5FH8A

Crystal structure of the fifth bromodomain of human pb1 in complex with compound 28
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Identification and Development of 2,3-Dihydropyrrolo[1,2-a]quinazolin-5(1H)-one Inhibitors Targeting Bromodomains within the Switch/Sucrose Nonfermenting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fh8A00
3QZSA 5EWCA 3ONIA 4YY6A 4QEWA 5KTUA 5DKDA 4PS5A 5E3GA 5I1QA 4UIYA 2YQDA 4NYVA 4QSVA 5CUCA 5F63A 4KV4A 4A9FA 4CFKA 5CTLA 5CZGA 5E74A 2YEKA 3G0LA 4YY4A 4LC2A 3ZYUA 2GRCA 4Z1SA 5FE5A 5EWVA 3P5OA 4NR8A 4OGJA 5HQ6A 5IGNA 4XY9A 5C87A 4UYGA 4UIXA 5HFRA 5E9YA 3AADA 5A5PA 4YYHA 4TU6A 4NRAA 4UIWA 5HRWA 4LYSA 4YADA 5H1VA 4QBMA 3U5LA 4BW3A 4CFLA 4IR6A 5FG5A 5EPSA 4QYDA 4C66A 3D7CA 5A81A 5A82A 4J3IA 3IU6A 5F25A 4WHWA 4HXNA 5F61A 4CUUA 4DONA 5HELA 4E96A 4NUEA 5KO4A 5L99A 4QSTA 5JI8A 4QSRA 3P1DA 4TU4A 3UW9A 5E9MA 5HENA 5CUGA 4Z1QA 4HBWA 5I86A 5ACYA 5E7DA 4TZ2A 3LQIA 4GPJA 4YYGA 5LVQA 5EV9A 4NUDA 5DYAA 5EU1A 5G4RA 4MEPA 5ETBA 5AD2A 5L8TA 5EPBA 4Z93A 4NRCA 5E0RA 5A5QA 4QSSA 2N9GA 4QYLA 4BHWA 4HXMA 5A5RA 4ALGA 4CLBA 4HXOA 4IR5A 1E6IA 2RNXA 5EA1A 5LVRA 5HM0A 4YATA 3DAIA 5IGKA 5DLXA 4Q0OA 5FE2A 5I89A 5EI4A 4ZC9A 4PTBA 5F3AA 4WIVA 4UIVA 4NR7A 2I7KA 4N4HA 3U5NA 2DVQA 2DWWA 4NYWA 5D3TA 5J0DA 5CUDA 5CUAA 4PKLA 5L97A 5BT3A 5ENIA 5ETDA 3U5OA 4YBMA 3U5PA 5FH6A 4N4FA 4QUUA 5ENHA 3HMHA 4QSPA 3U5MA 5D3LA 3MXFA 2R0SA 4A9HA 4O7FA 2MJVB 5FFYA 3IU5A 5EVAA 4ALHA 4Q0NA 5FE3A 4PY6A 4QEUA 5A83A 2OUOA 3Q2EA 3P1FA 4O77A 3UV5A 3HMEA 5ENFA 2L84A 4A9EA 5E3DA 4OGIA 4O76A 5HLSA 3O33A 5D3HA 4NYXA 5EISA 3TLPA 1WUGA 2YEMA 5F1LA 5HQ5A 4QB3A 5FE8A 4IR4A 5BT4A 4UYFB 5IGLA 5DFCA 5D7XA 5HCLA 3Q2FA 4TZ8A 5CQ7A 5DYXA 4O7AA 2RS9B 3P1EA 4NR5A 5C89A 4MEOA 3AQAA 5CFWA 4TYLA 5KTXA 5AMEA 5D3NA 4MR5A 5L96A 4N4GA 4UIUA 5EQ1A 5TCMA 4KV1A 5FE7A 5DYUA 5EM3A 3JVKA 4Z6IA 3QZTA 2YYNA 2DVRA 4TT2A 4HXLA 5ENBA 5KTWA 5DKCA 5H85A 5E9VA 5A5NA 4HBYA 3S92A 3UVDA 5FH7A 4YC9A 5F36A 4BW2A 5F60A 4MR4A 4LYWA 5LUUA 5FB0A 4FLPA 5D26A 4O7BA 4NS5A 5FDZA 5I40A 1ZS5A 5EPRA 5EWHA 5F2PA 3LXJA 5LJ0A 4UITA 5COIA 4YBTA 4HXPA 4ZQLA 4TS8A 4YH4A 3JVLA 5CRZA 4O70A 5I83A 3SVHA 4IR3A 4QSXA 5EP7A 5CY9A 4QEVA 3O36A 5DFBA 3FKMX 4TTEA 5IIDA 3UVWA 2DVSA 4XY8A 5CPEA 5C8GA 5I88A 2RI7A 5EGUA 4LZ2A 4O75A 2E7NA 4NQNA 3JVJA 4ZW1A 4NXJA 2NXBA 5IGMA 5F5ZA 2E7OA 5CQTA 3K2JA 5CGPA 5I80A 5A5SA 1WUMA 4BW4A 5EWDA 4O7CA 4HXSA 5CU8A 4YYKA 5A85A 3O34A 2R10A 4Y03A 5FFWA 2I8NA 5K29A 5D3SA 5ENJA 5HJCA 5H1TA 2DKWA 5AD3A 5LJ1A 1N72A 4A9KA 5L98A 5CQ5A 4YBSA 4NR4A 5D3PA 3O37A 5BT5A 1X0JA 1EQFA 4UIZA 5D24A 4QC1A 5ENEA 4YABA 5CQ4A 5IG6A 4NQMA 3UVYA 4IOQA 2E3KA 3QZVA 4LYIA 5D3JA 4QSQA 3SVGA 2OSSA 5F62A 5D0CA 5C4QA 5EWWA 5D3RA 5LKXA 2RNYA 3GG3A 3LQHA 4HBVA 5CQAA 5DW1A 2WP2A 5DX4A 2YW5A 4CUSA 3LQJA 2R0YA 2DATA 4TQNA 4BW1A 4O7EA 4PCIA 4OUFA 5FE6A 2YDWA 4QUTA 2RO1A 3MULA 4A9LA 4A9OA 4YYIA 4UYHA 5FB1A 4UYDA 3G0JA 5FH8A 1JSPB 4CUQA 1F68A 4TT4A 4QC3A 5II2A 4AKNA 4QSUA 4A9IA 4A9NA 4YYNA 4MR3A 5CQ8A 4A9MA 4N4IA 4X2IA 5CQ3A 5DY7A 4PCEA 5ENCA 2KTBB 4O71A 4CUPA 5HQ7A 5DW2A 4YYMA 4XUBA 3MB3A 5IBNA 4Z6HA 1JM4B 5E9IA 3I3JA 5FG6A 4J0RA 3O35A 5EICA 2R0VA 4QR4A 4RVRA 2DVVA 5CUBA 4O74A 3P1CA 4N3WA 5FE4A 5DYCA 5ENGA 5I7XA 3U5JA 3MUKA 3HMFA 5F1HA 5C7NA 2LSPB 5CRMA 4UYEA 3U5KA 5HRXA 5EK9A 5H1UA 4O78A 5HEMA 4YYDA 5FFVA 3SVFA 4QNSA 5CS8A 5FBXA 5FE1A 5E9LA 3MB4A 5CUEA 5KHMA 4O72A 5LKUA 3DWYA 3LJWA 4HXKA 2F6NA 5LKTA 4LZRA 5I7YA 2RNWA 4QZSA 2H60A 5DFDA 4QSWA 5FE9A 5DKHA 2YELA 4LDFA 2G4AA 5C85A 5E73A 3UV2A 4YYJA 5JWMA 5FG4A 4CUTA 4LZSA 4TT6A 3UV4A 2FSAA 5II1A 5I29A 4CL9A 4CURA 5L8UA 4YAXA 3JVMA 4IORA 3UVXA 4NUCA 5G4SA 4YK0A 2F6JA 4MR6A 5LJ2A 4MENA 3MQMA 4NR6A 4QY4A 3RCWA 2L85A 4LRGA 5FE0A 4J0SA 5DLZA 5E9KA 4XUAA 4NR9A 5HRVA 4WHUA 2L5EA 4MEQA 5KU3A 2WP1A 4F3IA 5D25A 4QR3A 4C67A 5LKZA 5HFQA 5DBMA 4YH3A 4QR5A 4LR6A 4KCXA 2RFJA 4IOOA 5A5OA 5A7CA 4XYAA 3NXBA 4NRBA 3S91A 5CQ6A 4HXRA 4J1PA 4UYFA 4A9JA 5AMFA 4HBXA 5CP5A 4BJXA 2D9EA 2OO1A 2D82A 5TB6A
