5FH8A

Crystal structure of the fifth bromodomain of human pb1 in complex with compound 28
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Identification and Development of 2,3-Dihydropyrrolo[1,2-a]quinazolin-5(1H)-one Inhibitors Targeting Bromodomains within the Switch/Sucrose Nonfermenting Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fh8A00
5DBMA 5A5NA 3SVGA 5TB6A 5KHMA 5D3JA 5KO4A 4ALGA 4TT4A 5F63A 4QC1A 2E3KA 5EA1A 1JSPB 4HXKA 2E7OA 3MXFA 5ETDA 5FBXA 5EWCA 3HMEA 4Z6HA 4MENA 3UVYA 2R0YA 4LYSA 5H1VA 5TCMA 5D0CA 5E74A 4N4GA 4WHWA 2YEMA 5L99A 4NRCA 4HXOA 4YBSA 4QUUA 4TTEA 2YDWA 4O75A 5H85A 4ZC9A 4UIXA 4BW4A 3P1FA 5EPRA 5E7DA 3O35A 4QEUA 5ENJA 5CQ5A 5ENCA 5LKZA 5F25A 3U5KA 5L97A 4NYXA 5L8TA 3O33A 5FE8A 5I40A 5ENBA 4ALHA 5EQ1A 4NR4A 5D3NA 5AD2A 4QY4A 4UITA 4YYJA 4NR6A 4NR5A 4AKNA 4OGJA 4UIZA 2DVRA 4O77A 4PS5A 3DWYA 3U5OA 4UIVA 4MEQA 5FH6A 5HQ7A 5COIA 4LZ2A 1JM4B 4Q0NA 5EU1A 5EK9A 2L85A 4QSTA 4NUCA 4QSSA 5E9LA 5EV9A 2WP2A 5FH7A 2L84A 4NUEA 5C87A 4A9NA 4C67A 5KU3A 3RCWA 3Q2EA 4NYVA 4CFLA 5D3PA 3JVMA 4J3IA 5F36A 5DKHA 2F6JA 5I7YA 4YATA 4YYNA 4QR5A 3HMHA 4A9EA 4HXSA 3MB4A 5CQAA 3JVLA 3UVWA 4YYIA 5ENGA 2RO1A 4QSUA 5A5SA 4O7AA 3UW9A 4KCXA 5ETBA 4MEOA 5BT5A 5FE6A 3UVDA 3LQJA 3IU6A 4WIVA 4HBXA 4Q0OA 5CQ8A 5EPBA 5FE1A 5E9YA 2D82A 4BW1A 5F60A 5LVQA 5CUGA 3G0LA 5ACYA 5HFRA 2DATA 5F1LA 3JVKA 4A9MA 5F62A 3LQIA 4QSWA 5D25A 4O78A 4XY8A 5C4QA 5KTXA 4J1PA 5E73A 5CQ6A 5D26A 5LJ0A 5L8UA 2FSAA 5I29A 1WUMA 3S92A 4LZSA 4MEPA 3U5PA 4N4FA 4YBMA 5HLSA 5KTUA 4J0SA 5F61A 5HELA 3UV5A 3QZTA 4QC3A 5HQ6A 4TZ2A 4Y03A 4MR3A 5HJCA 4A9OA 2RNYA 2YQDA 5CZGA 5J0DA 4YAXA 4TU4A 4UIYA 4N4IA 5D3LA 5I1QA 5E3DA 4XUBA 4TZ8A 5CGPA 5CY9A 5LKUA 4OGIA 5FDZA 4HXMA 5CFWA 4YYKA 5LKXA 5CU8A 5LVRA 5HFQA 5LKTA 4QSVA 4A9JA 2OUOA 5K29A 4UYFA 4QSPA 2DVVA 5EP7A 4TT2A 5LJ1A 5EWHA 4XY9A 5H1TA 2N9GA 3O34A 5HM0A 5D24A 4O72A 4HBWA 4E96A 5A85A 4Z1QA 5IBNA 5A81A 4DONA 1N72A 4IOOA 2E7NA 3O37A 5FFVA 4TYLA 4CURA 4TT6A 4IORA 5AD3A 5DFDA 3U5MA 3UVXA 5DYCA 5FG4A 4CUTA 5I83A 5CP5A 5C8GA 4O71A 4UIUA 4YK0A 4QNSA 5E9IA 4YC9A 5F2PA 3Q2FA 2OO1A 4QYDA 5I89A 4Z93A 3U5JA 5BT4A 5EVAA 5IGKA 5FFWA 4O7EA 4PKLA 2R0VA 5I86A 2RNXA 4O7CA 5DFCA 5DKCA 4IR5A 5IGMA 4YYGA 2L5EA 4QSXA 5EISA 4RVRA 4HXLA 4HBVA 2RS9B 5FE5A 5LJ2A 3FKMX 4A9FA 4A9IA 5H1UA 5EI4A 5HCLA 4ZQLA 2G4AA 4ZW1A 5EWWA 4YBTA 5A5OA 5C7NA 2YEKA 4LR6A 5JI8A 5A7CA 4UYFB 5CQ7A 3TLPA 5HENA 3SVFA 4UYDA 5IG6A 3U5NA 5IGNA 4A9HA 4TQNA 3K2JA 4BW3A 5G4SA 5A83A 3D7CA 3U5LA 4CLBA 1EQFA 2R10A 5D3RA 4UYHA 5IIDA 5FB0A 2I8NA 5II2A 4YY6A 5CUBA 5DX4A 1E6IA 2GRCA 4YH4A 5DLZA 5C89A 5HQ5A 4Z6IA 4QEVA 5L96A 5CUEA 5DKDA 4PTBA 3S91A 3P5OA 5FE3A 4CUSA 5ENFA 4UYEA 4N4HA 5DYXA 5FE2A 2YYNA 4QYLA 3P1DA 5HRWA 4CFKA 2I7KA 4QR3A 3LXJA 5CQTA 5ENHA 5CUDA 4GPJA 4NQMA 4WHUA 4IR6A 5D3TA 5A5RA 5E9MA 4QSQA 5ENIA 4A9KA 2R0SA 4F3IA 4XUAA 5DFBA 5HRXA 5FB1A 1ZS5A 2RI7A 3I3JA 3MULA 4NRBA 4BW2A 2WP1A 4YYHA 5BT3A 4YH3A 1X0JA 5CUCA 3DAIA 5FE9A 3GG3A 5CRMA 4LC2A 5CUAA 5DYAA 5DW2A 5DLXA 2DWWA 4A9LA 4O76A 4LRGA 5JWMA 4CUPA 5EGUA 4X2IA 4KV4A 4NRAA 4QR4A 4LZRA 4LYWA 5I88A 4OUFA 5ENEA 5FE0A 4QBMA 2DVQA 4LDFA 4MR5A 4BJXA 2H60A 2NXBA 2YW5A 4YYMA 4PY6A 4NXJA 4XYAA 4NQNA 4PCEA 4UIWA 2D9EA 4TU6A 2OSSA 3QZSA 5EWDA 4QUTA 2KTBB 3P1CA 5FFYA 4BHWA 4HXRA 5CPEA 4LYIA 4YY4A 5CTLA 4HBYA 5E0RA 5EICA 4KV1A 3MB3A 4FLPA 5EWVA 4YABA 5CQ3A 5FH8A 5A82A 2YELA 4C66A 4QZSA 3ZYUA 5A5PA 3G0JA 4IR3A 5II1A 4IOQA 5HRVA 2RFJA 3IU5A 5EPSA 2DVSA 5DY7A 5I7XA 5FE7A 5LUUA 4NYWA 4NR7A 4N3WA 3MUKA 4CUUA 5F1HA 4IR4A 2F6NA 5G4RA 3UV4A 5FE4A 4CL9A 4UYGA 4HXNA 1WUGA 3NXBA 2MJVB 4NS5A 4MR6A 5FG6A 3JVJA 2RNWA 1F68A 5F5ZA 3LJWA 4QB3A 4NR9A 5DYUA 3HMFA 5CRZA 4Z1SA 4O74A 4QSRA 4TS8A 3AQAA 4HXPA 4MR4A 5KTWA 3UV2A 4PCIA 5CQ4A 2DKWA 5HEMA 5AMEA 5C85A 5D3HA 5L98A 3P1EA 4NR8A 3MQMA 4O7FA 5AMFA 4QEWA 4YADA 5D3SA 5FG5A 5IGLA 5E3GA 5DW1A 3AADA 5E9VA 4O70A 5F3AA 3SVHA 3ONIA 5I80A 3O36A 5E9KA 4YYDA 3QZVA 5A5QA 4NUDA 2LSPB 5EM3A 4CUQA 4J0RA 4O7BA 5D7XA 5CS8A 3LQHA
