5G4SA

Bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl-n- ethyl-2-methoxybenzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
116
structure length
116
Chain Sequence
EIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEREGRIN
publication title Gsk6853, a Chemical Probe for Inhibition of the Brpf1 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 38
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5g4sA00
4KCXA 5COIA 5FFWA 5IG6A 2MJVB 5E9MA 3G0JA 4PCEA 5HEMA 5D26A 5CS8A 3UVWA 4QEVA 4HXLA 5FB1A 4WIVA 4YC9A 2N9GA 4NQMA 2R0VA 3QZTA 5FB0A 4UYFA 4NUCA 4QR3A 5EM3A 4PKLA 5CGPA 5FDZA 2F6JA 4QZSA 4A9FA 5A5OA 4TZ8A 4O7CA 4UIXA 5EISA 3SVGA 4QR4A 4A9NA 4DONA 3NXBA 5AD2A 3QZVA 5A85A 4QSWA 4CLBA 3I3JA 5F5ZA 2OSSA 5I83A 3O33A 2D82A 5FBXA 4OUFA 5ENJA 3LXJA 5DKHA 4QSPA 4NR5A 5H1TA 4KV1A 5JI8A 4QEUA 5CY9A 5FG5A 4C66A 5L8UA 5BT3A 4E96A 3QZSA 4CUUA 5LJ0A 5IGNA 5I1QA 5EP7A 4LYWA 4HXKA 5DBMA 5D3HA 4HXSA 5TB6A 5CRZA 4NUEA 5E9VA 4UIYA 2RS9B 3GG3A 5IGLA 4MR6A 5A83A 4ZQLA 5F2PA 4YAXA 3HMHA 5F62A 5D3SA 5ETDA 5CQ7A 5KTXA 5FE7A 2R10A 4NYWA 5ETBA 2RNXA 5FE1A 4YABA 5HRXA 3K2JA 2YEMA 4NYXA 4NS5A 5F61A 4YYIA 3D7CA 5EV9A 5CUAA 4N4IA 5CQ4A 5CRMA 5A5PA 4YYJA 2L85A 4MR3A 4HBXA 4RVRA 4X2IA 5HQ7A 4TQNA 4YBTA 4NR4A 5A82A 5EWVA 5EWDA 4UYFB 4IOOA 4NRCA 5F63A 5KHMA 5EWHA 5CU8A 4YY6A 4YBMA 2R0SA 1X0JA 5DFBA 4PY6A 5A81A 2GRCA 3U5PA 5CQ6A 3U5LA 4YY4A 5C85A 4Q0OA 4YYKA 4N3WA 5L8TA 5DLZA 4IR5A 5HCLA 4OGJA 3P1CA 5LKXA 4IOQA 5DKDA 1ZS5A 4LYIA 3ZYUA 2G4AA 5H85A 5E7DA 5L97A 5I80A 2YYNA 3UVYA 4LDFA 4UIWA 4N4GA 4A9MA 4A9EA 4QSXA 4Z6HA 5TCMA 5BT4A 5LKZA 3MULA 4QBMA 5EWCA 5C89A 4O7FA 4TT2A 5I89A 2WP2A 5ENEA 4LZRA 3UV2A 5E0RA 4MEPA 2OUOA 4LZSA 4NR7A 5F1LA 5F60A 5K29A 5JWMA 3LQJA 5ENGA 5FE3A 4MENA 2OO1A 5C87A 4QEWA 5DW2A 1WUMA 3MB4A 2DATA 4CUTA 2DVQA 2RNYA 4J0SA 3P1EA 4ALGA 4QSTA 5F25A 3S91A 5EPRA 4QNSA 4YYHA 