chains in the Genus database with same CATH superfamily
3QZSA 5EWCA 3ONIA 4YY6A 4QEWA 5KTUA 5DKDA 4PS5A 5E3GA 5I1QA 4UIYA 2YQDA 4NYVA 4QSVA 5CUCA 5F63A 4KV4A 4A9FA 4CFKA 5CTLA 5CZGA 5E74A 2YEKA 3G0LA 4YY4A 4LC2A 3ZYUA 2GRCA 4Z1SA 5FE5A 5EWVA 3P5OA 4NR8A 4OGJA 5HQ6A 5IGNA 4XY9A 5C87A 4UYGA 4UIXA 5HFRA 5E9YA 3AADA 5A5PA 4YYHA 4TU6A 4NRAA 4UIWA 5HRWA 4LYSA 4YADA 5H1VA 4QBMA 3U5LA 4BW3A 4CFLA 4IR6A 5FG5A 2EJNA 5EPSA 4QYDA 4C66A 3D7CA 5A81A 5A82A 4J3IA 3IU6A 5F25A 4WHWA 4HXNA 5F61A 4CUUA 4DONA 5HELA 4E96A 4NUEA 5KO4A 5L99A 4AKIA 4QSTA 5JI8A 4QSRA 3P1DA 4TU4A 3UW9A 5E9MA 5HENA 5CUGA 4Z1QA 4HBWA 5I86A 5ACYA 4AI6A 5E7DA 4TZ2A 3LQIA 4GPJA 4YYGA 5LVQA 5EV9A 4NUDA 5DYAA 5EU1A 5G4RA 4MEPA 5ETBA 5AD2A 5L8TA 5EPBA 4Z93A 4NRCA 5E0RA 5A5QA 4AKGA 4QSSA 2N9GA 4QYLA 4BHWA 4HXMA 5A5RA 4ALGA 4CLBA 4HXOA 4IR5A 1E6IA 2RNXA 5EA1A 5LVRA 5HM0A 4YATA 3DAIA 5IGKA 5DLXA 4Q0OA 5FE2A 5I89A 5EI4A 4ZC9A 4PTBA 5F3AA 4WIVA 4UIVA 4NR7A 2I7KA 4N4HA 3U5NA 3VKHA 2DVQA 2DWWA 4NYWA 5D3TA 5J0DA 5CUDA 5CUAA 4PKLA 5L97A 1PUOA 5BT3A 5ENIA 5ETDA 3U5OA 4YBMA 3U5PA 5FH6A 4N4FA 4QUUA 5ENHA 3HMHA 4QSPA 3U5MA 5D3LA 3MXFA 2R0SA 4A9HA 4O7FA 2MJVB 5FFYA 3IU5A 5EVAA 4ALHA 4Q0NA 5FE3A 4PY6A 4QEUA 5A83A 2OUOA 3Q2EA 3P1FA 4O77A 1ZKRA 3UV5A 3HMEA 5ENFA 2L84A 4A9EA 5E3DA 4OGIA 4O76A 5HLSA 3O33A 5D3HA 4NYXA 5EISA 3TLPA 1WUGA 2YEMA 5F1LA 5HQ5A 4QB3A 5FE8A 4IR4A 5BT4A 4UYFB 5IGLA 5DFCA 5D7XA 5HCLA 3Q2FA 4TZ8A 5CQ7A 5DYXA 4O7AA 3ERRA 2RS9B 3P1EA 4NR5A 5C89A 4MEOA 3AQAA 5CFWA 4TYLA 5KTXA 5AMEA 5D3NA 4MR5A 3D1BA 5L96A 4N4GA 4UIUA 5EQ1A 5TCMA 4KV1A 5FE7A 5DYUA 5EM3A 3JVKA 4Z6IA 3QZTA 2YYNA 2DVRA 4TT2A 4HXLA 5ENBA 5KTWA 5DKCA 5H85A 5E9VA 5A5NA 4HBYA 3S92A 3UVDA 5FH7A 4YC9A 5F36A 4BW2A 5F60A 4MR4A 4LYWA 5LUUA 5FB0A 4FLPA 5D26A 4O7BA 4NS5A 5FDZA 5I40A 1ZS5A 5EPRA 5EWHA 5F2PA 3LXJA 5LJ0A 4UITA 5COIA 4YBTA 4HXPA 4ZQLA 4TS8A 4YH4A 3JVLA 5CRZA 4O70A 5I83A 3SVHA 4IR3A 4QSXA 5EP7A 5CY9A 4QEVA 3O36A 5DFBA 3FKMX 4TTEA 5IIDA 3UVWA 2DVSA 4XY8A 5CPEA 5C8GA 5I88A 2RI7A 5EGUA 4LZ2A 4O75A 2E7NA 4NQNA 3JVJA 4ZW1A 4NXJA 2NXBA 5IGMA 5F5ZA 2E7OA 5CQTA 3K2JA 5CGPA 5I80A 5A5SA 1WUMA 4BW4A 5EWDA 4O7CA 4HXSA 5CU8A 4YYKA 5A85A 3O34A 2R10A 4Y03A 5FFWA 2I8NA 5K29A 5D3SA 5ENJA 5HJCA 5H1TA 2DKWA 5AD3A 5LJ1A 3VKGA 1N72A 4A9KA 5L98A 5CQ5A 4YBSA 4NR4A 5D3PA 3O37A 5BT5A 1X0JA 1EQFA 4UIZA 5D24A 4QC1A 5ENEA 4YABA 5CQ4A 5IG6A 4NQMA 3UVYA 4IOQA 2E3KA 3QZVA 4LYIA 5D3JA 4QSQA 3SVGA 2OSSA 5F62A 5D0CA 5C4QA 5EWWA 5D3RA 5LKXA 2RNYA 3GG3A 3LQHA 4HBVA 5CQAA 5DW1A 2WP2A 5DX4A 2YW5A 4CUSA 3LQJA 2R0YA 2DATA 4TQNA 4BW1A 4O7EA 4PCIA 4OUFA 5FE6A 2YDWA 4QUTA 2RO1A 3MULA 4A9LA 4A9OA 4YYIA 4UYHA 5FB1A 4UYDA 3G0JA 5FH8A 1JSPB 4CUQA 1F68A 4TT4A 4QC3A 5II2A 4AKNA 4QSUA 4A9IA 4A9NA 4YYNA 4MR3A 5CQ8A 4A9MA 4N4IA 4X2IA 5CQ3A 5DY7A 4PCEA 5ENCA 2KTBB 4O71A 4CUPA 5HQ7A 5DW2A 4YYMA 4XUBA 3MB3A 5IBNA 4Z6HA 1JM4B 5E9IA 3I3JA 5FG6A 4J0RA 3O35A 5EICA 2R0VA 4QR4A 4RVRA 2DVVA 5CUBA 4O74A 3P1CA 4N3WA 5FE4A 5DYCA 5ENGA 5I7XA 3U5JA 3MUKA 3HMFA 5F1HA 5C7NA 2LSPB 