chains in the Genus database with same CATH superfamily
5DBMA 5A5NA 3SVGA 5TB6A 5KHMA 5D3JA 5KO4A 4ALGA 4TT4A 5F63A 4QC1A 2E3KA 5EA1A 1JSPB 4HXKA 2E7OA 3MXFA 5ETDA 5FBXA 5EWCA 3HMEA 4Z6HA 4MENA 3UVYA 2R0YA 4LYSA 5H1VA 5TCMA 5D0CA 5E74A 4N4GA 4WHWA 2YEMA 5L99A 4NRCA 4HXOA 4YBSA 4QUUA 4TTEA 2YDWA 4O75A 5H85A 4ZC9A 4UIXA 4BW4A 3P1FA 5EPRA 5E7DA 3O35A 4QEUA 5ENJA 5CQ5A 5ENCA 5LKZA 5F25A 3U5KA 5L97A 4NYXA 5L8TA 3O33A 5FE8A 5I40A 5ENBA 4ALHA 5EQ1A 4NR4A 5D3NA 5AD2A 4QY4A 4UITA 4YYJA 4NR6A 4NR5A 4AKNA 4OGJA 4UIZA 2DVRA 4O77A 4PS5A 3DWYA 3U5OA 4UIVA 4MEQA 5FH6A 5HQ7A 5COIA 4LZ2A 1JM4B 3VKHA 4Q0NA 5EU1A 5EK9A 2L85A 4QSTA 4NUCA 4QSSA 5E9LA 5EV9A 2WP2A 5FH7A 2L84A 4NUEA 5C87A 4A9NA 4C67A 5KU3A 3RCWA 3Q2EA 4NYVA 4CFLA 5D3PA 3JVMA 4J3IA 5F36A 5DKHA 2F6JA 5I7YA 4YATA 4YYNA 4QR5A 3HMHA 4A9EA 3D1DA 4HXSA 3MB4A 5CQAA 3JVLA 3UVWA 4YYIA 5ENGA 2RO1A 4QSUA 5A5SA 4O7AA 3UW9A 4KCXA 5ETBA 4MEOA 5BT5A 5FE6A 3UVDA 3LQJA 3IU6A 4WIVA 4HBXA 4Q0OA 5CQ8A 5EPBA 5FE1A 5E9YA 2D82A 4BW1A 5F60A 5LVQA 5CUGA 3G0LA 5ACYA 5HFRA 2DATA 5F1LA 3JVKA 4A9MA 5F62A 3LQIA 4QSWA 5D25A 4O78A 4XY8A 5C4QA 5KTXA 4J1PA 5E73A 5CQ6A 5D26A 5LJ0A 5L8UA 2FSAA 5I29A 1WUMA 3S92A 4LZSA 4MEPA 3U5PA 4N4FA 4YBMA 5HLSA 5KTUA 4J0SA 5F61A 5HELA 3UV5A 3QZTA 3VKGA 4QC3A 5HQ6A 4TZ2A 4Y03A 4MR3A 5HJCA 4A9OA 2RNYA 2YQDA 5CZGA 5J0DA 4YAXA 4TU4A 4UIYA 4N4IA 5D3LA 5I1QA 4AKGA 5E3DA 4XUBA 4TZ8A 5CGPA 5CY9A 5LKUA 4OGIA 5FDZA 4HXMA 5CFWA 4YYKA 5LKXA 5CU8A 5LVRA 5HFQA 5LKTA 4QSVA 4A9JA 2OUOA 5K29A 4UYFA 4QSPA 2DVVA 5EP7A 4TT2A 5LJ1A 5EWHA 4XY9A 5H1TA 2N9GA 3O34A 5HM0A 5D24A 4O72A 4HBWA 2EJNA 4E96A 5A85A 4Z1QA 5IBNA 5A81A 4DONA 1N72A 4IOOA 2E7NA 3O37A 5FFVA 4TYLA 4CURA 4TT6A 4IORA 5AD3A 5DFDA 3U5MA 3UVXA 3ERRA 5DYCA 5FG4A 4CUTA 5I83A 5CP5A 5C8GA 4O71A 4UIUA 4YK0A 4QNSA 5E9IA 4YC9A 5F2PA 3Q2FA 2OO1A 4QYDA 5I89A 4Z93A 3U5JA 5BT4A 5EVAA 5IGKA 5FFWA 4O7EA 4PKLA 2R0VA 5I86A 4AKIA 2RNXA 4O7CA 5DFCA 5DKCA 4IR5A 5IGMA 4YYGA 2L5EA 4QSXA 5EISA 4RVRA 4HXLA 4HBVA 2RS9B 5FE5A 5LJ2A 3FKMX 4A9FA 4A9IA 5H1UA 5EI4A 5HCLA 4ZQLA 2G4AA 4ZW1A 5EWWA 4YBTA 5A5OA 5C7NA 2YEKA 4LR6A 5JI8A 5A7CA 4UYFB 5CQ7A 3TLPA 5HENA 3SVFA 4UYDA 5IG6A 3U5NA 5IGNA 4A9HA 4TQNA 3K2JA 4BW3A 5G4SA 5A83A 3D7CA 3U5LA 4CLBA 1EQFA 2R10A 5D3RA 4UYHA 5IIDA 5FB0A 2I8NA 5II2A 4YY6A 5CUBA 5DX4A 1E6IA 2GRCA 4YH4A 5DLZA 5C89A 5HQ5A 4Z6IA 4QEVA 5L96A 5CUEA 5DKDA 4PTBA 3S91A 3P5OA 5FE3A 4CUSA 5ENFA 4UYEA 4N4HA 5DYXA 5FE2A 2YYNA 4QYLA 3P1DA 5HRWA 4CFKA 2I7KA 4QR3A 3LXJA 5CQTA 5ENHA 5CUDA 4GPJA 4NQMA 4WHUA 4IR6A 5D3TA 5A5RA 5E9MA 4QSQA 5ENIA 4A9KA 2R0SA 4F3IA 4XUAA 5DFBA 5HRXA 5FB1A 1ZS5A 2RI7A 3I3JA 3MULA 4NRBA 4BW2A 2WP1A 4YYHA 5BT3A 4YH3A 1X0JA 5CUCA 3DAIA 5FE9A 3GG3A 5CRMA 4LC2A 5CUAA 5DYAA 5DW2A 5DLXA 2DWWA 4A9LA 4O76A 4LRGA 5JWMA 4CUPA 5EGUA 4X2IA 4KV4A 4NRAA 4QR4A 4LZRA 4LYWA 4AKHA 5I88A 4OUFA 5ENEA 5FE0A 4QBMA 2DVQA 4LDFA 4MR5A 4BJXA 2H60A 2NXBA 2YW5A 4YYMA 4PY6A 4NXJA 4XYAA 4NQNA 4PCEA 4UIWA 2D9EA 4TU6A 2OSSA 3QZSA 5EWDA 4AI6A 4QUTA 2KTBB 3P1CA 5FFYA 4BHWA 