5EVAA 5CUGA 4AKNA 3O34A 4O75A 3UVXA 2L84A 4O78A 3RCWA 4BW4A 5FE2A 4HXOA 5A5SA 5FFVA 4TS8A 5CQ8A 5I29A 5HELA 5G4SA 5FE8A 4PS5A 5EU1A 5KO4A 5CQ5A 5ENIA 4LYSA 5HJCA 5LJ2A 4UYEA 5FH7A 4YADA 2RO1A 4QUTA 5DYXA 5CQ3A 5HRVA 4CUSA 4QY4A 4NR8A 5CPEA 5E3GA 4C67A 4QR5A 3U5MA 5E9IA 5I40A 4MEQA 5LVRA 4MR4A 5EPBA 2YDWA 4IR6A 3U5OA 4PTBA 4A9KA 4HXRA 5ENHA 2YELA 4IORA 3IU6A 5L96A 3UW9A 3MB3A 5FE9A 4TYLA 5A5QA 4BHWA 2RNWA 4NRBA 1E6IA 4O77A 4O70A 5FE0A 4A9IA 5C8GA 4HBWA 4IR4A 2YQDA 3ONIA 5ENFA 4YBSA 5A5RA 3UV5A 4HXPA 4CUQA 5AMFA 4LZ2A 3U5JA 4QSSA 4TTEA 4XY8A 3LJWA 5KTWA 3U5KA 5D3PA 5EA1A 2DWWA 2I7KA 5D0CA 5II2A 4Z1SA 4YATA 3MUKA 5H1UA 5DFDA 4LR6A 3G0LA 5HQ5A 4TU4A 5HFQA 5A7CA 5EWWA 5HM0A 5FH6A 5HLSA 4LC2A 5D25A 5EICA 3O35A 4YK0A 2RI7A 4A9OA 5G4RA 4NYVA 5F3AA 4QB3A 5D3TA 4A9JA 5CFWA 4Q0NA 2H60A 3TLPA 5D3LA 2FSAA 4CURA 5D24A 4QC1A 4BW3A 4UYGA 5AD3A 4N4FA 3LQIA 5D3RA 3HMFA 5II1A 5HRWA 2R0YA 5IBNA 5E73A 4A9LA 3DAIA 5I88A 4Z93A 3O37A 4XY9A 4F3IA 4O7EA 2YEKA 5E74A 4QC3A 4ZW1A 1N72A 4CUPA 1JSPB 4MEOA 4UIZA 5FH8A 5FFYA 3P1DA 3SVHA 5EK9A 4OGIA 4CFKA 4Z1QA 3AQAA 4TZ2A 3MQMA 4NR6A 2E3KA 5C7NA 5CZGA 5D3NA 5FG6A 4NQNA 2E7NA 3IU5A 4WHWA 5FE6A 4TT4A 5AMEA 5DY7A 5FG4A 5KU3A 5E9YA 4YYNA 5IIDA 5CUEA 2I8NA 5CQTA 1WUGA 5EPSA 2WP1A 4PCIA 4J1PA 4NR9A 4NUDA 2F6NA 4KV4A 4O7AA 5DYCA 5IGKA 3Q2FA 5F1HA 5HQ6A 2E7OA 5DYAA 5I7XA 4Z6IA 2D9EA 2RFJA 5DKCA 1JM4B 4LRGA 4QYDA 2YW5A 4QSRA 2LSPB 5KTUA 3JVJA 4J3IA 5DYUA 3S92A 5LKTA 4O7BA 5FE4A 2DVSA 4QSUA 5CUDA 3DWYA 4GPJA 3MXFA 4BJXA 5A5NA 4UYHA 2DKWA 5EQ1A 5E9KA 5CQAA 5J0DA 4QUUA 4YH4A 4ALHA 5CP5A 5L98A 5BT5A 4UYDA 4XUAA 3JVLA 5LUUA 4NXJA 3JVKA 3P5OA 4TU6A 4O76A 4QSQA 5EGUA 5L99A 5LJ1A 5H1VA 4ZC9A 4FLPA 4HXNA 1F68A 5I86A 4TT6A 4HXMA 4J0RA 4YYDA 1EQFA 4WHUA 4XUBA 5HENA 5FE5A 4O74A 4Y03A 5E3DA 5ENCA 3Q2EA 4UITA 4HBYA 4MR5A 4YH3A 4NRAA 4UIVA 5DLXA 5ACYA 2L5EA 5DFCA 5HFRA 3UVDA 