5CRMA 4UYEA 3U5KA 5HRXA 5EK9A 5H1UA 4O78A 5HEMA 4YYDA 5FFVA 3SVFA 4QNSA 5CS8A 5FBXA 5FE1A 5E9LA 3MB4A 5CUEA 5KHMA 4O72A 5LKUA 3DWYA 3LJWA 4HXKA 2F6NA 5LKTA 4LZRA 5I7YA 2RNWA 4QZSA 2H60A 5DFDA 4QSWA 5FE9A 5DKHA 2YELA 4LDFA 2G4AA 5C85A 5E73A 3UV2A 4YYJA 5JWMA 5FG4A 4CUTA 4LZSA 4TT6A 3UV4A 2FSAA 5II1A 5I29A 4CL9A 4CURA 5L8UA 4AKHA 4YAXA 3JVMA 4IORA 3UVXA 4NUCA 5G4SA 3D1DA 4YK0A 2F6JA 4MR6A 5LJ2A 4MENA 3MQMA 4NR6A 4QY4A 3RCWA 2L85A 4LRGA 5FE0A 4J0SA 5DLZA 5E9KA 4XUAA 4NR9A 5HRVA 4WHUA 2L5EA 4MEQA 5KU3A 2WP1A 4F3IA 5D25A 4QR3A 4C67A 5LKZA 5HFQA 5DBMA 4YH3A 4QR5A 4LR6A 4KCXA 2RFJA 4IOOA 5A5OA 5A7CA 4XYAA 3NXBA 4NRBA 3S91A 5CQ6A 4HXRA 4J1PA 4UYFA 4A9JA 5AMFA 4HBXA 5CP5A 4BJXA 2D9EA 2OO1A 2D82A 5TB6A
chains in the Genus database with same CATH topology
3QZSA 5EWCA 3ONIA 4YY6A 4QEWA 5KTUA 5DKDA 4PS5A 5E3GA 5I1QA 4UIYA 2YQDA 4NYVA 4QSVA 5CUCA 5F63A 4KV4A 4A9FA 4CFKA 5CTLA 5CZGA 5E74A 2YEKA 3G0LA 4YY4A 4LC2A 3ZYUA 2GRCA 4Z1SA 5FE5A 5EWVA 3P5OA 4NR8A 4OGJA 5HQ6A 5IGNA 4XY9A 5C87A 4UYGA 4UIXA 5HFRA 5E9YA 3AADA 5A5PA 4YYHA 4TU6A 4NRAA 4UIWA 5HRWA 4LYSA 4YADA 5H1VA 4QBMA 3U5LA 4BW3A 4CFLA 4IR6A 5FG5A 5EPSA 4QYDA 4C66A 3D7CA 5A81A 5A82A 4J3IA 3IU6A 5F25A 4WHWA 4HXNA 5F61A 4CUUA 4DONA 5HELA 4E96A 4NUEA 5KO4A 5L99A 4QSTA 5JI8A 4QSRA 3P1DA 4TU4A 3UW9A 5E9MA 5HENA 5CUGA 4Z1QA 4HBWA 5I86A 5ACYA 5E7DA 4TZ2A 3LQIA 4GPJA 4YYGA 5LVQA 5EV9A 4NUDA 5DYAA 5EU1A 5G4RA 4MEPA 5ETBA 5AD2A 5L8TA 5EPBA 4Z93A 4NRCA 5E0RA 5A5QA 4QSSA 2N9GA 4QYLA 4BHWA 4HXMA 5A5RA 4ALGA 4CLBA 4HXOA 4IR5A 1E6IA 2RNXA 5EA1A 5LVRA 5HM0A 4YATA 3DAIA 5IGKA 5DLXA 4Q0OA 5FE2A 5I89A 5EI4A 4ZC9A 4PTBA 5F3AA 4WIVA 4UIVA 4NR7A 2I7KA 4N4HA 3U5NA 2DVQA 2DWWA 4NYWA 5D3TA 5J0DA 5CUDA 5CUAA 4PKLA 5L97A 5BT3A 5ENIA 5ETDA 3U5OA 4YBMA 3U5PA 5FH6A 4N4FA 4QUUA 5ENHA 3HMHA 4QSPA 3U5MA 5D3LA 3MXFA 2R0SA 4A9HA 4O7FA 2MJVB 5FFYA 3IU5A 5EVAA 4ALHA 4Q0NA 5FE3A 4PY6A 4QEUA 5A83A 2OUOA 3Q2EA 3P1FA 4O77A 3UV5A 3HMEA 5ENFA 2L84A 4A9EA 5E3DA 4OGIA 4O76A 5HLSA 3O33A 5D3HA 4NYXA 5EISA 3TLPA 1WUGA 2YEMA 5F1LA 5HQ5A 4QB3A 5FE8A 4IR4A 5BT4A 4UYFB 5IGLA 5DFCA 5D7XA 5HCLA 3Q2FA 4TZ8A 5CQ7A 5DYXA 4O7AA 2RS9B 3P1EA 4NR5A 5C89A 4MEOA 3AQAA 5CFWA 4TYLA 5KTXA 5AMEA 5D3NA 4MR5A 5L96A 4N4GA 4UIUA 5EQ1A 5TCMA 4KV1A 5FE7A 5DYUA 5EM3A 3JVKA 4Z6IA 3QZTA 2YYNA 2DVRA 4TT2A 4HXLA 5ENBA 5KTWA 5DKCA 5H85A 5E9VA 5A5NA 4HBYA 3S92A 3UVDA 5FH7A 4YC9A 5F36A 4BW2A 5F60A 4MR4A 4LYWA 5LUUA 5FB0A 4FLPA 5D26A 4O7BA 4NS5A 5FDZA 5I40A 1ZS5A 5EPRA 5EWHA 5F2PA 3LXJA 5LJ0A 4UITA 5COIA 4YBTA 4HXPA 4ZQLA 4TS8A 4YH4A 3JVLA 5CRZA 4O70A 5I83A 3SVHA 4IR3A 4QSXA 5EP7A 5CY9A 4QEVA 3O36A 5DFBA 3FKMX 4TTEA 5IIDA 3UVWA 2DVSA 4XY8A 5CPEA 5C8GA 5I88A 2RI7A 5EGUA 4LZ2A 4O75A 2E7NA 4NQNA 3JVJA 4ZW1A 4NXJA 2NXBA 5IGMA 5F5ZA 2E7OA 5CQTA 3K2JA 5CGPA 5I80A 5A5SA 1WUMA 4BW4A 5EWDA 4O7CA 4HXSA 5CU8A 4YYKA 5A85A 3O34A 2R10A 4Y03A 5FFWA 2I8NA 5K29A 5D3SA 5ENJA 5HJCA 5H1TA 2DKWA 5AD3A 5LJ1A 1N72A 4A9KA 5L98A 5CQ5A 4YBSA 4NR4A 5D3PA 3O37A 5BT5A 1X0JA 1EQFA 4UIZA 5D24A 4QC1A 5ENEA 4YABA 5CQ4A 5IG6A 4NQMA 3UVYA 4IOQA 2E3KA 3QZVA 4LYIA 5D3JA 4QSQA 3SVGA 2OSSA 5F62A 5D0CA 5C4QA 5EWWA 5D3RA 5LKXA 2RNYA 3GG3A 3LQHA 4HBVA 5CQAA 5DW1A 2WP2A 5DX4A 2YW5A 4CUSA 3LQJA 2R0YA 2DATA 4TQNA 4BW1A 4O7EA 4PCIA 4OUFA 5FE6A 2YDWA 4QUTA 2RO1A 3MULA 4A9LA 4A9OA 4YYIA 4UYHA 5FB1A 4UYDA 3G0JA 5FH8A 1JSPB 4CUQA 1F68A 4TT4A 4QC3A 5II2A 4AKNA 4QSUA 4A9IA 4A9NA 4YYNA 4MR3A 5CQ8A 4A9MA 4N4IA 4X2IA 5CQ3A 5DY7A 4PCEA 5ENCA 2KTBB 4O71A 4CUPA 5HQ7A 5DW2A 4YYMA 