4HXRA 5CPEA 4LYIA 4YY4A 5CTLA 4HBYA 5E0RA 5EICA 4KV1A 3MB3A 4FLPA 5EWVA 4YABA 5CQ3A 5FH8A 5A82A 2YELA 4C66A 4QZSA 3ZYUA 5A5PA 3G0JA 4IR3A 5II1A 4IOQA 5HRVA 2RFJA 3IU5A 5EPSA 2DVSA 5DY7A 5I7XA 5FE7A 5LUUA 4NYWA 4NR7A 4N3WA 3MUKA 4CUUA 5F1HA 4IR4A 2F6NA 5G4RA 3UV4A 5FE4A 4CL9A 4UYGA 4HXNA 1WUGA 3NXBA 2MJVB 4NS5A 4MR6A 5FG6A 3JVJA 2RNWA 1F68A 5F5ZA 3LJWA 4QB3A 4NR9A 5DYUA 3HMFA 5CRZA 4Z1SA 4O74A 4QSRA 4TS8A 3AQAA 4HXPA 4MR4A 5KTWA 3UV2A 4PCIA 5CQ4A 2DKWA 5HEMA 5AMEA 5C85A 5D3HA 5L98A 3P1EA 4NR8A 3MQMA 3D1BA 4O7FA 5AMFA 4QEWA 4YADA 5D3SA 5FG5A 5IGLA 5E3GA 5DW1A 3AADA 5E9VA 4O70A 5F3AA 3SVHA 3ONIA 5I80A 3O36A 5E9KA 4YYDA 3QZVA 5A5QA 4NUDA 2LSPB 5EM3A 4CUQA 1PUOA 4J0RA 4O7BA 1ZKRA 5D7XA 5CS8A 3LQHA
chains in the Genus database with same CATH topology
5DBMA 5A5NA 3SVGA 5TB6A 5KHMA 5D3JA 5KO4A 4ALGA 4TT4A 5F63A 4QC1A 2E3KA 5EA1A 1JSPB 4HXKA 2E7OA 3MXFA 5ETDA 5FBXA 5EWCA 3HMEA 4Z6HA 4MENA 3UVYA 2R0YA 4LYSA 5H1VA 5TCMA 5D0CA 5E74A 4N4GA 4WHWA 2YEMA 5L99A 4NRCA 4HXOA 4YBSA 4QUUA 4TTEA 2YDWA 4O75A 5H85A 4ZC9A 4UIXA 4BW4A 3P1FA 5EPRA 5E7DA 3O35A 4QEUA 5ENJA 5CQ5A 5ENCA 5LKZA 5F25A 3U5KA 5L97A 4NYXA 5L8TA 3O33A 5FE8A 5I40A 5ENBA 4ALHA 5EQ1A 4NR4A 5D3NA 5AD2A 4QY4A 4UITA 4YYJA 4NR6A 4NR5A 4AKNA 4OGJA 4UIZA 2DVRA 4O77A 4PS5A 3DWYA 3U5OA 4UIVA 4MEQA 5FH6A 5HQ7A 5COIA 4LZ2A 1JM4B 4Q0NA 5EU1A 5EK9A 2L85A 4QSTA 4NUCA 4QSSA 5E9LA 5EV9A 2WP2A 5FH7A 2L84A 4NUEA 5C87A 4A9NA 4C67A 5KU3A 3RCWA 3Q2EA 4NYVA 4CFLA 5D3PA 3JVMA 4J3IA 5F36A 5DKHA 2F6JA 5I7YA 4YATA 4YYNA 4QR5A 3HMHA 4A9EA 4HXSA 3MB4A 5CQAA 3JVLA 3UVWA 4YYIA 5ENGA 2RO1A 4QSUA 5A5SA 4O7AA 3UW9A 4KCXA 5ETBA 4MEOA 5BT5A 5FE6A 3UVDA 3LQJA 3IU6A 4WIVA 4HBXA 4Q0OA 5CQ8A 5EPBA 5FE1A 5E9YA 2D82A 4BW1A 5F60A 5LVQA 5CUGA 3G0LA 5ACYA 5HFRA 2DATA 5F1LA 3JVKA 4A9MA 5F62A 3LQIA 4QSWA 5D25A 4O78A 4XY8A 5C4QA 5KTXA 4J1PA 5E73A 5CQ6A 5D26A 5LJ0A 5L8UA 2FSAA 5I29A 1WUMA 3S92A 4LZSA 4MEPA 3U5PA 4N4FA 4YBMA 5HLSA 5KTUA 4J0SA 5F61A 5HELA 3UV5A 3QZTA 4QC3A 5HQ6A 4TZ2A 4Y03A 4MR3A 5HJCA 4A9OA 2RNYA 2YQDA 5CZGA 5J0DA 4YAXA 4TU4A 4UIYA 4N4IA 5D3LA 5I1QA 5E3DA 4XUBA 4TZ8A 5CGPA 5CY9A 5LKUA 4OGIA 5FDZA 4HXMA 5CFWA 4YYKA 5LKXA 5CU8A 5LVRA 5HFQA 5LKTA 4QSVA 4A9JA 2OUOA 5K29A 4UYFA 4QSPA 2DVVA 5EP7A 4TT2A 5LJ1A 5EWHA 4XY9A 5H1TA 2N9GA 3O34A 5HM0A 5D24A 4O72A 4HBWA 4E96A 5A85A 4Z1QA 5IBNA 5A81A 4DONA 1N72A 4IOOA 2E7NA 3O37A 5FFVA 4TYLA 4CURA 4TT6A 4IORA 5AD3A 5DFDA 3U5MA 3UVXA 5DYCA 5FG4A 4CUTA 5I83A 5CP5A 5C8GA 4O71A 4UIUA 4YK0A 4QNSA 5E9IA 4YC9A 5F2PA 3Q2FA 2OO1A 4QYDA 5I89A 4Z93A 3U5JA 5BT4A 5EVAA 5IGKA 5FFWA 4O7EA 4PKLA 2R0VA 5I86A 2RNXA 4O7CA 5DFCA 5DKCA 4IR5A 5IGMA 4YYGA 2L5EA 4QSXA 5EISA 4RVRA 4HXLA 4HBVA 2RS9B 5FE5A 5LJ2A 3FKMX 4A9FA 4A9IA 5H1UA 5EI4A 5HCLA 4ZQLA 2G4AA 4ZW1A 5EWWA 4YBTA 5A5OA 5C7NA 2YEKA 4LR6A 5JI8A 5A7CA 4UYFB 5CQ7A 3TLPA 5HENA 3SVFA 4UYDA 5IG6A 3U5NA 5IGNA 4A9HA 4TQNA 3K2JA 4BW3A 5G4SA 5A83A 3D7CA 3U5LA 4CLBA 1EQFA 2R10A 5D3RA 4UYHA 5IIDA 5FB0A 2I8NA 5II2A 4YY6A 5CUBA 5DX4A 1E6IA 2GRCA 4YH4A 5DLZA 5C89A 5HQ5A 4Z6IA 4QEVA 5L96A 5CUEA 5DKDA 4PTBA 3S91A 3P5OA 5FE3A 4CUSA 5ENFA 4UYEA 4N4HA 5DYXA 5FE2A 2YYNA 4QYLA 3P1DA 5HRWA 4CFKA 2I7KA 4QR3A 3LXJA 5CQTA 5ENHA 5CUDA 4GPJA 4NQMA 4WHUA 4IR6A 5D3TA 5A5RA 5E9MA 4QSQA 5ENIA 4A9KA 2R0SA 4F3IA 4XUAA 5DFBA 5HRXA 5FB1A 1ZS5A 2RI7A 3I3JA 3MULA 4NRBA 4BW2A 2WP1A 4YYHA 5BT3A 4YH3A 1X0JA 5CUCA 3DAIA 5FE9A 3GG3A 5CRMA 4LC2A 5CUAA 5DYAA 5DW2A 5DLXA 2DWWA 4A9LA 4O76A 4LRGA 5JWMA 4CUPA 5EGUA 4X2IA 4KV4A 4NRAA 4QR4A 4LZRA 