNS A;  5F25 A;  4XUB A;  5DFC A;  5A82 A;  5KTW A;  5E73 A;  5I89 A;  4PTB A;  4QR4 A;  2H60 A;  4QUT A;  4BW4 A;  4LDF A;  2RO1 A;  5IG6 A;  4HBV A;  5E3D A;  5DKD A;  4ZW1 A;  5HEN A;  3U5O A;  2OO1 A;  5I80 A;  5EV9 A;  5A5S A;  3JVM A;  4N3W A;  3P1F A;  4QSX A;  5EA1 A;  5CZG A;  5H1V A;  4BW1 A;  4BHW A;  5C8G A;  2WP2 A;  3MXF A;  3QZV A;  4QSU A;  5DKH A;  4NQM A;  4Z1S A;  5DLZ A;  4UYF B;  3P1C A;  5FH7 A;  4IOQ A;  5EU1 A;  4KV4 A;  2D9E A;  4XYA A;  4NRC A;  4O76 A;  5D3R A;  3O33 A;  5FFY A;  3U5J A;  4MR3 A;  4NR5 A;  4HXP A;  4CFK A;  4NS5 A;  5ETB A;  4Q0O A;  5HLS A;  4IOR A;  5FE8 A;  4RVR A;  3GG3 A;  4CUR A;  5JWM A;  4HXO A;  3IU5 A;  5A83 A;  4HXM A;  4MR5 A;  4NR8 A;  1EQF A;  4UYD A;  5D3S A;  5A7C A;  4HBY A;  3AQA A;  5FE2 A;  5DYA A;  5DFD A;  4HXL A;  4KV1 A;  5FE9 A;  5COI A;  3LQJ A;  1ZS5 A;  4X2I A;  5DW2 A;  5CUG A;  3LJW A;  5DYX A;  2L5E A;  3JVL A;  3NXB A;  5DX4 A;  5LVQ A;  4TZ2 A;  5D3T A;  4HXK A;  4BW3 A;  5ENC A;  4CUS A;  5C7N A;  4O7F A;  5D24 A;  4QYL A;  5BT4 A;  4YBS A;  5DYC A;  4YH4 A;  5CUE A;  5CUD A;  4UIX A;  5CUA A;  3HMF A;  4LYW A;  4Z93 A;  4YYH A;  4UIY A;  5E3G A;  2OUO A;  4O75 A;  2E3K A;  5HQ6 A;  5D3H A;  4GPJ A;  4YYK A;  4OUF A;  5CS8 A;  5ENF A;  5I1Q A;  4UYE A;  4O7B A;  3HME A;  4YYD A;  3UVD A;  4YAD A;  4LRG A;  4YY6 A;  5EM3 A;  4NR6 A;  5FG5 A;  5HEM A;  5CQ3 A;  3O36 A;  5CGP A;  4YYN A;  5EWV A;  5LJ2 A;  5EWW A;  4N4G A;  3UW9 A;  5DLX A;  3UVX A;  1X0J A;  5CQ6 A;  4WHU A;  4TT4 A;  3SVH A;  4NR9 A;  4CFL A;  4QC3 A;  4HBW A;  5EIS A;  5CQ5 A;  4C67 A;  4QR5 A;  4AKN A;  3O35 A;  5CQ8 A;  5L98 A;  4TU4 A;  5A5N A;  5FE4 A;  4J3I A;  5EPS A;  4HXR A;  4CLB A;  4Y03 A;  5IGN A;  4UIT A;  5L99 A;  4UIZ A;  2FSA A;  5A5P A;  4PKL A;  5I29 A;  4IOO A;  5ENE A;  5F3A A;  4QSS A;  5FB1 A;  4OGI A;  4NQN A;  4MEO A;  5CU8 A;  4HBX A;  3RCW A;  2LSP B;  3P5O A;  4QC1 A;  2YYN A;  5CQA A;  3QZT A;  5A81 A;  5E9Y A;  5C4Q A;  2N9G A;  2D82 A;  5LVR A;  5HRW A;  4LYS A;  4NUE A;  4UIW A;  4Q0N A;  4UYF A;  5D26 A;  5FE5 A;  4YY4 