4XUBA 3MB3A 5IBNA 4Z6HA 1JM4B 5E9IA 3I3JA 5FG6A 4J0RA 3O35A 5EICA 2R0VA 4QR4A 4RVRA 2DVVA 5CUBA 4O74A 3P1CA 4N3WA 5FE4A 5DYCA 5ENGA 5I7XA 3U5JA 3MUKA 3HMFA 5F1HA 5C7NA 2LSPB 5CRMA 4UYEA 3U5KA 5HRXA 5EK9A 5H1UA 4O78A 5HEMA 4YYDA 5FFVA 3SVFA 4QNSA 5CS8A 5FBXA 5FE1A 5E9LA 3MB4A 5CUEA 5KHMA 4O72A 5LKUA 3DWYA 3LJWA 4HXKA 2F6NA 5LKTA 4LZRA 5I7YA 2RNWA 4QZSA 2H60A 5DFDA 4QSWA 5FE9A 5DKHA 2YELA 4LDFA 2G4AA 5C85A 5E73A 3UV2A 4YYJA 5JWMA 5FG4A 4CUTA 4LZSA 4TT6A 3UV4A 2FSAA 5II1A 5I29A 4CL9A 4CURA 5L8UA 4YAXA 3JVMA 4IORA 3UVXA 4NUCA 5G4SA 4YK0A 2F6JA 4MR6A 5LJ2A 4MENA 3MQMA 4NR6A 4QY4A 3RCWA 2L85A 4LRGA 5FE0A 4J0SA 5DLZA 5E9KA 4XUAA 4NR9A 5HRVA 4WHUA 2L5EA 4MEQA 5KU3A 2WP1A 4F3IA 5D25A 4QR3A 4C67A 5LKZA 5HFQA 5DBMA 4YH3A 4QR5A 4LR6A 4KCXA 2RFJA 4IOOA 5A5OA 5A7CA 4XYAA 3NXBA 4NRBA 3S91A 5CQ6A 4HXRA 4J1PA 4UYFA 4A9JA 5AMFA 4HBXA 5CP5A 4BJXA 2D9EA 2OO1A 2D82A 5TB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZS A;  5EWC A;  3ONI A;  4YY6 A;  4QEW A;  5KTU A;  5DKD A;  4PS5 A;  5E3G A;  5I1Q A;  4UIY A;  2YQD A;  4NYV A;  4QSV A;  5CUC A;  5F63 A;  4KV4 A;  4A9F A;  4CFK A;  5CTL A;  5CZG A;  5E74 A;  2YEK A;  3G0L A;  4YY4 A;  4LC2 A;  3ZYU A;  2GRC A;  4Z1S A;  5FE5 A;  5EWV A;  3P5O A;  4NR8 A;  4OGJ A;  5HQ6 A;  5IGN A;  4XY9 A;  5C87 A;  4UYG A;  4UIX A;  5HFR A;  5E9Y A;  3AAD A;  5A5P A;  4YYH A;  4TU6 A;  4NRA A;  4UIW A;  5HRW A;  4LYS A;  4YAD A;  5H1V A;  4QBM A;  3U5L A;  4BW3 A;  4CFL A;  4IR6 A;  5FG5 A;  5EPS A;  4QYD A;  4C66 A;  3D7C A;  5A81 A;  5A82 A;  4J3I A;  3IU6 A;  5F25 A;  4WHW A;  4HXN A;  5F61 A;  4CUU A;  4DON A;  5HEL A;  4E96 A;  4NUE A;  5KO4 A;  5L99 A;  4QST A;  5JI8 A;  4QSR A;  3P1D A;  4TU4 A;  3UW9 A;  5E9M A;  5HEN A;  5CUG A;  4Z1Q A;  4HBW A;  5I86 A;  5ACY A;  5E7D A;  4TZ2 A;  3LQI A;  4GPJ A;  4YYG A;  5LVQ A;  5EV9 A;  4NUD A;  5DYA A;  5EU1 A;  5G4R A;  4MEP A;  5ETB A;  5AD2 A;  5L8T A;  5EPB A;  4Z93 A;  4NRC A;  5E0R A;  5A5Q A;  4QSS A;  2N9G A;  4QYL A;  4BHW A;  4HXM A;  5A5R A;  4ALG A;  4CLB A;  4HXO A;  4IR5 A;  1E6I A;  2RNX A;  5EA1 A;  5LVR A;  5HM0 A;  4YAT A;  3DAI A;  5IGK A;  5DLX A;  4Q0O A;  5FE2 A;  5I89 A;  5EI4 A;  4ZC9 A;  4PTB A;  5F3A A;  4WIV A;  4UIV A;  4NR7 A;  2I7K A;  4N4H A;  3U5N A;  2DVQ A;  2DWW A;  4NYW A;  5D3T A;  5J0D A;  5CUD A;  5CUA A;  4PKL A;  5L97 A;  5BT3 A;  5ENI A;  5ETD A;  3U5O A;  4YBM A;  3U5P A;  5FH6 A;  4N4F A;  4QUU A;  5ENH A;  3HMH A;  4QSP A;  3U5M A;  5D3L A;  3MXF A;  2R0S A;  4A9H A;  4O7F A;  2MJV B;  5FFY A;  3IU5 A;  5EVA A;  4ALH A;  4Q0N A;  5FE3 A;  4PY6 A;  4QEU A;  5A83 A;  2OUO A;  3Q2E A;  3P1F A;  4O77 A;  3UV5 A;  3HME A;  5ENF A;  2L84 A;  4A9E A;  5E3D A;  4OGI A;  4O76 A;  5HLS A;  3O33 A;  5D3H A;  4NYX A;  5EIS A;  3TLP A;  1WUG A;  2YEM A;  5F1L A;  5HQ5 A;  4QB3 A;  5FE8 A;  4IR4 A;  5BT4 A;  4UYF B;  5IGL A;  5DFC A;  5D7X A;  5HCL A;  3Q2F A;  4TZ8 A;  5CQ7 A;  5DYX A;  4O7A A;  2RS9 B;  3P1E A;  4NR5 A;  5C89 A;  4MEO A;  3AQA A;  5CFW A;  4TYL A;  5KTX A;  5AME A;  5D3N A;  4MR5 A;  5L96 A;  4N4G A;  4UIU A;  5EQ1 A;  5TCM A;  4KV1 A;  5FE7 A;  5DYU A;  5EM3 A;  3JVK A;  4Z6I A;  3QZT A;  2YYN A;  2DVR A;  4TT2 A;  4HXL A;  5ENB A;  5KTW A;  5DKC A;  5H85 A;  5E9V A;  5A5N A;  4HBY A;  3S92 A;  3UVD A;  5FH7 A;  4YC9 A;  5F36 A;  4BW2 A;  5F60 A;  4MR4 A;  4LYW A;  5LUU A;  5FB0 A;  4FLP A;  5D26 A;  4O7B A;  4NS5 A;  5FDZ A;  5I40 A;  1ZS5 A;  5EPR A;  5EWH A;  