4LYWA 5I88A 4OUFA 5ENEA 5FE0A 4QBMA 2DVQA 4LDFA 4MR5A 4BJXA 2H60A 2NXBA 2YW5A 4YYMA 4PY6A 4NXJA 4XYAA 4NQNA 4PCEA 4UIWA 2D9EA 4TU6A 2OSSA 3QZSA 5EWDA 4QUTA 2KTBB 3P1CA 5FFYA 4BHWA 4HXRA 5CPEA 4LYIA 4YY4A 5CTLA 4HBYA 5E0RA 5EICA 4KV1A 3MB3A 4FLPA 5EWVA 4YABA 5CQ3A 5FH8A 5A82A 2YELA 4C66A 4QZSA 3ZYUA 5A5PA 3G0JA 4IR3A 5II1A 4IOQA 5HRVA 2RFJA 3IU5A 5EPSA 2DVSA 5DY7A 5I7XA 5FE7A 5LUUA 4NYWA 4NR7A 4N3WA 3MUKA 4CUUA 5F1HA 4IR4A 2F6NA 5G4RA 3UV4A 5FE4A 4CL9A 4UYGA 4HXNA 1WUGA 3NXBA 2MJVB 4NS5A 4MR6A 5FG6A 3JVJA 2RNWA 1F68A 5F5ZA 3LJWA 4QB3A 4NR9A 5DYUA 3HMFA 5CRZA 4Z1SA 4O74A 4QSRA 4TS8A 3AQAA 4HXPA 4MR4A 5KTWA 3UV2A 4PCIA 5CQ4A 2DKWA 5HEMA 5AMEA 5C85A 5D3HA 5L98A 3P1EA 4NR8A 3MQMA 4O7FA 5AMFA 4QEWA 4YADA 5D3SA 5FG5A 5IGLA 5E3GA 5DW1A 3AADA 5E9VA 4O70A 5F3AA 3SVHA 3ONIA 5I80A 3O36A 5E9KA 4YYDA 3QZVA 5A5QA 4NUDA 2LSPB 5EM3A 4CUQA 4J0RA 4O7BA 5D7XA 5CS8A 3LQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBM A;  5A5N A;  3SVG A;  5TB6 A;  5KHM A;  5D3J A;  5KO4 A;  4ALG A;  4TT4 A;  5F63 A;  4QC1 A;  2E3K A;  5EA1 A;  1JSP B;  4HXK A;  2E7O A;  3MXF A;  5ETD A;  5FBX A;  5EWC A;  3HME A;  4Z6H A;  4MEN A;  3UVY A;  2R0Y A;  4LYS A;  5H1V A;  5TCM A;  5D0C A;  5E74 A;  4N4G A;  4WHW A;  2YEM A;  5L99 A;  4NRC A;  4HXO A;  4YBS A;  4QUU A;  4TTE A;  2YDW A;  4O75 A;  5H85 A;  4ZC9 A;  4UIX A;  4BW4 A;  3P1F A;  5EPR A;  5E7D A;  3O35 A;  4QEU A;  5ENJ A;  5CQ5 A;  5ENC A;  5LKZ A;  5F25 A;  3U5K A;  5L97 A;  4NYX A;  5L8T A;  3O33 A;  5FE8 A;  5I40 A;  5ENB A;  4ALH A;  5EQ1 A;  4NR4 A;  5D3N A;  5AD2 A;  4QY4 A;  4UIT A;  4YYJ A;  4NR6 A;  4NR5 A;  4AKN A;  4OGJ A;  4UIZ A;  2DVR A;  4O77 A;  4PS5 A;  3DWY A;  3U5O A;  4UIV A;  4MEQ A;  5FH6 A;  5HQ7 A;  5COI A;  4LZ2 A;  1JM4 B;  4Q0N A;  5EU1 A;  5EK9 A;  2L85 A;  4QST A;  4NUC A;  4QSS A;  5E9L A;  5EV9 A;  2WP2 A;  5FH7 A;  2L84 A;  4NUE A;  5C87 A;  4A9N A;  4C67 A;  5KU3 A;  3RCW A;  3Q2E A;  4NYV A;  4CFL A;  5D3P A;  3JVM A;  4J3I A;  5F36 A;  5DKH A;  2F6J A;  5I7Y A;  4YAT A;  4YYN A;  4QR5 A;  3HMH A;  4A9E A;  4HXS A;  3MB4 A;  5CQA A;  3JVL A;  3UVW A;  4YYI A;  5ENG A;  2RO1 A;  4QSU A;  5A5S A;  4O7A A;  3UW9 A;  4KCX A;  5ETB A;  4MEO A;  5BT5 A;  5FE6 A;  3UVD A;  3LQJ A;  3IU6 A;  4WIV A;  4HBX A;  4Q0O A;  5CQ8 A;  5EPB A;  5FE1 A;  5E9Y A;  2D82 A;  4BW1 A;  5F60 A;  5LVQ A;  5CUG A;  3G0L A;  5ACY A;  5HFR A;  2DAT A;  5F1L A;  3JVK A;  4A9M A;  5F62 A;  3LQI A;  4QSW A;  5D25 A;  4O78 A;  4XY8 A;  5C4Q A;  5KTX A;  4J1P A;  5E73 A;  5CQ6 A;  5D26 A;  5LJ0 A;  5L8U A;  2FSA A;  5I29 A;  1WUM A;  3S92 A;  4LZS A;  4MEP A;  3U5P A;  4N4F A;  4YBM A;  5HLS A;  5KTU A;  4J0S A;  5F61 A;  5HEL A;  3UV5 A;  3QZT A;  4QC3 A;  5HQ6 A;  4TZ2 A;  4Y03 A;  4MR3 A;  5HJC A;  4A9O A;  2RNY A;  2YQD A;  5CZG A;  5J0D A;  4YAX A;  4TU4 A;  4UIY A;  4N4I A;  5D3L A;  5I1Q A;  5E3D A;  4XUB A;  4TZ8 A;  5CGP A;  5CY9 A;  5LKU A;  4OGI A;  5FDZ A;  4HXM A;  5CFW A;  4YYK A;  5LKX A;  5CU8 A;  5LVR A;  5HFQ A;  5LKT A;  4QSV A;  4A9J A;  2OUO A;  5K29 A;  4UYF A;  4QSP A;  2DVV A;  5EP7 A;  4TT2 A;  5LJ1 A;  5EWH A;  4XY9 A;  5H1T A;  2N9G A;  3O34 A;  5HM0 A;  5D24 A;  4O72 A;  4HBW A;  4E96 A;  5A85 A;  4Z1Q A;  5IBN A;  5A81 A;  4DON A;  1N72 A;  4IOO A;  2E7N A;  3O37 A;  5FFV A;  4TYL A;  4CUR A;  4TT6 A;  4IOR A;  5AD3 A;  5DFD A;  3U5M A;  3UVX A;  5DYC A;  5FG4 A;  4CUT A;  5I83 A;  5CP5 A;  5C8G A;  4O71 A;  4UIU A;  4YK0 A;  