5CUCA 4QSVA 5DW1A 4BW2A 5IGMA 4YYMA 5LKUA 3AADA 3O36A 5LVQA 5C4QA 4O72A 3SVFA 5F36A 4N4HA 4O71A 4UIUA 4XYAA 5ENBA 5CTLA 3JVMA 4IR3A 4QYLA 2KTBB 3P1FA 4CFLA 3LQHA 2NXBA 4HBVA 5D7XA 3HMEA 5DX4A 3FKMX 4BW1A 5EI4A 2DVVA 5I7YA 3UV4A 5CUBA 5E9LA 4A9HA 5D3JA 3U5NA 4CL9A 2DVRA 4YYGA
chains in the Genus database with same CATH superfamily
4KCXA 5COIA 5FFWA 5IG6A 2MJVB 5E9MA 3G0JA 4PCEA 5HEMA 5D26A 5CS8A 3UVWA 4QEVA 4HXLA 5FB1A 4WIVA 4YC9A 2N9GA 4NQMA 2R0VA 3QZTA 5FB0A 4UYFA 4NUCA 4QR3A 5EM3A 4PKLA 5CGPA 5FDZA 2F6JA 4QZSA 4A9FA 5A5OA 4TZ8A 4O7CA 4UIXA 5EISA 3SVGA 4QR4A 4A9NA 4DONA 3NXBA 5AD2A 3QZVA 5A85A 4QSWA 4CLBA 3I3JA 5F5ZA 3VKHA 2OSSA 5I83A 3ERRA 3O33A 2D82A 5FBXA 4OUFA 5ENJA 3LXJA 5DKHA 4QSPA 4NR5A 5H1TA 3VKGA 4KV1A 5JI8A 4QEUA 5CY9A 5FG5A 4C66A 5L8UA 5BT3A 4E96A 3QZSA 4CUUA 5LJ0A 5IGNA 5I1QA 5EP7A 4LYWA 4HXKA 5DBMA 5D3HA 4HXSA 5TB6A 5CRZA 4NUEA 5E9VA 4UIYA 2RS9B 3GG3A 5IGLA 4MR6A 5A83A 4ZQLA 5F2PA 4YAXA 3HMHA 5F62A 5D3SA 5ETDA 5CQ7A 5KTXA 5FE7A 2R10A 4NYWA 5ETBA 2RNXA 5FE1A 4YABA 5HRXA 3K2JA 2YEMA 4NYXA 4NS5A 5F61A 4YYIA 3D7CA 5EV9A 5CUAA 4N4IA 5CQ4A 5CRMA 5A5PA 4YYJA 2L85A 4MR3A 4HBXA 4RVRA 4X2IA 5HQ7A 4TQNA 4YBTA 4NR4A 5A82A 5EWVA 5EWDA 4UYFB 4IOOA 4NRCA 5F63A 5KHMA 5EWHA 5CU8A 4YY6A 4YBMA 2R0SA 1X0JA 5DFBA 4PY6A 5A81A 2GRCA 3U5PA 5CQ6A 3U5LA 4YY4A 5C85A 4Q0OA 4YYKA 4N3WA 5L8TA 5DLZA 4IR5A 5HCLA 4OGJA 3D1DA 3P1CA 5LKXA 4IOQA 5DKDA 1ZS5A 4LYIA 3ZYUA 2G4AA 5H85A 5E7DA 5L97A 5I80A 2YYNA 3UVYA 4LDFA 4UIWA 4N4GA 4A9MA 4A9EA 4QSXA 4Z6HA 5TCMA 5BT4A 5LKZA 3MULA 4QBMA 5EWCA 5C89A 4O7FA 4TT2A 5I89A 2WP2A 5ENEA 4LZRA 3UV2A 5E0RA 4MEPA 2OUOA 4LZSA 4NR7A 5F1LA 5F60A 5K29A 5JWMA 3LQJA 5ENGA 5FE3A 4MENA 2OO1A 5C87A 4QEWA 5DW2A 1WUMA 3MB4A 2DATA 4CUTA 2DVQA 2RNYA 4J0SA 3P1EA 4ALGA 4QSTA 5F25A 3S91A 5EPRA 4QNSA 4YYHA 2EJNA 5EVAA 5CUGA 4AKNA 3O34A 4O75A 3UVXA 2L84A 4O78A 3RCWA 4BW4A 5FE2A 4HXOA 