5F2P A;  3LXJ A;  5LJ0 A;  4UIT A;  5COI A;  4YBT A;  4HXP A;  4ZQL A;  4TS8 A;  4YH4 A;  3JVL A;  5CRZ A;  4O70 A;  5I83 A;  3SVH A;  4IR3 A;  4QSX A;  5EP7 A;  5CY9 A;  4QEV A;  3O36 A;  5DFB A;  3FKM X;  4TTE A;  5IID A;  3UVW A;  2DVS A;  4XY8 A;  5CPE A;  5C8G A;  5I88 A;  2RI7 A;  5EGU A;  4LZ2 A;  4O75 A;  2E7N A;  4NQN A;  3JVJ A;  4ZW1 A;  4NXJ A;  2NXB A;  5IGM A;  5F5Z A;  2E7O A;  5CQT A;  3K2J A;  5CGP A;  5I80 A;  5A5S A;  1WUM A;  4BW4 A;  5EWD A;  4O7C A;  4HXS A;  5CU8 A;  4YYK A;  5A85 A;  3O34 A;  2R10 A;  4Y03 A;  5FFW A;  2I8N A;  5K29 A;  5D3S A;  5ENJ A;  5HJC A;  5H1T A;  2DKW A;  5AD3 A;  5LJ1 A;  1N72 A;  4A9K A;  5L98 A;  5CQ5 A;  4YBS A;  4NR4 A;  5D3P A;  3O37 A;  5BT5 A;  1X0J A;  1EQF A;  4UIZ A;  5D24 A;  4QC1 A;  5ENE A;  4YAB A;  5CQ4 A;  5IG6 A;  4NQM A;  3UVY A;  4IOQ A;  2E3K A;  3QZV A;  4LYI A;  5D3J A;  4QSQ A;  3SVG A;  2OSS A;  5F62 A;  5D0C A;  5C4Q A;  5EWW A;  5D3R A;  5LKX A;  2RNY A;  3GG3 A;  3LQH A;  4HBV A;  5CQA A;  5DW1 A;  2WP2 A;  5DX4 A;  2YW5 A;  4CUS A;  3LQJ A;  2R0Y A;  2DAT A;  4TQN A;  4BW1 A;  4O7E A;  4PCI A;  4OUF A;  5FE6 A;  2YDW A;  4QUT A;  2RO1 A;  3MUL A;  4A9L A;  4A9O A;  4YYI A;  4UYH A;  5FB1 A;  4UYD A;  3G0J A;  5FH8 A;  1JSP B;  4CUQ A;  1F68 A;  4TT4 A;  4QC3 A;  5II2 A;  4AKN A;  4QSU A;  4A9I A;  4A9N A;  4YYN A;  4MR3 A;  5CQ8 A;  4A9M A;  4N4I A;  4X2I A;  5CQ3 A;  5DY7 A;  4PCE A;  5ENC A;  2KTB B;  4O71 A;  4CUP A;  5HQ7 A;  5DW2 A;  4YYM A;  4XUB A;  3MB3 A;  5IBN A;  4Z6H A;  1JM4 B;  5E9I A;  3I3J A;  5FG6 A;  4J0R A;  3O35 A;  5EIC A;  2R0V A;  4QR4 A;  4RVR A;  2DVV A;  5CUB A;  4O74 A;  3P1C A;  4N3W A;  5FE4 A;  5DYC A;  5ENG A;  5I7X A;  3U5J A;  3MUK A;  3HMF A;  5F1H A;  5C7N A;  2LSP B;  5CRM A;  4UYE A;  3U5K A;  5HRX A;  5EK9 A;  5H1U A;  4O78 A;  5HEM A;  4YYD A;  5FFV A;  3SVF A;  4QNS A;  5CS8 A;  5FBX A;  5FE1 A;  5E9L A;  3MB4 A;  5CUE A;  5KHM A;  4O72 A;  5LKU A;  3DWY A;  3LJW A;  4HXK A;  2F6N A;  5LKT A;  4LZR A;  5I7Y A;  2RNW A;  4QZS A;  2H60 A;  5DFD A;  4QSW A;  5FE9 A;  5DKH A;  2YEL A;  4LDF A;  2G4A A;  5C85 A;  5E73 A;  3UV2 A;  4YYJ A;  5JWM A;  5FG4 A;  4CUT A;  4LZS A;  4TT6 A;  3UV4 A;  2FSA A;  5II1 A;  5I29 A;  4CL9 A;  4CUR A;  5L8U A;  4YAX A;  3JVM A;  4IOR A;  3UVX A;  4NUC A;  5G4S A;  4YK0 A;  2F6J A;  4MR6 A;  5LJ2 A;  4MEN A;  3MQM A;  4NR6 A;  4QY4 A;  3RCW A;  2L85 A;  4LRG A;  5FE0 A;  4J0S A;  5DLZ A;  5E9K A;  4XUA A;  4NR9 A;  5HRV A;  4WHU A;  2L5E A;  4MEQ A;  5KU3 A;  2WP1 A;  4F3I A;  5D25 A;  4QR3 A;  4C67 A;  5LKZ A;  5HFQ A;  5DBM A;  4YH3 A;  4QR5 A;  4LR6 A;  4KCX A;  2RFJ A;  4IOO A;  5A5O A;  5A7C A;  4XYA A;  3NXB A;  4NRB A;  3S91 A;  5CQ6 A;  4HXR A;  4J1P A;  4UYF A;  4A9J A;  5AMF A;  4HBX A;  5CP5 A;  4BJX A;  2D9E A;  2OO1 A;  2D82 A;  5TB6 A; 
#chains in the Genus database with same CATH topology
 3QZS A;  5EWC A;  3ONI A;  4YY6 A;  4QEW A;  5KTU A;  5DKD A;  4PS5 A;  5E3G A;  5I1Q A;  4UIY A;  2YQD A;  4NYV A;  4QSV A;  5CUC A;  5F63 A;  4KV4 A;  4A9F A;  4CFK A;  5CTL A;  5CZG A;  5E74 A;  2YEK A;  3G0L A;  4YY4 A;  4LC2 A;  3ZYU A;  2GRC A;  4Z1S A;  5FE5 A;  5EWV A;  3P5O A;  4NR8 A;  4OGJ A;  5HQ6 A;  5IGN A;  4XY9 A;  5C87 A;  4UYG A;  4UIX A;  5HFR A;  5E9Y A;  3AAD A;  5A5P A;  4YYH A;  4TU6 A;  4NRA A;  4UIW A;  5HRW A;  4LYS A;  4YAD A;  5H1V A;  4QBM A;  3U5L A;  4BW3 A;  4CFL A;  4IR6 A;  5FG5 A;  2EJN A;  5EPS A;  