4QNS A;  5E9I A;  4YC9 A;  5F2P A;  3Q2F A;  2OO1 A;  4QYD A;  5I89 A;  4Z93 A;  3U5J A;  5BT4 A;  5EVA A;  5IGK A;  5FFW A;  4O7E A;  4PKL A;  2R0V A;  5I86 A;  2RNX A;  4O7C A;  5DFC A;  5DKC A;  4IR5 A;  5IGM A;  4YYG A;  2L5E A;  4QSX A;  5EIS A;  4RVR A;  4HXL A;  4HBV A;  2RS9 B;  5FE5 A;  5LJ2 A;  3FKM X;  4A9F A;  4A9I A;  5H1U A;  5EI4 A;  5HCL A;  4ZQL A;  2G4A A;  4ZW1 A;  5EWW A;  4YBT A;  5A5O A;  5C7N A;  2YEK A;  4LR6 A;  5JI8 A;  5A7C A;  4UYF B;  5CQ7 A;  3TLP A;  5HEN A;  3SVF A;  4UYD A;  5IG6 A;  3U5N A;  5IGN A;  4A9H A;  4TQN A;  3K2J A;  4BW3 A;  5G4S A;  5A83 A;  3D7C A;  3U5L A;  4CLB A;  1EQF A;  2R10 A;  5D3R A;  4UYH A;  5IID A;  5FB0 A;  2I8N A;  5II2 A;  4YY6 A;  5CUB A;  5DX4 A;  1E6I A;  2GRC A;  4YH4 A;  5DLZ A;  5C89 A;  5HQ5 A;  4Z6I A;  4QEV A;  5L96 A;  5CUE A;  5DKD A;  4PTB A;  3S91 A;  3P5O A;  5FE3 A;  4CUS A;  5ENF A;  4UYE A;  4N4H A;  5DYX A;  5FE2 A;  2YYN A;  4QYL A;  3P1D A;  5HRW A;  4CFK A;  2I7K A;  4QR3 A;  3LXJ A;  5CQT A;  5ENH A;  5CUD A;  4GPJ A;  4NQM A;  4WHU A;  4IR6 A;  5D3T A;  5A5R A;  5E9M A;  4QSQ A;  5ENI A;  4A9K A;  2R0S A;  4F3I A;  4XUA A;  5DFB A;  5HRX A;  5FB1 A;  1ZS5 A;  2RI7 A;  3I3J A;  3MUL A;  4NRB A;  4BW2 A;  2WP1 A;  4YYH A;  5BT3 A;  4YH3 A;  1X0J A;  5CUC A;  3DAI A;  5FE9 A;  3GG3 A;  5CRM A;  4LC2 A;  5CUA A;  5DYA A;  5DW2 A;  5DLX A;  2DWW A;  4A9L A;  4O76 A;  4LRG A;  5JWM A;  4CUP A;  5EGU A;  4X2I A;  4KV4 A;  4NRA A;  4QR4 A;  4LZR A;  4LYW A;  5I88 A;  4OUF A;  5ENE A;  5FE0 A;  4QBM A;  2DVQ A;  4LDF A;  4MR5 A;  4BJX A;  2H60 A;  2NXB A;  2YW5 A;  4YYM A;  4PY6 A;  4NXJ A;  4XYA A;  4NQN A;  4PCE A;  4UIW A;  2D9E A;  4TU6 A;  2OSS A;  3QZS A;  5EWD A;  4QUT A;  2KTB B;  3P1C A;  5FFY A;  4BHW A;  4HXR A;  5CPE A;  4LYI A;  4YY4 A;  5CTL A;  4HBY A;  5E0R A;  5EIC A;  4KV1 A;  3MB3 A;  4FLP A;  5EWV A;  4YAB A;  5CQ3 A;  5FH8 A;  5A82 A;  2YEL A;  4C66 A;  4QZS A;  3ZYU A;  5A5P A;  3G0J A;  4IR3 A;  5II1 A;  4IOQ A;  5HRV A;  2RFJ A;  3IU5 A;  5EPS A;  2DVS A;  5DY7 A;  5I7X A;  5FE7 A;  5LUU A;  4NYW A;  4NR7 A;  4N3W A;  3MUK A;  4CUU A;  5F1H A;  4IR4 A;  2F6N A;  5G4R A;  3UV4 A;  5FE4 A;  4CL9 A;  4UYG A;  4HXN A;  1WUG A;  3NXB A;  2MJV B;  4NS5 A;  4MR6 A;  5FG6 A;  3JVJ A;  2RNW A;  1F68 A;  5F5Z A;  3LJW A;  4QB3 A;  4NR9 A;  5DYU A;  3HMF A;  5CRZ A;  4Z1S A;  4O74 A;  4QSR A;  4TS8 A;  3AQA A;  4HXP A;  4MR4 A;  5KTW A;  3UV2 A;  4PCI A;  5CQ4 A;  2DKW A;  5HEM A;  5AME A;  5C85 A;  5D3H A;  5L98 A;  3P1E A;  4NR8 A;  3MQM A;  4O7F A;  5AMF A;  4QEW A;  4YAD A;  5D3S A;  5FG5 A;  5IGL A;  5E3G A;  5DW1 A;  3AAD A;  5E9V A;  4O70 A;  5F3A A;  3SVH A;  3ONI A;  5I80 A;  3O36 A;  5E9K A;  4YYD A;  3QZV A;  5A5Q A;  4NUD A;  2LSP B;  5EM3 A;  4CUQ A;  4J0R A;  4O7B A;  5D7X A;  5CS8 A;  3LQH A; 
#chains in the Genus database with same CATH topology
 5DBM A;  5A5N A;  3SVG A;  5TB6 A;  5KHM A;  5D3J A;  5KO4 A;  4ALG A;  4TT4 A;  5F63 A;  4QC1 A;  2E3K A;  5EA1 A;  1JSP B;  4HXK A;  2E7O A;  3MXF A;  5ETD A;  5FBX A;  5EWC A;  3HME A;  4Z6H A;  4MEN A;  3UVY A;  2R0Y A;  4LYS A;  5H1V A;  5TCM A;  5D0C A;  5E74 A;  4N4G A;  4WHW A;  2YEM A;  5L99 A;  4NRC A;  4HXO A;  4YBS A;  4QUU A;  4TTE A;  2YDW A;  4O75 A;  5H85 A;  4ZC9 A;  4UIX A;  4BW4 A;  3P1F A;  5EPR A;  5E7D A;  3O35 A;  4QEU A;  5ENJ A;  5CQ5 A;  5ENC A;  5LKZ A;  5F25 A;  3U5K A;  5L97 A;  4NYX A;  5L8T A;  3O33 A;  