A;  2I7K A;  5CQ4 A;  5TB6 A;  2DAT A;  5EWH A;  5LJ1 A;  4WHW A;  4A9M A;  4C66 A;  5D3L A;  4LZS A;  4F3I A;  5A5O A;  4PS5 A;  1JSP B;  3S92 A;  4TS8 A;  2WP1 A;  5EWC A;  1JM4 B;  5AD3 A;  4LZR A;  4O7E A;  5EPR A;  4A9J A;  5D25 A;  3HMH A;  4Z6H A;  5FE1 A;  5DBM A;  4QEV A;  4YAB A;  2L85 A;  5E9M A;  5CQT A;  2YEM A;  4PY6 A;  5KTX A;  5A5Q A;  3U5M A;  4YBT A;  5FE0 A;  5D3N A;  1N72 A;  3UV2 A;  5I83 A;  5HM0 A;  5E9L A;  4NUC A;  4O7C A;  5L97 A;  4BJX A;  4O70 A;  2R0Y A;  4O7A A;  3JVK A;  4TQN A;  3SVG A;  5CQ7 A;  4NUD A;  5H85 A;  5IGL A;  5F60 A;  5FFV A;  5IGK A;  4KCX A;  4XY8 A;  5LKZ A;  2R0S A;  5CPE A;  3QZS A;  5I7X A;  5HCL A;  4NR7 A;  3O37 A;  5L96 A;  5F5Z A;  5HQ5 A;  4QYD A;  5LKT A;  4QEU A;  4MR6 A;  5C85 A;  2R0V A;  5E9K A;  5E9I A;  2R10 A;  4PCE A;  4YH3 A;  4YYM A;  4O77 A;  5CUC A;  2YDW A;  5F1L A;  5G4S A;  5CFW A;  1WUM A;  2DVV A;  5I40 A;  5A85 A;  4NYX A;  3AAD A;  2DVQ A;  4YBM A;  5FE7 A;  2RS9 B;  5AME A;  4NRA A;  3ZYU A;  3U5P A;  3LQI A;  5EI4 A;  3U5L A;  4O74 A;  5CP5 A;  4IR6 A;  5EWD A;  4CUU A;  5EQ1 A;  4YYG A;  3ONI A;  2YEK A;  5FH6 A;  4A9L A;  3DAI A;  3LQH A;  4ZC9 A;  5EK9 A;  3UV4 A;  2E7O A;  3O34 A;  4QEW A;  5LKX A;  5EIC A;  5ENJ A;  3UVY A;  5C89 A;  3I3J A;  4MEQ A;  5BT3 A;  3JVJ A;  4WIV A;  5LJ0 A;  3P1E A;  4OGJ A;  3LXJ A;  4CUP A;  4A9F A;  4IR4 A;  5F61 A;  3MQM A;  4O72 A;  2E7N A;  4A9K A;  4CUQ A;  5JI8 A;  5HJC A;  3Q2E A;  4ZQL A;  5L8T A;  4Z1Q A;  4XUA A;  5H1U A;  2MJV B;  4N4F A;  2DVS A;  5FBX A;  5CY9 A;  3MB4 A;  5KU3 A; 
#chains in the Genus database with same CATH topology
 3SVF A;  4QSW A;  4QUU A;  4YAT A;  5EVA A;  4J0S A;  5DW1 A;  5DY7 A;  2RI7 A;  4O78 A;  4PCI A;  4TTE A;  4NYW A;  5F62 A;  3U5N A;  5I7Y A;  2YQD A;  4UYG A;  5HQ7 A;  5FE3 A;  5F36 A;  4LYI A;  4TT6 A;  5ENI A;  4MEP A;  2RFJ A;  4UIV A;  3MUK A;  4QR3 A;  5FG4 A;  2RNY A;  5G4R A;  5E0R A;  3S91 A;  5F63 A;  4BW2 A;  2YEL A;  4MEN A;  4QB3 A;  5CUB A;  4IR5 A;  5K29 A;  5ENB A;  2GRC A;  3MUL A;  4IR3 A;  4TT2 A;  4QSQ A;  