4QYD A;  4C66 A;  3D7C A;  5A81 A;  5A82 A;  4J3I A;  3IU6 A;  5F25 A;  4WHW A;  4HXN A;  5F61 A;  4CUU A;  4DON A;  5HEL A;  4E96 A;  4NUE A;  5KO4 A;  5L99 A;  4AKI A;  4QST A;  5JI8 A;  4QSR A;  3P1D A;  4TU4 A;  3UW9 A;  5E9M A;  5HEN A;  5CUG A;  4Z1Q A;  4HBW A;  5I86 A;  5ACY A;  4AI6 A;  5E7D A;  4TZ2 A;  3LQI A;  4GPJ A;  4YYG A;  5LVQ A;  5EV9 A;  4NUD A;  5DYA A;  5EU1 A;  5G4R A;  4MEP A;  5ETB A;  5AD2 A;  5L8T A;  5EPB A;  4Z93 A;  4NRC A;  5E0R A;  5A5Q A;  4AKG A;  4QSS A;  2N9G A;  4QYL A;  4BHW A;  4HXM A;  5A5R A;  4ALG A;  4CLB A;  4HXO A;  4IR5 A;  1E6I A;  2RNX A;  5EA1 A;  5LVR A;  5HM0 A;  4YAT A;  3DAI A;  5IGK A;  5DLX A;  4Q0O A;  5FE2 A;  5I89 A;  5EI4 A;  4ZC9 A;  4PTB A;  5F3A A;  4WIV A;  4UIV A;  4NR7 A;  2I7K A;  4N4H A;  3U5N A;  3VKH A;  2DVQ A;  2DWW A;  4NYW A;  5D3T A;  5J0D A;  5CUD A;  5CUA A;  4PKL A;  5L97 A;  1PUO A;  5BT3 A;  5ENI A;  5ETD A;  3U5O A;  4YBM A;  3U5P A;  5FH6 A;  4N4F A;  4QUU A;  5ENH A;  3HMH A;  4QSP A;  3U5M A;  5D3L A;  3MXF A;  2R0S A;  4A9H A;  4O7F A;  2MJV B;  5FFY A;  3IU5 A;  5EVA A;  4ALH A;  4Q0N A;  5FE3 A;  4PY6 A;  4QEU A;  5A83 A;  2OUO A;  3Q2E A;  3P1F A;  4O77 A;  1ZKR A;  3UV5 A;  3HME A;  5ENF A;  2L84 A;  4A9E A;  5E3D A;  4OGI A;  4O76 A;  5HLS A;  3O33 A;  5D3H A;  4NYX A;  5EIS A;  3TLP A;  1WUG A;  2YEM A;  5F1L A;  5HQ5 A;  4QB3 A;  5FE8 A;  4IR4 A;  5BT4 A;  4UYF B;  5IGL A;  5DFC A;  5D7X A;  5HCL A;  3Q2F A;  4TZ8 A;  5CQ7 A;  5DYX A;  4O7A A;  3ERR A;  2RS9 B;  3P1E A;  4NR5 A;  5C89 A;  4MEO A;  3AQA A;  5CFW A;  4TYL A;  5KTX A;  5AME A;  5D3N A;  4MR5 A;  3D1B A;  5L96 A;  4N4G A;  4UIU A;  5EQ1 A;  5TCM A;  4KV1 A;  5FE7 A;  5DYU A;  5EM3 A;  3JVK A;  4Z6I A;  3QZT A;  2YYN A;  2DVR A;  4TT2 A;  4HXL A;  5ENB A;  5KTW A;  5DKC A;  5H85 A;  5E9V A;  5A5N A;  4HBY A;  3S92 A;  3UVD A;  5FH7 A;  4YC9 A;  5F36 A;  4BW2 A;  5F60 A;  4MR4 A;  4LYW A;  5LUU A;  5FB0 A;  4FLP A;  5D26 A;  4O7B A;  4NS5 A;  5FDZ A;  5I40 A;  1ZS5 A;  5EPR A;  5EWH A;  5F2P A;  3LXJ A;  5LJ0 A;  4UIT A;  5COI A;  4YBT A;  4HXP A;  4ZQL A;  4TS8 A;  4YH4 A;  3JVL A;  5CRZ A;  4O70 A;  5I83 A;  3SVH A;  4IR3 A;  4QSX A;  5EP7 A;  5CY9 A;  4QEV A;  3O36 A;  5DFB A;  3FKM X;  4TTE A;  5IID A;  3UVW A;  2DVS A;  4XY8 A;  5CPE A;  5C8G A;  5I88 A;  2RI7 A;  5EGU A;  4LZ2 A;  4O75 A;  2E7N A;  4NQN A;  3JVJ A;  4ZW1 A;  4NXJ A;  2NXB A;  5IGM A;  5F5Z A;  2E7O A;  5CQT A;  3K2J A;  5CGP A;  5I80 A;  5A5S A;  1WUM A;  4BW4 A;  5EWD A;  4O7C A;  4HXS A;  5CU8 A;  4YYK A;  5A85 A;  3O34 A;  2R10 A;  4Y03 A;  5FFW A;  2I8N A;  5K29 A;  5D3S A;  5ENJ A;  5HJC A;  5H1T A;  2DKW A;  5AD3 A;  5LJ1 A;  3VKG A;  1N72 A;  4A9K A;  5L98 A;  5CQ5 A;  4YBS A;  4NR4 A;  5D3P A;  3O37 A;  5BT5 A;  1X0J A;  1EQF A;  4UIZ A;  5D24 A;  4QC1 A;  5ENE A;  4YAB A;  5CQ4 A;  5IG6 A;  4NQM A;  3UVY A;  4IOQ A;  2E3K A;  3QZV A;  4LYI A;  5D3J A;  4QSQ A;  3SVG A;  2OSS A;  5F62 A;  5D0C A;  5C4Q A;  5EWW A;  5D3R A;  5LKX A;  2RNY A;  3GG3 A;  3LQH A;  4HBV A;  5CQA A;  5DW1 A;  2WP2 A;  5DX4 A;  2YW5 A;  4CUS A;  3LQJ A;  2R0Y A;  2DAT A;  4TQN A;  4BW1 A;  4O7E A;  4PCI A;  4OUF A;  5FE6 A;  2YDW A;  4QUT A;  2RO1 A;  3MUL A;  4A9L A;  4A9O A;  4YYI A;  4UYH A;  5FB1 A;  4UYD A;  3G0J A;  5FH8 A;  1JSP B;  4CUQ A;  1F68 A;  4TT4 A;  4QC3 A;  5II2 A;  4AKN A;  4QSU A;  4A9I A;  4A9N A;  4YYN A;  4MR3 A;  5CQ8 A;  4A9M A;  4N4I A;  4X2I A;  