5A5SA 5FFVA 4TS8A 5CQ8A 5I29A 5HELA 5G4SA 5FE8A 4PS5A 5EU1A 5KO4A 5CQ5A 5ENIA 4LYSA 5HJCA 5LJ2A 4UYEA 5FH7A 4YADA 2RO1A 4AKGA 4QUTA 5DYXA 5CQ3A 5HRVA 4CUSA 4QY4A 4NR8A 5CPEA 5E3GA 4C67A 4QR5A 3U5MA 5E9IA 5I40A 4MEQA 5LVRA 4MR4A 5EPBA 2YDWA 4IR6A 3U5OA 4PTBA 4A9KA 4HXRA 5ENHA 2YELA 4IORA 3IU6A 5L96A 3UW9A 3MB3A 5FE9A 4TYLA 5A5QA 4BHWA 2RNWA 4NRBA 1E6IA 4O77A 4O70A 5FE0A 4A9IA 5C8GA 4AKIA 4HBWA 4IR4A 2YQDA 3ONIA 5ENFA 4YBSA 5A5RA 3UV5A 4HXPA 4CUQA 5AMFA 4LZ2A 3U5JA 4QSSA 4AKHA 4TTEA 4XY8A 3LJWA 5KTWA 3U5KA 5D3PA 5EA1A 2DWWA 2I7KA 5D0CA 5II2A 4Z1SA 4YATA 3MUKA 5H1UA 5DFDA 4LR6A 3G0LA 5HQ5A 4TU4A 5HFQA 5A7CA 5EWWA 5HM0A 5FH6A 5HLSA 4LC2A 5D25A 5EICA 3O35A 4YK0A 2RI7A 4A9OA 5G4RA 4NYVA 5F3AA 4QB3A 1ZKRA 5D3TA 4A9JA 5CFWA 4Q0NA 2H60A 3TLPA 5D3LA 2FSAA 4CURA 5D24A 4QC1A 4BW3A 4UYGA 5AD3A 4N4FA 3LQIA 5D3RA 3HMFA 5II1A 5HRWA 2R0YA 5IBNA 5E73A 4A9LA 3DAIA 5I88A 4Z93A 3O37A 4XY9A 4F3IA 4O7EA 2YEKA 5E74A 4QC3A 4ZW1A 1N72A 4CUPA 1JSPB 4MEOA 4UIZA 5FH8A 5FFYA 3P1DA 3SVHA 5EK9A 4OGIA 4CFKA 4Z1QA 3AQAA 4TZ2A 3MQMA 4NR6A 2E3KA 5C7NA 5CZGA 5D3NA 5FG6A 4NQNA 2E7NA 3IU5A 4WHWA 5FE6A 4TT4A 5AMEA 5DY7A 5FG4A 5KU3A 5E9YA 4YYNA 5IIDA 5CUEA 2I8NA 5CQTA 1WUGA 5EPSA 2WP1A 4PCIA 4J1PA 4NR9A 4NUDA 2F6NA 4KV4A 4O7AA 5DYCA 5IGKA 3Q2FA 5F1HA 5HQ6A 2E7OA 5DYAA 5I7XA 4Z6IA 2D9EA 2RFJA 5DKCA 1JM4B 4LRGA 4QYDA 2YW5A 4QSRA 2LSPB 5KTUA 3JVJA 4J3IA 5DYUA 3S92A 5LKTA 3D1BA 4O7BA 5FE4A 2DVSA 4QSUA 5CUDA 3DWYA 4GPJA 3MXFA 4BJXA 5A5NA 4UYHA 2DKWA 5EQ1A 5E9KA 5CQAA 5J0DA 4QUUA 4YH4A 4ALHA 5CP5A 5L98A 5BT5A 4UYDA 4XUAA 3JVLA 5LUUA 4NXJA 1PUOA 3JVKA 3P5OA 4TU6A 4O76A 4QSQA 5EGUA 5L99A 5LJ1A 5H1VA 4ZC9A 4FLPA 4HXNA 1F68A 5I86A 4TT6A 4HXMA 4AI6A 4J0RA 4YYDA 1EQFA 4WHUA 4XUBA 5HENA 5FE5A 4O74A 4Y03A 5E3DA 5ENCA 3Q2EA 4UITA 4HBYA 4MR5A 4YH3A 4NRAA 4UIVA 5DLXA 5ACYA 2L5EA 5DFCA 5HFRA 3UVDA 5CUCA 4QSVA 5DW1A 4BW2A 5IGMA 4YYMA 5LKUA 3AADA 3O36A 5LVQA 5C4QA 4O72A 3SVFA 5F36A 4N4HA 4O71A 4UIUA 4XYAA 5ENBA 5CTLA 3JVMA 4IR3A 4QYLA 2KTBB 3P1FA 4CFLA 3LQHA 2NXBA 4HBVA 5D7XA 3HMEA 5DX4A 3FKMX 4BW1A 5EI4A 2DVVA 5I7YA 3UV4A 5CUBA 5E9LA 4A9HA 5D3JA 3U5NA 4CL9A 2DVRA 4YYGA
chains in the Genus database with same CATH topology
4KCXA 5COIA 5FFWA 5IG6A 2MJVB 5E9MA 3G0JA 4PCEA 5HEMA 5D26A 5CS8A 3UVWA 4QEVA 4HXLA 5FB1A 4WIVA 4YC9A 2N9GA 4NQMA 2R0VA 3QZTA 5FB0A 4UYFA 4NUCA 4QR3A 5EM3A 4PKLA 5CGPA 5FDZA 2F6JA 4QZSA 4A9FA 5A5OA 4TZ8A 4O7CA 4UIXA 5EISA 3SVGA 4QR4A 4A9NA 4DONA 3NXBA 5AD2A 3QZVA 5A85A 4QSWA 4CLBA 3I3JA 5F5ZA 2OSSA 5I83A 3O33A 2D82A 5FBXA 4OUFA 5ENJA 3LXJA 5DKHA 4QSPA 4NR5A 5H1TA 4KV1A 5JI8A 4QEUA 5CY9A 5FG5A 4C66A 5L8UA 5BT3A 4E96A 3QZSA 4CUUA 5LJ0A 5IGNA 5I1QA 5EP7A 4LYWA 4HXKA 5DBMA 5D3HA 4HXSA 5TB6A 5CRZA 4NUEA 5E9VA 4UIYA 2RS9B 3GG3A 5IGLA 4MR6A 5A83A 4ZQLA 5F2PA 4YAXA 3HMHA 5F62A 5D3SA 5ETDA 5CQ7A 5KTXA 5FE7A 2R10A 4NYWA 5ETBA 2RNXA 5FE1A 4YABA 5HRXA 3K2JA 2YEMA 4NYXA 4NS5A 5F61A 4YYIA 3D7CA 5EV9A 5CUAA 4N4IA 5CQ4A 5CRMA 5A5PA 4YYJA 2L85A 4MR3A 4HBXA 4RVRA 4X2IA 5HQ7A 4TQNA 4YBTA 4NR4A 5A82A 5EWVA 5EWDA 4UYFB 4IOOA 4NRCA 5F63A 5KHMA 5EWHA 5CU8A 4YY6A 4YBMA 2R0SA 1X0JA 5DFBA 4PY6A 5A81A 2GRCA 3U5PA 5CQ6A 3U5LA 4YY4A 5C85A 4Q0OA 4YYKA 4N3WA 5L8TA 5DLZA 4IR5A 5HCLA 4OGJA 3P1CA 5LKXA 4IOQA 5DKDA 1ZS5A 4LYIA 3ZYUA 2G4AA 5H85A 5E7DA 5L97A 5I80A 2YYNA 3UVYA 4LDFA 4UIWA 4N4GA 4A9MA 4A9EA 4QSXA 4Z6HA 5TCMA 5BT4A 5LKZA 3MULA 4QBMA 5EWCA 5C89A 4O7FA 4TT2A 5I89A 2WP2A 5ENEA 4LZRA 3UV2A 5E0RA 4MEPA 2OUOA 4LZSA 4NR7A 5F1LA 5F60A 5K29A 5JWMA 3LQJA 5ENGA 5FE3A 4MENA 2OO1A 5C87A 4QEWA 5DW2A 1WUMA 3MB4A 2DATA 4CUTA 2DVQA 2RNYA 4J0SA 3P1EA 4ALGA 4QSTA 5F25A 3S91A 5EPRA 4QNSA 4YYHA 5EVAA 5CUGA 4AKNA 3O34A 4O75A 3UVXA 2L84A 4O78A 3RCWA 4BW4A 5FE2A 4HXOA 5A5SA 5FFVA 4TS8A 5CQ8A 5I29A 5HELA 5G4SA 5FE8A 4PS5A 5EU1A 