4QY4 A;  3IU6 A;  4HXN A;  4NRB A;  5HRV A;  5D0C A;  4FLP A;  5ETD A;  2YW5 A;  1WUG A;  4LZ2 A;  4YC9 A;  4CL9 A;  5D3P A;  2RNX A;  5IBN A;  5FDZ A;  4QSP A;  5BT5 A;  2KTB B;  4QSV A;  4NR4 A;  3U5K A;  3D1B A;  5D7X A;  1F68 A;  5FFW A;  5AD2 A;  4A9E A;  5E7D A;  2F6J A;  5ENG A;  5E74 A;  5KO4 A;  5F1H A;  3D1D A;  5CRM A;  3TLP A;  4A9O A;  5EGU A;  3DWY A;  4YYJ A;  4UIU A;  2OSS A;  4A9I A;  5FB0 A;  5L8U A;  2L84 A;  5CTL A;  5D3J A;  2RNW A;  5HFR A;  5II1 A;  5EPB A;  4UYH A;  5ACY A;  5KTU A;  3P1D A;  5ENH A;  4NXJ A;  5FE6 A;  4N4I A;  5AMF A;  5IID A;  5FH8 A;  2I8N A;  5E9V A;  5I86 A;  4J1P A;  5HEL A;  4LC2 A;  4YK0 A;  2NXB A;  3FKM X;  4DON A;  5IGM A;  1E6I A;  4QST A;  5DKC A;  5DYU A;  3G0J A;  5CRZ A;  5C87 A;  5HFQ A;  4XY9 A;  5LUU A;  3Q2F A;  4CUT A;  5I88 A;  4Z6I A;  4QZS A;  3K2J A;  4ALH A;  4QSR A;  4A9H A;  5DFB A;  3UV5 A;  4YAX A;  2G4A A;  4QBM A;  4O71 A;  5FG6 A;  3VKH A;  5H1T A;  2F6N A;  5II2 A;  5A5R A;  5KHM A;  4HXS A;  4NYV A;  2DWW A;  4J0R A;  4TZ8 A;  4ALG A;  4A9N A;  4LR6 A;  4E96 A;  5J0D A;  4N4H A;  4TYL A;  4MR4 A;  3MB3 A;  2DKW A;  3D7C A;  5LKU A;  4YYI A;  5TCM A;  5EP7 A;  2DVR A;  3UVW A;  5HRX A;  5F2P A;  4TU6 A;  3G0L A;  4QNS A;  5F25 A;  4XUB A;  5DFC A;  5A82 A;  5KTW A;  5E73 A;  5I89 A;  4PTB A;  4QR4 A;  2H60 A;  4QUT A;  4BW4 A;  4LDF A;  2RO1 A;  5IG6 A;  4HBV A;  5E3D A;  5DKD A;  4ZW1 A;  5HEN A;  3U5O A;  2OO1 A;  5I80 A;  5EV9 A;  5A5S A;  3JVM A;  4N3W A;  3P1F A;  4QSX A;  5EA1 A;  5CZG A;  5H1V A;  4BW1 A;  4BHW A;  5C8G A;  2WP2 A;  3MXF A;  3QZV A;  4QSU A;  5DKH A;  4NQM A;  4Z1S A;  5DLZ A;  4UYF B;  3P1C A;  5FH7 A;  4IOQ A;  5EU1 A;  4KV4 A;  2D9E A;  4XYA A;  4NRC A;  4O76 A;  5D3R A;  3O33 A;  5FFY A;  3U5J A;  4MR3 A;  4NR5 A;  4HXP A;  4CFK A;  4NS5 A;  5ETB A;  4Q0O A;  5HLS A;  4IOR A;  5FE8 A;  4RVR A;  3GG3 A;  4CUR A;  5JWM A;  4HXO A;  3IU5 A;  5A83 A;  4HXM A;  4MR5 A;  4NR8 A;  1EQF A;  4UYD A;  5D3S A;  5A7C A;  4HBY A;  3AQA A;  5FE2 A;  5DYA A;  5DFD A;  4HXL A;  4KV1 A;  5FE9 A;  5COI A;  3LQJ A;  1ZS5 A;  4X2I A;  5DW2 A;  5CUG A;  3LJW A;  5DYX A;  2L5E A;  3JVL A;  3NXB A;  5DX4 A;  5LVQ A;  4TZ2 A;  4AKI A;  5D3T A;  4HXK A;  4BW3 A;  5ENC A;  4CUS A;  5C7N A;  4O7F A;  5D24 A;  4QYL A;  5BT4 A;  4YBS A;  5DYC A;  4YH4 A;  4AI6 A;  5CUE A;  5CUD A;  4UIX A;  5CUA A;  3HMF A;  4LYW A;  4Z93 A;  4YYH A;  4UIY A;  5E3G A;  2OUO A;  4O75 A;  2E3K A;  5HQ6 A;  5D3H A;  4GPJ A;  4YYK A;  4OUF A;  5CS8 A;  5ENF A;  5I1Q A;  4UYE A;  4O7B A;  3HME A;  4YYD A;  3UVD A;  4YAD A;  4LRG A;  4YY6 A;  5EM3 A;  4NR6 A;  5FG5 A;  5HEM A;  5CQ3 A;  3O36 A;  5CGP A;  4YYN A;  5EWV A;  5LJ2 A;  5EWW A;  4N4G A;  3UW9 A;  5DLX A;  3UVX A;  1X0J A;  5CQ6 A;  4WHU A;  4TT4 A;  3SVH A;  4NR9 A;  4CFL A;  4QC3 A;  4HBW A;  5EIS A;  5CQ5 A;  4C67 A;  4QR5 A;  4AKN A;  3O35 A;  5CQ8 A;  5L98 A;  4TU4 A;  2EJN A;  5A5N A;  5FE4 A;  4AKH A;  4J3I A;  5EPS A;  4HXR A;  4CLB A;  4Y03 A;  5IGN A;  4UIT A;  5L99 A;  4UIZ A;  2FSA A;  5A5P A;  4PKL A;  5I29 A;  4IOO A;  5ENE A;  5F3A A;  4QSS A;  5FB1 A;  4OGI A;  4NQN A;  4MEO A;  5CU8 A;  4AKG A;  4HBX A;  3RCW A;  2LSP B;  3P5O A;  4QC1 A;  2YYN A;  5CQA A;  3QZT A;  5A81 A;  5E9Y A;  5C4Q A;  2N9G A;  2D82 A;  5LVR A;  5HRW A;  4LYS A;  4NUE A;  4UIW A;  4Q0N A;  4UYF A;  5D26 A;  5FE5 A;  4YY4 A;  2I7K A;  5CQ4 A;  5TB6 A;  2DAT A;  5EWH A;  5LJ1 A;  4WHW A;  4A9M A;  4C66 A;  5D3L A;  4LZS A;  4F3I A;  5A5O A;  4PS5 A;  1JSP B;  3S92 A;  4TS8 A;  2WP1 A;  5EWC A;  1JM4 B;  5AD3 A;  1PUO A;  4LZR A;  4O7E A;  5EPR A;  4A9J A;  5D25 A;  3HMH A;  4Z6H A;  5FE1 A;  5DBM A;  4QEV A;  4YAB A;  2L85 A;  5E9M A;  5CQT A;  2YEM A;  4PY6 A;  5KTX A;  5A5Q A;  3U5M A;  4YBT A;  5FE0 A;  5D3N A;  1N72 A;  3UV2 A;  5I83 A;  5HM0 A;  5E9L A;  4NUC A;  4O7C A;  5L97 A;  4BJX A;  4O70 A;  2R0Y A;  4O7A A;  3JVK A;  4TQN A;  3SVG A;  5CQ7 A;  4NUD A;  5H85 A;  5IGL A;  5F60 A;  5FFV A;  5IGK A;  3VKG A;  4KCX A;  4XY8 A;  5LKZ A;  2R0S A;  5CPE A;  3QZS A;  5I7X A;  5HCL A;  4NR7 A;  1ZKR A;  3O37 A;  5L96 A;  5F5Z A;  5HQ5 A;  4QYD A;  5LKT A;  4QEU A;  4MR6 A;  5C85 