5CQ3 A;  5DY7 A;  4PCE A;  5ENC A;  2KTB B;  4O71 A;  4CUP A;  5HQ7 A;  5DW2 A;  4YYM A;  4XUB A;  3MB3 A;  5IBN A;  4Z6H A;  1JM4 B;  5E9I A;  3I3J A;  5FG6 A;  4J0R A;  3O35 A;  5EIC A;  2R0V A;  4QR4 A;  4RVR A;  2DVV A;  5CUB A;  4O74 A;  3P1C A;  4N3W A;  5FE4 A;  5DYC A;  5ENG A;  5I7X A;  3U5J A;  3MUK A;  3HMF A;  5F1H A;  5C7N A;  2LSP B;  5CRM A;  4UYE A;  3U5K A;  5HRX A;  5EK9 A;  5H1U A;  4O78 A;  5HEM A;  4YYD A;  5FFV A;  3SVF A;  4QNS A;  5CS8 A;  5FBX A;  5FE1 A;  5E9L A;  3MB4 A;  5CUE A;  5KHM A;  4O72 A;  5LKU A;  3DWY A;  3LJW A;  4HXK A;  2F6N A;  5LKT A;  4LZR A;  5I7Y A;  2RNW A;  4QZS A;  2H60 A;  5DFD A;  4QSW A;  5FE9 A;  5DKH A;  2YEL A;  4LDF A;  2G4A A;  5C85 A;  5E73 A;  3UV2 A;  4YYJ A;  5JWM A;  5FG4 A;  4CUT A;  4LZS A;  4TT6 A;  3UV4 A;  2FSA A;  5II1 A;  5I29 A;  4CL9 A;  4CUR A;  5L8U A;  4AKH A;  4YAX A;  3JVM A;  4IOR A;  3UVX A;  4NUC A;  5G4S A;  3D1D A;  4YK0 A;  2F6J A;  4MR6 A;  5LJ2 A;  4MEN A;  3MQM A;  4NR6 A;  4QY4 A;  3RCW A;  2L85 A;  4LRG A;  5FE0 A;  4J0S A;  5DLZ A;  5E9K A;  4XUA A;  4NR9 A;  5HRV A;  4WHU A;  2L5E A;  4MEQ A;  5KU3 A;  2WP1 A;  4F3I A;  5D25 A;  4QR3 A;  4C67 A;  5LKZ A;  5HFQ A;  5DBM A;  4YH3 A;  4QR5 A;  4LR6 A;  4KCX A;  2RFJ A;  4IOO A;  5A5O A;  5A7C A;  4XYA A;  3NXB A;  4NRB A;  3S91 A;  5CQ6 A;  4HXR A;  4J1P A;  4UYF A;  4A9J A;  5AMF A;  4HBX A;  5CP5 A;  4BJX A;  2D9E A;  2OO1 A;  2D82 A;  5TB6 A; 
#chains in the Genus database with same CATH homology
 3QZS A;  5EWC A;  3ONI A;  4YY6 A;  4QEW A;  5KTU A;  5DKD A;  4PS5 A;  5E3G A;  5I1Q A;  4UIY A;  2YQD A;  4NYV A;  4QSV A;  5CUC A;  5F63 A;  4KV4 A;  4A9F A;  4CFK A;  5CTL A;  5CZG A;  5E74 A;  2YEK A;  3G0L A;  4YY4 A;  4LC2 A;  3ZYU A;  2GRC A;  4Z1S A;  5FE5 A;  5EWV A;  3P5O A;  4NR8 A;  4OGJ A;  5HQ6 A;  5IGN A;  4XY9 A;  5C87 A;  4UYG A;  4UIX A;  5HFR A;  5E9Y A;  3AAD A;  5A5P A;  4YYH A;  4TU6 A;  4NRA A;  4UIW A;  5HRW A;  4LYS A;  4YAD A;  5H1V A;  4QBM A;  3U5L A;  4BW3 A;  4CFL A;  4IR6 A;  5FG5 A;  5EPS A;  4QYD A;  4C66 A;  3D7C A;  5A81 A;  5A82 A;  4J3I A;  3IU6 A;  5F25 A;  4WHW A;  4HXN A;  5F61 A;  4CUU A;  4DON A;  5HEL A;  4E96 A;  4NUE A;  5KO4 A;  5L99 A;  4QST A;  5JI8 A;  4QSR A;  3P1D A;  4TU4 A;  3UW9 A;  5E9M A;  5HEN A;  5CUG A;  4Z1Q A;  4HBW A;  5I86 A;  5ACY A;  5E7D A;  4TZ2 A;  3LQI A;  4GPJ A;  4YYG A;  5LVQ A;  5EV9 A;  4NUD A;  5DYA A;  5EU1 A;  5G4R A;  4MEP A;  5ETB A;  5AD2 A;  5L8T A;  5EPB A;  4Z93 A;  4NRC A;  5E0R A;  5A5Q A;  4QSS A;  2N9G A;  4QYL A;  4BHW A;  4HXM A;  5A5R A;  4ALG A;  4CLB A;  4HXO A;  4IR5 A;  1E6I A;  2RNX A;  5EA1 A;  5LVR A;  5HM0 A;  4YAT A;  3DAI A;  5IGK A;  5DLX A;  4Q0O A;  5FE2 A;  5I89 A;  5EI4 A;  4ZC9 A;  4PTB A;  5F3A A;  4WIV A;  4UIV A;  4NR7 A;  2I7K A;  4N4H A;  3U5N A;  2DVQ A;  2DWW A;  4NYW A;  5D3T A;  5J0D A;  5CUD A;  5CUA A;  4PKL A;  5L97 A;  5BT3 A;  5ENI A;  5ETD A;  3U5O A;  4YBM A;  3U5P A;  5FH6 A;  4N4F A;  4QUU A;  5ENH A;  3HMH A;  4QSP A;  3U5M A;  5D3L A;  3MXF A;  2R0S A;  4A9H A;  4O7F A;  2MJV B;  5FFY A;  3IU5 A;  5EVA A;  4ALH A;  4Q0N A;  5FE3 A;  4PY6 A;  4QEU A;  5A83 A;  2OUO A;  3Q2E A;  3P1F A;  4O77 A;  3UV5 A;  3HME A;  5ENF A;  2L84 A;  4A9E A;  5E3D A;  4OGI A;  4O76 A;  5HLS A;  3O33 A;  5D3H A;  4NYX A;  5EIS A;  3TLP A;  1WUG A;  2YEM A;  5F1L A;  5HQ5 A;  4QB3 A;  5FE8 A;  4IR4 A;  5BT4 A;  4UYF B;  5IGL A;  5DFC A;  5D7X A;  5HCL