5KO4A 5CQ5A 5ENIA 4LYSA 5HJCA 5LJ2A 4UYEA 5FH7A 4YADA 2RO1A 4QUTA 5DYXA 5CQ3A 5HRVA 4CUSA 4QY4A 4NR8A 5CPEA 5E3GA 4C67A 4QR5A 3U5MA 5E9IA 5I40A 4MEQA 5LVRA 4MR4A 5EPBA 2YDWA 4IR6A 3U5OA 4PTBA 4A9KA 4HXRA 5ENHA 2YELA 4IORA 3IU6A 5L96A 3UW9A 3MB3A 5FE9A 4TYLA 5A5QA 4BHWA 2RNWA 4NRBA 1E6IA 4O77A 4O70A 5FE0A 4A9IA 5C8GA 4HBWA 4IR4A 2YQDA 3ONIA 5ENFA 4YBSA 5A5RA 3UV5A 4HXPA 4CUQA 5AMFA 4LZ2A 3U5JA 4QSSA 4TTEA 4XY8A 3LJWA 5KTWA 3U5KA 5D3PA 5EA1A 2DWWA 2I7KA 5D0CA 5II2A 4Z1SA 4YATA 3MUKA 5H1UA 5DFDA 4LR6A 3G0LA 5HQ5A 4TU4A 5HFQA 5A7CA 5EWWA 5HM0A 5FH6A 5HLSA 4LC2A 5D25A 5EICA 3O35A 4YK0A 2RI7A 4A9OA 5G4RA 4NYVA 5F3AA 4QB3A 5D3TA 4A9JA 5CFWA 4Q0NA 2H60A 3TLPA 5D3LA 2FSAA 4CURA 5D24A 4QC1A 4BW3A 4UYGA 5AD3A 4N4FA 3LQIA 5D3RA 3HMFA 5II1A 5HRWA 2R0YA 5IBNA 5E73A 4A9LA 3DAIA 5I88A 4Z93A 3O37A 4XY9A 4F3IA 4O7EA 2YEKA 5E74A 4QC3A 4ZW1A 1N72A 4CUPA 1JSPB 4MEOA 4UIZA 5FH8A 5FFYA 3P1DA 3SVHA 5EK9A 4OGIA 4CFKA 4Z1QA 3AQAA 4TZ2A 3MQMA 4NR6A 2E3KA 5C7NA 5CZGA 5D3NA 5FG6A 4NQNA 2E7NA 3IU5A 4WHWA 5FE6A 4TT4A 5AMEA 5DY7A 5FG4A 5KU3A 5E9YA 4YYNA 5IIDA 5CUEA 2I8NA 5CQTA 1WUGA 5EPSA 2WP1A 4PCIA 4J1PA 4NR9A 4NUDA 2F6NA 4KV4A 4O7AA 5DYCA 5IGKA 3Q2FA 5F1HA 5HQ6A 2E7OA 5DYAA 5I7XA 4Z6IA 2D9EA 2RFJA 5DKCA 1JM4B 4LRGA 4QYDA 2YW5A 4QSRA 2LSPB 5KTUA 3JVJA 4J3IA 5DYUA 3S92A 5LKTA 4O7BA 5FE4A 2DVSA 4QSUA 5CUDA 3DWYA 4GPJA 3MXFA 4BJXA 5A5NA 4UYHA 2DKWA 5EQ1A 5E9KA 5CQAA 5J0DA 4QUUA 4YH4A 4ALHA 5CP5A 5L98A 5BT5A 4UYDA 4XUAA 3JVLA 5LUUA 4NXJA 3JVKA 3P5OA 4TU6A 4O76A 4QSQA 5EGUA 5L99A 5LJ1A 5H1VA 4ZC9A 4FLPA 4HXNA 1F68A 5I86A 4TT6A 4HXMA 4J0RA 4YYDA 1EQFA 4WHUA 4XUBA 5HENA 5FE5A 4O74A 4Y03A 5E3DA 5ENCA 3Q2EA 4UITA 4HBYA 4MR5A 4YH3A 4NRAA 4UIVA 5DLXA 5ACYA 2L5EA 5DFCA 5HFRA 3UVDA 5CUCA 4QSVA 5DW1A 4BW2A 5IGMA 4YYMA 5LKUA 3AADA 3O36A 5LVQA 5C4QA 4O72A 3SVFA 5F36A 4N4HA 4O71A 4UIUA 4XYAA 5ENBA 5CTLA 3JVMA 4IR3A 4QYLA 