A;  2R0V A;  5E9K A;  5E9I A;  2R10 A;  4PCE A;  4YH3 A;  4YYM A;  4O77 A;  5CUC A;  2YDW A;  5F1L A;  5G4S A;  5CFW A;  1WUM A;  2DVV A;  5I40 A;  5A85 A;  4NYX A;  3AAD A;  2DVQ A;  4YBM A;  5FE7 A;  2RS9 B;  5AME A;  4NRA A;  3ZYU A;  3U5P A;  3LQI A;  5EI4 A;  3U5L A;  4O74 A;  5CP5 A;  4IR6 A;  5EWD A;  4CUU A;  5EQ1 A;  4YYG A;  3ONI A;  2YEK A;  5FH6 A;  4A9L A;  3DAI A;  3LQH A;  4ZC9 A;  5EK9 A;  3UV4 A;  2E7O A;  3O34 A;  4QEW A;  5LKX A;  5EIC A;  5ENJ A;  3UVY A;  5C89 A;  3I3J A;  4MEQ A;  5BT3 A;  3ERR A;  3JVJ A;  4WIV A;  5LJ0 A;  3P1E A;  4OGJ A;  3LXJ A;  4CUP A;  4A9F A;  4IR4 A;  5F61 A;  3MQM A;  4O72 A;  2E7N A;  4A9K A;  4CUQ A;  5JI8 A;  5HJC A;  3Q2E A;  4ZQL A;  5L8T A;  4Z1Q A;  4XUA A;  5H1U A;  2MJV B;  4N4F A;  2DVS A;  5FBX A;  5CY9 A;  3MB4 A;  5KU3 A; 
#chains in the Genus database with same CATH homology
 3SVF A;  4QSW A;  4QUU A;  4YAT A;  5EVA A;  4J0S A;  5DW1 A;  5DY7 A;  2RI7 A;  4O78 A;  4PCI A;  4TTE A;  4NYW A;  5F62 A;  3U5N A;  5I7Y A;  2YQD A;  4UYG A;  5HQ7 A;  5FE3 A;  5F36 A;  4LYI A;  4TT6 A;  5ENI A;  4MEP A;  2RFJ A;  4UIV A;  3MUK A;  4QR3 A;  5FG4 A;  2RNY A;  5G4R A;  5E0R A;  3S91 A;  5F63 A;  4BW2 A;  2YEL A;  4MEN A;  4QB3 A;  5CUB A;  4IR5 A;  5K29 A;  5ENB A;  2GRC A;  3MUL A;  4IR3 A;  4TT2 A;  4QSQ A;  4QY4 A;  3IU6 A;  4HXN A;  4NRB A;  5HRV A;  5D0C A;  4FLP A;  5ETD A;  2YW5 A;  1WUG A;  4LZ2 A;  4YC9 A;  4CL9 A;  5D3P A;  2RNX A;  5IBN A;  5FDZ A;  4QSP A;  5BT5 A;  2KTB B;  4QSV A;  4NR4 A;  3U5K A;  5D7X A;  1F68 A;  5FFW A;  5AD2 A;  4A9E A;  5E7D A;  2F6J A;  5ENG A;  5E74 A;  5KO4 A;  5F1H A;  5CRM A;  3TLP A;  4A9O A;  5EGU A;  3DWY A;  4YYJ A;  4UIU A;  2OSS A;  4A9I A;  5FB0 A;  5L8U A;  2L84 A;  5CTL A;  5D3J A;  2RNW A;  5HFR A;  5II1 A;  5EPB A;  4UYH A;  5ACY A;  5KTU A;  3P1D A;  5ENH A;  4NXJ A;  5FE6 A;  4N4I A;  5AMF A;  5IID A;  5FH8 A;  2I8N A;  5E9V A;  5I86 A;  4J1P A;  5HEL A;  4LC2 A;  4YK0 A;  2NXB A;  3FKM X;  4DON A;  5IGM A;  1E6I A;  4QST A;  5DKC A;  5DYU A;  3G0J A;  5CRZ A;  5C87 A;  5HFQ A;  4XY9 