A;  3Q2F A;  4TZ8 A;  5CQ7 A;  5DYX A;  4O7A A;  2RS9 B;  3P1E A;  4NR5 A;  5C89 A;  4MEO A;  3AQA A;  5CFW A;  4TYL A;  5KTX A;  5AME A;  5D3N A;  4MR5 A;  5L96 A;  4N4G A;  4UIU A;  5EQ1 A;  5TCM A;  4KV1 A;  5FE7 A;  5DYU A;  5EM3 A;  3JVK A;  4Z6I A;  3QZT A;  2YYN A;  2DVR A;  4TT2 A;  4HXL A;  5ENB A;  5KTW A;  5DKC A;  5H85 A;  5E9V A;  5A5N A;  4HBY A;  3S92 A;  3UVD A;  5FH7 A;  4YC9 A;  5F36 A;  4BW2 A;  5F60 A;  4MR4 A;  4LYW A;  5LUU A;  5FB0 A;  4FLP A;  5D26 A;  4O7B A;  4NS5 A;  5FDZ A;  5I40 A;  1ZS5 A;  5EPR A;  5EWH A;  5F2P A;  3LXJ A;  5LJ0 A;  4UIT A;  5COI A;  4YBT A;  4HXP A;  4ZQL A;  4TS8 A;  4YH4 A;  3JVL A;  5CRZ A;  4O70 A;  5I83 A;  3SVH A;  4IR3 A;  4QSX A;  5EP7 A;  5CY9 A;  4QEV A;  3O36 A;  5DFB A;  3FKM X;  4TTE A;  5IID A;  3UVW A;  2DVS A;  4XY8 A;  5CPE A;  5C8G A;  5I88 A;  2RI7 A;  5EGU A;  4LZ2 A;  4O75 A;  2E7N A;  4NQN A;  3JVJ A;  4ZW1 A;  4NXJ A;  2NXB A;  5IGM A;  5F5Z A;  2E7O A;  5CQT A;  3K2J A;  5CGP A;  5I80 A;  5A5S A;  1WUM A;  4BW4 A;  5EWD A;  4O7C A;  4HXS A;  5CU8 A;  4YYK A;  5A85 A;  3O34 A;  2R10 A;  4Y03 A;  5FFW A;  2I8N A;  5K29 A;  5D3S A;  5ENJ A;  5HJC A;  5H1T A;  2DKW A;  5AD3 A;  5LJ1 A;  1N72 A;  4A9K A;  5L98 A;  5CQ5 A;  4YBS A;  4NR4 A;  5D3P A;  3O37 A;  5BT5 A;  1X0J A;  1EQF A;  4UIZ A;  5D24 A;  4QC1 A;  5ENE A;  4YAB A;  5CQ4 A;  5IG6 A;  4NQM A;  3UVY A;  4IOQ A;  2E3K A;  3QZV A;  4LYI A;  5D3J A;  4QSQ A;  3SVG A;  2OSS A;  5F62 A;  5D0C A;  5C4Q A;  5EWW A;  5D3R A;  5LKX A;  2RNY A;  3GG3 A;  3LQH A;  4HBV A;  5CQA A;  5DW1 A;  2WP2 A;  5DX4 A;  2YW5 A;  4CUS A;  3LQJ A;  2R0Y A;  2DAT A;  4TQN A;  4BW1 A;  4O7E A;  4PCI A;  4OUF A;  5FE6 A;  2YDW A;  4QUT A;  2RO1 A;  3MUL A;  4A9L A;  4A9O A;  4YYI A;  4UYH A;  5FB1 A;  4UYD A;  3G0J A;  5FH8 A;  1JSP B;  4CUQ A;  1F68 A;  4TT4 A;  4QC3 A;  5II2 A;  4AKN A;  4QSU A;  4A9I A;  4A9N A;  4YYN A;  4MR3 A;  5CQ8 A;  4A9M A;  4N4I A;  4X2I A;  5CQ3 A;  5DY7 A;  4PCE A;  5ENC A;  2KTB B;  4O71 A;  4CUP A;  5HQ7 A;  5DW2 A;  4YYM A;  4XUB A;  3MB3 A;  5IBN A;  4Z6H A;  1JM4 B;  5E9I A;  3I3J A;  5FG6 A;  4J0R A;  3O35 A;  5EIC A;  2R0V A;  4QR4 A;  4RVR A;  2DVV A;  5CUB A;  4O74 A;  3P1C A;  4N3W A;  5FE4 A;  5DYC A;  5ENG A;  5I7X A;  3U5J A;  3MUK A;  3HMF A;  5F1H A;  5C7N A;  2LSP B;  5CRM A;  4UYE A;  3U5K A;  5HRX A;  5EK9 A;  5H1U A;  4O78 A;  5HEM A;  4YYD A;  5FFV A;  3SVF A;  4QNS A;  5CS8 A;  5FBX A;  5FE1 A;  5E9L A;  3MB4 A;  5CUE A;  5KHM A;  4O72 A;  5LKU A;  3DWY A;  3LJW A;  4HXK A;  2F6N A;  5LKT A;  4LZR A;  5I7Y A;  2RNW A;  4QZS A;  2H60 A;  5DFD A;  4QSW A;  5FE9 A;  5DKH A;  2YEL A;  4LDF A;  2G4A A;  5C85 A;  5E73 A;  3UV2 A;  4YYJ A;  5JWM A;  5FG4 A;  4CUT A;  4LZS A;  4TT6 A;  3UV4 A;  2FSA A;  5II1 A;  5I29 A;  4CL9 A;  4CUR A;  5L8U A;  4YAX A;  3JVM A;  4IOR A;  3UVX A;  4NUC A;  5G4S A;  4YK0 A;  2F6J A;  4MR6 A;  5LJ2 A;  4MEN A;  3MQM A;  4NR6 A;  4QY4 A;  3RCW A;  2L85 A;  4LRG A;  5FE0 A;  4J0S A;  5DLZ A;  5E9K A;  4XUA A;  4NR9 A;  5HRV A;  4WHU A;  2L5E A;  4MEQ A;  5KU3 A;  2WP1 A;  4F3I A;  5D25 A;  4QR3 A;  4C67 A;  5LKZ A;  5HFQ A;  5DBM A;  4YH3 A;  4QR5 A;  4LR6 A;  4KCX A;  2RFJ A;  4IOO A;  5A5O A;  5A7C A;  4XYA A;  3NXB A;  4NRB A;  3S91 A;  5CQ6 A;  4HXR A;  4J1P A;  4UYF A;  4A9J A;  5AMF A;  4HBX A;  5CP5 A;  4BJX A;  2D9E A;  2OO1 A;  2D82 A;  5TB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...