5FE8 A;  5I40 A;  5ENB A;  4ALH A;  5EQ1 A;  4NR4 A;  5D3N A;  5AD2 A;  4QY4 A;  4UIT A;  4YYJ A;  4NR6 A;  4NR5 A;  4AKN A;  4OGJ A;  4UIZ A;  2DVR A;  4O77 A;  4PS5 A;  3DWY A;  3U5O A;  4UIV A;  4MEQ A;  5FH6 A;  5HQ7 A;  5COI A;  4LZ2 A;  1JM4 B;  3VKH A;  4Q0N A;  5EU1 A;  5EK9 A;  2L85 A;  4QST A;  4NUC A;  4QSS A;  5E9L A;  5EV9 A;  2WP2 A;  5FH7 A;  2L84 A;  4NUE A;  5C87 A;  4A9N A;  4C67 A;  5KU3 A;  3RCW A;  3Q2E A;  4NYV A;  4CFL A;  5D3P A;  3JVM A;  4J3I A;  5F36 A;  5DKH A;  2F6J A;  5I7Y A;  4YAT A;  4YYN A;  4QR5 A;  3HMH A;  4A9E A;  3D1D A;  4HXS A;  3MB4 A;  5CQA A;  3JVL A;  3UVW A;  4YYI A;  5ENG A;  2RO1 A;  4QSU A;  5A5S A;  4O7A A;  3UW9 A;  4KCX A;  5ETB A;  4MEO A;  5BT5 A;  5FE6 A;  3UVD A;  3LQJ A;  3IU6 A;  4WIV A;  4HBX A;  4Q0O A;  5CQ8 A;  5EPB A;  5FE1 A;  5E9Y A;  2D82 A;  4BW1 A;  5F60 A;  5LVQ A;  5CUG A;  3G0L A;  5ACY A;  5HFR A;  2DAT A;  5F1L A;  3JVK A;  4A9M A;  5F62 A;  3LQI A;  4QSW A;  5D25 A;  4O78 A;  4XY8 A;  5C4Q A;  5KTX A;  4J1P A;  5E73 A;  5CQ6 A;  5D26 A;  5LJ0 A;  5L8U A;  2FSA A;  5I29 A;  1WUM A;  3S92 A;  4LZS A;  4MEP A;  3U5P A;  4N4F A;  4YBM A;  5HLS A;  5KTU A;  4J0S A;  5F61 A;  5HEL A;  3UV5 A;  3QZT A;  3VKG A;  4QC3 A;  5HQ6 A;  4TZ2 A;  4Y03 A;  4MR3 A;  5HJC A;  4A9O A;  2RNY A;  2YQD A;  5CZG A;  5J0D A;  4YAX A;  4TU4 A;  4UIY A;  4N4I A;  5D3L A;  5I1Q A;  4AKG A;  5E3D A;  4XUB A;  4TZ8 A;  5CGP A;  5CY9 A;  5LKU A;  4OGI A;  5FDZ A;  4HXM A;  5CFW A;  4YYK A;  5LKX A;  5CU8 A;  5LVR A;  5HFQ A;  5LKT A;  4QSV A;  4A9J A;  2OUO A;  5K29 A;  4UYF A;  4QSP A;  2DVV A;  5EP7 A;  4TT2 A;  5LJ1 A;  5EWH A;  4XY9 A;  5H1T A;  2N9G A;  3O34 A;  5HM0 A;  5D24 A;  4O72 A;  4HBW A;  2EJN A;  4E96 A;  5A85 A;  4Z1Q A;  5IBN A;  5A81 A;  4DON A;  1N72 A;  4IOO A;  2E7N A;  3O37 A;  5FFV A;  4TYL A;  4CUR A;  4TT6 A;  4IOR A;  5AD3 A;  5DFD A;  3U5M A;  3UVX A;  3ERR A;  5DYC A;  5FG4 A;  4CUT A;  5I83 A;  5CP5 A;  5C8G A;  4O71 A;  4UIU A;  4YK0 A;  4QNS A;  5E9I A;  4YC9 A;  5F2P A;  3Q2F A;  2OO1 A;  4QYD A;  5I89 A;  4Z93 A;  3U5J A;  5BT4 A;  5EVA A;  5IGK A;  5FFW A;  4O7E A;  4PKL A;  2R0V A;  5I86 A;  4AKI A;  2RNX A;  4O7C A;  5DFC A;  5DKC A;  4IR5 A;  5IGM A;  4YYG A;  2L5E A;  4QSX A;  5EIS A;  4RVR A;  4HXL A;  4HBV A;  2RS9 B;  5FE5 A;  5LJ2 A;  3FKM X;  4A9F A;  4A9I A;  5H1U A;  5EI4 A;  5HCL A;  4ZQL A;  2G4A A;  4ZW1 A;  5EWW A;  4YBT A;  5A5O A;  5C7N A;  2YEK A;  4LR6 A;  5JI8 A;  5A7C A;  4UYF B;  5CQ7 A;  3TLP A;  5HEN A;  3SVF A;  4UYD A;  5IG6 A;  3U5N A;  5IGN A;  4A9H A;  4TQN A;  3K2J A;  4BW3 A;  5G4S A;  5A83 A;  3D7C A;  3U5L A;  4CLB A;  1EQF A;  2R10 A;  5D3R A;  4UYH A;  5IID A;  5FB0 A;  2I8N A;  5II2 A;  4YY6 A;  5CUB A;  5DX4 A;  1E6I A;  2GRC A;  4YH4 A;  5DLZ A;  5C89 A;  5HQ5 A;  4Z6I A;  4QEV A;  5L96 A;  5CUE A;  5DKD A;  4PTB A;  3S91 A;  3P5O A;  5FE3 A;  4CUS A;  5ENF A;  4UYE A;  4N4H A;  5DYX A;  5FE2 A;  2YYN A;  4QYL A;  3P1D A;  5HRW A;  4CFK A;  2I7K A;  4QR3 A;  3LXJ A;  5CQT A;  5ENH A;  5CUD A;  4GPJ A;  4NQM A;  4WHU A;  4IR6 A;  5D3T A;  5A5R A;  5E9M A;  4QSQ A;  5ENI A;  4A9K A;  2R0S A;  4F3I A;  4XUA A;  5DFB A;  5HRX A;  5FB1 A;  1ZS5 A;  2RI7 A;  3I3J A;  3MUL A;  4NRB A;  4BW2 A;  2WP1 A;  4YYH A;  5BT3 A;  4YH3 A;  1X0J A;  5CUC A;  3DAI A;  5FE9 A;  3GG3 A;  5CRM A;  4LC2 A;  5CUA A;  5DYA A;  5DW2 A;  5DLX A;  2DWW A;  4A9L A;  4O76 A;  4LRG A;  5JWM A;  