A;  5LUU A;  3Q2F A;  4CUT A;  5I88 A;  4Z6I A;  4QZS A;  3K2J A;  4ALH A;  4QSR A;  4A9H A;  5DFB A;  3UV5 A;  4YAX A;  2G4A A;  4QBM A;  4O71 A;  5FG6 A;  5H1T A;  2F6N A;  5II2 A;  5A5R A;  5KHM A;  4HXS A;  4NYV A;  2DWW A;  4J0R A;  4TZ8 A;  4ALG A;  4A9N A;  4LR6 A;  4E96 A;  5J0D A;  4N4H A;  4TYL A;  4MR4 A;  3MB3 A;  2DKW A;  3D7C A;  5LKU A;  4YYI A;  5TCM A;  5EP7 A;  2DVR A;  3UVW A;  5HRX A;  5F2P A;  4TU6 A;  3G0L A;  4QNS A;  5F25 A;  4XUB A;  5DFC A;  5A82 A;  5KTW A;  5E73 A;  5I89 A;  4PTB A;  4QR4 A;  2H60 A;  4QUT A;  4BW4 A;  4LDF A;  2RO1 A;  5IG6 A;  4HBV A;  5E3D A;  5DKD A;  4ZW1 A;  5HEN A;  3U5O A;  2OO1 A;  5I80 A;  5EV9 A;  5A5S A;  3JVM A;  4N3W A;  3P1F A;  4QSX A;  5EA1 A;  5CZG A;  5H1V A;  4BW1 A;  4BHW A;  5C8G A;  2WP2 A;  3MXF A;  3QZV A;  4QSU A;  5DKH A;  4NQM A;  4Z1S A;  5DLZ A;  4UYF B;  3P1C A;  5FH7 A;  4IOQ A;  5EU1 A;  4KV4 A;  2D9E A;  4XYA A;  4NRC A;  4O76 A;  5D3R A;  3O33 A;  5FFY A;  3U5J A;  4MR3 A;  4NR5 A;  4HXP A;  4CFK A;  4NS5 A;  5ETB A;  4Q0O A;  5HLS A;  4IOR A;  5FE8 A;  4RVR A;  3GG3 A;  4CUR A;  5JWM A;  4HXO A;  3IU5 A;  5A83 A;  4HXM A;  4MR5 A;  4NR8 A;  1EQF A;  4UYD A;  5D3S A;  5A7C A;  4HBY A;  3AQA A;  5FE2 A;  5DYA A;  5DFD A;  4HXL A;  4KV1 A;  5FE9 A;  5COI A;  3LQJ A;  1ZS5 A;  4X2I A;  5DW2 A;  5CUG A;  3LJW A;  5DYX A;  2L5E A;  3JVL A;  3NXB A;  5DX4 A;  5LVQ A;  4TZ2 A;  5D3T A;  4HXK A;  4BW3 A;  5ENC A;  4CUS A;  5C7N A;  4O7F A;  5D24 A;  4QYL A;  5BT4 A;  4YBS A;  5DYC A;  4YH4 A;  5CUE A;  5CUD A;  4UIX A;  5CUA A;  3HMF A;  4LYW A;  4Z93 A;  4YYH A;  4UIY A;  5E3G A;  2OUO A;  4O75 A;  2E3K A;  5HQ6 A;  5D3H A;  4GPJ A;  4YYK A;  4OUF A;  5CS8 A;  5ENF A;  5I1Q A;  4UYE A;  4O7B A;  3HME A;  4YYD A;  3UVD A;  4YAD A;  4LRG A;  4YY6 A;  5EM3 A;  4NR6 A;  5FG5 A;  5HEM A;  5CQ3 A;  3O36 A;  5CGP A;  4YYN A;  5EWV A;  5LJ2 A;  5EWW A;  4N4G A;  3UW9 A;  5DLX A;  3UVX A;  1X0J A;  5CQ6 A;  4WHU A;  4TT4 A;  3SVH A;  4NR9 A;  4CFL A;  4QC3 A;  4HBW A;  5EIS A;  5CQ5 A;  4C67 A;  4QR5 A;  4AKN A;  3O35 A;  5CQ8 A;  5L98 A;  4TU4 A;  5A5N A;  5FE4 A;  4J3I A;  5EPS A;  4HXR A;  4CLB A;  4Y03 A;  5IGN A;  4UIT A;  5L99 A;  4UIZ A;  2FSA A;  5A5P A;  4PKL A;  5I29 A;  4IOO A;  5ENE A;  5F3A A;  4QSS A;  5FB1 A;  4OGI A;  4NQN A;  4MEO A;  5CU8 A;  4HBX A;  3RCW A;  2LSP B;  3P5O A;  4QC1 A;  2YYN A;  5CQA A;  3QZT A;  5A81 A;  5E9Y A;  5C4Q A;  2N9G A;  2D82 A;  5LVR A;  5HRW A;  4LYS A;  4NUE A;  4UIW A;  4Q0N A;  4UYF A;  5D26 A;  5FE5 A;  4YY4 A;  2I7K A;  5CQ4 A;  5TB6 A;  2DAT A;  5EWH A;  5LJ1 A;  4WHW A;  4A9M A;  4C66 A;  5D3L A;  4LZS A;  4F3I A;  5A5O A;  4PS5 A;  1JSP B;  3S92 A;  4TS8 A;  2WP1 A;  5EWC A;  1JM4 B;  5AD3 A;  4LZR A;  4O7E A;  5EPR A;  4A9J A;  5D25 A;  3HMH A;  4Z6H A;  5FE1 A;  5DBM A;  4QEV A;  4YAB A;  2L85 A;  5E9M A;  5CQT A;  2YEM A;  4PY6 A;  5KTX A;  5A5Q A;  3U5M A;  4YBT A;  5FE0 A;  5D3N A;  1N72 A;  3UV2 A;  5I83 A;  5HM0 A;  5E9L A;  4NUC A;  4O7C A;  5L97 A;  4BJX A;  4O70 A;  2R0Y A;  4O7A A;  3JVK A;  4TQN A;  3SVG A;  5CQ7 A;  4NUD A;  5H85 A;  5IGL A;  5F60 A;  5FFV A;  5IGK A;  4KCX A;  4XY8 A;  5LKZ A;  2R0S A;  5CPE A;  3QZS A;  5I7X A;  5HCL A;  4NR7 A;  3O37 A;  5L96 A;  5F5Z A;  5HQ5 A;  4QYD A;  5LKT A;  4QEU A;  4MR6 A;  5C85 A;  2R0V A;  5E9K A;  5E9I A;  2R10 A;  4PCE A;  4YH3 A;  4YYM A;  4O77 A;  5CUC A;  2YDW A;  5F1L A;  5G4S A;  5CFW A;  1WUM A;  2DVV A;  5I40 A;  5A85 A;  4NYX A;  3AAD A;  2DVQ A;  4YBM A;  5FE7 A;  2RS9 B;  5AME A;  4NRA A;  3ZYU A;  3U5P A;  3LQI A;  5EI4 A;  3U5L A;  4O74 A;  5CP5 A;  4IR6 A;  5EWD A;  4CUU A;  5EQ1 A;  4YYG A;  3ONI A;  2YEK A;  5FH6 A;  4A9L A;  3DAI A;  3LQH A;  4ZC9 A;  5EK9 A;  3UV4 A;  2E7O A;  3O34 A;  4QEW A;  5LKX A;  5EIC A;  5ENJ A;  3UVY A;  5C89 A;  3I3J A;  4MEQ A;  5BT3 A;  3JVJ A;  4WIV A;  5LJ0 A;  3P1E A;  4OGJ A;  3LXJ A;  4CUP A;  4A9F A;  4IR4 A;  5F61 A;  3MQM A;  4O72 A;  2E7N A;  4A9K A;  4CUQ A;  5JI8 A;  5HJC A;  3Q2E A;  4ZQL A;  5L8T A;  4Z1Q A;  4XUA A;  5H1U A;  2MJV B;  4N4F A;  2DVS A;  5FBX A;  5CY9 A;  3MB4 A;  5KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...