4CUP A;  5EGU A;  4X2I A;  4KV4 A;  4NRA A;  4QR4 A;  4LZR A;  4LYW A;  4AKH A;  5I88 A;  4OUF A;  5ENE A;  5FE0 A;  4QBM A;  2DVQ A;  4LDF A;  4MR5 A;  4BJX A;  2H60 A;  2NXB A;  2YW5 A;  4YYM A;  4PY6 A;  4NXJ A;  4XYA A;  4NQN A;  4PCE A;  4UIW A;  2D9E A;  4TU6 A;  2OSS A;  3QZS A;  5EWD A;  4AI6 A;  4QUT A;  2KTB B;  3P1C A;  5FFY A;  4BHW A;  4HXR A;  5CPE A;  4LYI A;  4YY4 A;  5CTL A;  4HBY A;  5E0R A;  5EIC A;  4KV1 A;  3MB3 A;  4FLP A;  5EWV A;  4YAB A;  5CQ3 A;  5FH8 A;  5A82 A;  2YEL A;  4C66 A;  4QZS A;  3ZYU A;  5A5P A;  3G0J A;  4IR3 A;  5II1 A;  4IOQ A;  5HRV A;  2RFJ A;  3IU5 A;  5EPS A;  2DVS A;  5DY7 A;  5I7X A;  5FE7 A;  5LUU A;  4NYW A;  4NR7 A;  4N3W A;  3MUK A;  4CUU A;  5F1H A;  4IR4 A;  2F6N A;  5G4R A;  3UV4 A;  5FE4 A;  4CL9 A;  4UYG A;  4HXN A;  1WUG A;  3NXB A;  2MJV B;  4NS5 A;  4MR6 A;  5FG6 A;  3JVJ A;  2RNW A;  1F68 A;  5F5Z A;  3LJW A;  4QB3 A;  4NR9 A;  5DYU A;  3HMF A;  5CRZ A;  4Z1S A;  4O74 A;  4QSR A;  4TS8 A;  3AQA A;  4HXP A;  4MR4 A;  5KTW A;  3UV2 A;  4PCI A;  5CQ4 A;  2DKW A;  5HEM A;  5AME A;  5C85 A;  5D3H A;  5L98 A;  3P1E A;  4NR8 A;  3MQM A;  3D1B A;  4O7F A;  5AMF A;  4QEW A;  4YAD A;  5D3S A;  5FG5 A;  5IGL A;  5E3G A;  5DW1 A;  3AAD A;  5E9V A;  4O70 A;  5F3A A;  3SVH A;  3ONI A;  5I80 A;  3O36 A;  5E9K A;  4YYD A;  3QZV A;  5A5Q A;  4NUD A;  2LSP B;  5EM3 A;  4CUQ A;  1PUO A;  4J0R A;  4O7B A;  1ZKR A;  5D7X A;  5CS8 A;  3LQH A; 
#chains in the Genus database with same CATH homology
 5DBM A;  5A5N A;  3SVG A;  5TB6 A;  5KHM A;  5D3J A;  5KO4 A;  4ALG A;  4TT4 A;  5F63 A;  4QC1 A;  2E3K A;  5EA1 A;  1JSP B;  4HXK A;  2E7O A;  3MXF A;  5ETD A;  5FBX A;  5EWC A;  3HME A;  4Z6H A;  4MEN A;  3UVY A;  2R0Y A;  4LYS A;  5H1V A;  5TCM A;  5D0C A;  5E74 A;  4N4G A;  4WHW A;  2YEM A;  5L99 A;  4NRC A;  4HXO A;  4YBS A;  4QUU A;  4TTE A;  2YDW A;  4O75 A;  5H85 A;  4ZC9 A;  4UIX A;  4BW4 A;  3P1F A;  5EPR A;  5E7D A;  3O35 A;  4QEU A;  5ENJ A;  5CQ5 A;  5ENC A;  5LKZ A;  5F25 A;  3U5K A;  5L97 A;  4NYX A;  5L8T A;  3O33 A;  5FE8 A;  5I40 A;  5ENB A;  4ALH A;  5EQ1 A;  4NR4 A;  5D3N A;  5AD2 A;  4QY4 A;  4UIT A;  4YYJ A;  4NR6 A;  4NR5 A;  4AKN A;  4OGJ A;  4UIZ A;  2DVR A;  4O77 A;  4PS5 A;  3DWY A;  3U5O A;  4UIV A;  4MEQ A;  5FH6 A;  5HQ7 A;  5COI A;  4LZ2 A;  1JM4 B;  4Q0N A;  5EU1 A;  5EK9 A;  2L85 A;  4QST A;  4NUC A;  4QSS A;  5E9L A;  5EV9 A;  2WP2 A;  5FH7 A;  2L84 A;  4NUE A;  5C87 A;  4A9N A;  4C67 A;  5KU3 A;  3RCW A;  3Q2E A;  4NYV A;  4CFL A;  5D3P A;  3JVM A;  4J3I A;  5F36 A;  5DKH A;  2F6J A;  5I7Y A;  4YAT A;  4YYN A;  4QR5 A;  3HMH A;  4A9E A;  4HXS A;  3MB4 A;  5CQA A;  3JVL A;  3UVW A;  4YYI A;  5ENG A;  2RO1 A;  4QSU A;  5A5S A;  4O7A A;  3UW9 A;  4KCX A;  5ETB A;  4MEO A;  5BT5 A;  5FE6 A;  3UVD A;  3LQJ A;  3IU6 A;  4WIV A;  4HBX A;  4Q0O A;  5CQ8 A;  5EPB A;  5FE1 A;  5E9Y A;  2D82 A;  4BW1 A;  5F60 A;  5LVQ A;  5CUG A;  3G0L A;  5ACY A;  5HFR A;  2DAT A;  5F1L A;  3JVK A;  4A9M A;  5F62 A;  3LQI A;  4QSW A;  5D25 A;  4O78 A;  4XY8 A;  5C4Q A;  5KTX A;  4J1P A;  5E73 A;  5CQ6 A;  5D26 A;  5LJ0 A;  5L8U A;  2FSA A;  5I29 A;  1WUM A;  3S92 A;  4LZS A;  4MEP A;  3U5P A;  4N4F A;  4YBM A;  5HLS A;  5KTU A;  4J0S A;  5F61 A;  5HEL A;  3UV5 A;  3QZT A;  4QC3 A;  5HQ6 A;  4TZ2 A;  4Y03 A;  4MR3 A;  5HJC A;  4A9O A;  2RNY A;  2YQD A;  5CZG A;  5J0D A;  4YAX A;  4TU4 A;  4UIY A;  4N4I A;  5D3L A;  5I1Q A;  5E3D A;  4XUB A;  4TZ8 A;  5CGP A;  5CY9 A;  5LKU A;  4OGI A;  5FDZ A;  4HXM A;  5CFW A;  4YYK A;  5LKX A;  5CU8 A;  5LVR A;  5HFQ A;  5LKT A;  4QSV A;  4A9J A;  2OUO A;  5K29 A;  4UYF A;  4QSP A;  2DVV A;  5EP7 A;  4TT2 A;  5LJ1 A;  5EWH A;  4XY9 A;  5H1T A;  2N9G A;  3O34 A;  5HM0 A;  5D24 A;  4O72 A;  4HBW A;  4E96 A;  5A85 A;  4Z1Q A;  5IBN A;  5A81 A;  4DON A;  1N72 A;  4IOO A;  2E7N A;  3O37 A;  5FFV A;  4TYL A;  4CUR A;  4TT6 A;  4IOR A;  5AD3 A;  5DFD A;  3U5M A;  3UVX A;  5DYC A;  5FG4 A;  4CUT A;  5I83 A;  5CP5 A;  5C8G A;  4O71 A;  4UIU A;  4YK0 A;  4QNS A;  5E9I A;  4YC9 A;  5F2P A;  3Q2F A;  2OO1 A;  4QYD A;  5I89 A;  4Z93 A;  3U5J A;  5BT4 A;  5EVA A;  5IGK A;  5FFW A;  4O7E A;  4PKL A;  2R0V A;  5I86 A;  2RNX A;  4O7C A;  5DFC A;  5DKC A;  4IR5 A;  5IGM A;  4YYG A;  2L5E A;  4QSX A;  5EIS A;  4RVR A;  4HXL A;  4HBV A;  2RS9 B;  5FE5 A;  5LJ2 A;  3FKM X;  4A9F A;  4A9I A;  5H1U A;  5EI4 A;  5HCL A;  4ZQL A;  2G4A A;  4ZW1 A;  5EWW A;  4YBT A;  5A5O A;  5C7N A;  2YEK A;  4LR6 A;  5JI8 A;  5A7C A;  4UYF B;  5CQ7 A;  3TLP A;  5HEN A;  3SVF A;  4UYD A;  5IG6 A;  3U5N A;  5IGN A;  4A9H A;  4TQN A;  3K2J A;  4BW3 A;  5G4S A;  5A83 A;  3D7C A;  3U5L A;  4CLB A;  1EQF A;  2R10 A;  5D3R A;  4UYH A;  5IID A;  5FB0 A;  2I8N A;  5II2 A;  4YY6 A;  5CUB A;  5DX4 A;  1E6I A;  2GRC A;  4YH4 A;  5DLZ A;  5C89 A;  5HQ5 A;  4Z6I A;  4QEV A;  5L96 A;  5CUE A;  5DKD A;  4PTB A;  3S91 A;  3P5O A;  5FE3 A;  4CUS A;  5ENF A;  4UYE A;  4N4H A;  5DYX A;  5FE2 A;  2YYN A;  4QYL A;  3P1D A;  5HRW A;  4CFK A;  2I7K A;  4QR3 A;  3LXJ A;  5CQT A;  5ENH A;  5CUD A;  4GPJ A;  4NQM A;  4WHU A;  4IR6 A;  5D3T A;  5A5R A;  5E9M A;  4QSQ A;  5ENI A;  4A9K A;  2R0S A;  4F3I A;  4XUA A;  5DFB A;  5HRX A;  5FB1 A;  1ZS5 A;  2RI7 A;  3I3J A;  3MUL A;  4NRB A;  4BW2 A;  2WP1 A;  4YYH A;  5BT3 A;  4YH3 A;  1X0J A;  5CUC A;  3DAI A;  5FE9 A;  3GG3 A;  5CRM A;  4LC2 A;  5CUA A;  5DYA A;  5DW2 A;  5DLX A;  2DWW A;  4A9L A;  4O76 A;  4LRG A;  5JWM A;  4CUP A;  5EGU A;  4X2I A;  4KV4 A;  4NRA A;  4QR4 A;  4LZR A;  4LYW A;  5I88 A;  4OUF A;  5ENE A;  5FE0 A;  4QBM A;  2DVQ A;  4LDF A;  4MR5 A;  4BJX A;  2H60 A;  2NXB A;  2YW5 A;  4YYM A;  4PY6 A;  4NXJ A;  4XYA A;  4NQN A;  4PCE A;  4UIW A;  2D9E A;  4TU6 A;  2OSS A;  3QZS A;  5EWD A;  4QUT A;  2KTB B;  3P1C A;  5FFY A;  4BHW A;  4HXR A;  5CPE A;  4LYI A;  4YY4 A;  5CTL A;  4HBY A;  5E0R A;  5EIC A;  4KV1 A;  3MB3 A;  4FLP A;  5EWV A;  4YAB A;  5CQ3 A;  5FH8 A;  5A82 A;  2YEL A;  4C66 A;  4QZS A;  3ZYU A;  5A5P A;  3G0J A;  4IR3 A;  5II1 A;  4IOQ A;  5HRV A;  2RFJ A;  3IU5 A;  5EPS A;  2DVS A;  5DY7 A;  5I7X A;  5FE7 A;  5LUU A;  4NYW A;  4NR7 A;  4N3W A;  3MUK A;  4CUU A;  5F1H A;  4IR4 A;  2F6N A;  5G4R A;  3UV4 A;  5FE4 A;  4CL9 A;  4UYG A;  4HXN A;  1WUG A;  3NXB A;  2MJV B;  4NS5 A;  4MR6 A;  5FG6 A;  3JVJ A;  2RNW A;  1F68 A;  5F5Z A;  3LJW A;  4QB3 A;  4NR9 A;  5DYU A;  3HMF A;  5CRZ A;  4Z1S A;  4O74 A;  4QSR A;  4TS8 A;  3AQA A;  4HXP A;  4MR4 A;  5KTW A;  3UV2 A;  4PCI A;  5CQ4 A;  2DKW A;  5HEM A;  5AME A;  5C85 A;  5D3H A;  5L98 A;  3P1E A;  4NR8 A;  3MQM A;  4O7F A;  5AMF A;  4QEW A;  4YAD A;  5D3S A;  5FG5 A;  5IGL A;  5E3G A;  5DW1 A;  3AAD A;  5E9V A;  4O70 A;  5F3A A;  3SVH A;  3ONI A;  5I80 A;  3O36 A;  5E9K A;  4YYD A;  3QZV A;  5A5Q A;  4NUD A;  2LSP B;  5EM3 A;  4CUQ A;  4J0R A;  4O7B A;  5D7X A;  5CS8 A;  3LQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...