2KTBB 3P1FA 4CFLA 3LQHA 2NXBA 4HBVA 5D7XA 3HMEA 5DX4A 3FKMX 4BW1A 5EI4A 2DVVA 5I7YA 3UV4A 5CUBA 5E9LA 4A9HA 5D3JA 3U5NA 4CL9A 2DVRA 4YYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCX A;  5COI A;  5FFW A;  5IG6 A;  2MJV B;  5E9M A;  3G0J A;  4PCE A;  5HEM A;  5D26 A;  5CS8 A;  3UVW A;  4QEV A;  4HXL A;  5FB1 A;  4WIV A;  4YC9 A;  2N9G A;  4NQM A;  2R0V A;  3QZT A;  5FB0 A;  4UYF A;  4NUC A;  4QR3 A;  5EM3 A;  4PKL A;  5CGP A;  5FDZ A;  2F6J A;  4QZS A;  4A9F A;  5A5O A;  4TZ8 A;  4O7C A;  4UIX A;  5EIS A;  3SVG A;  4QR4 A;  4A9N A;  4DON A;  3NXB A;  5AD2 A;  3QZV A;  5A85 A;  4QSW A;  4CLB A;  3I3J A;  5F5Z A;  2OSS A;  5I83 A;  3O33 A;  2D82 A;  5FBX A;  4OUF A;  5ENJ A;  3LXJ A;  5DKH A;  4QSP A;  4NR5 A;  5H1T A;  4KV1 A;  5JI8 A;  4QEU A;  5CY9 A;  5FG5 A;  4C66 A;  5L8U A;  5BT3 A;  4E96 A;  3QZS A;  4CUU A;  5LJ0 A;  5IGN A;  5I1Q A;  5EP7 A;  4LYW A;  4HXK A;  5DBM A;  5D3H A;  4HXS A;  5TB6 A;  5CRZ A;  4NUE A;  5E9V A;  4UIY A;  2RS9 B;  3GG3 A;  5IGL A;  4MR6 A;  5A83 A;  4ZQL A;  5F2P A;  4YAX A;  3HMH A;  5F62 A;  5D3S A;  5ETD A;  5CQ7 A;  5KTX A;  5FE7 A;  2R10 A;  4NYW A;  5ETB A;  2RNX A;  5FE1 A;  4YAB A;  5HRX A;  3K2J A;  2YEM A;  4NYX A;  4NS5 A;  5F61 A;  4YYI A;  3D7C A;  5EV9 A;  5CUA A;  4N4I A;  5CQ4 A;  5CRM A;  5A5P A;  4YYJ A;  2L85 A;  4MR3 A;  4HBX A;  4RVR A;  4X2I A;  5HQ7 A;  4TQN A;  4YBT A;  4NR4 A;  5A82 A;  5EWV A;  5EWD A;  4UYF B;  4IOO A;  4NRC A;  5F63 A;  5KHM A;  5EWH A;  5CU8 A;  4YY6 A;  4YBM A;  2R0S A;  1X0J A;  5DFB A;  4PY6 A;  5A81 A;  2GRC A;  3U5P A;  5CQ6 A;  3U5L A;  4YY4 A;  5C85 A;  4Q0O A;  4YYK A;  4N3W A;  5L8T A;  5DLZ A;  4IR5 A;  5HCL A;  4OGJ A;  3P1C A;  5LKX A;  4IOQ A;  5DKD A;  1ZS5 A;  4LYI A;  3ZYU A;  2G4A A;  5H85 A;  5E7D A;  5L97 A;  5I80 A;  2YYN A;  3UVY A;  4LDF A;  4UIW A;  4N4G A;  4A9M A;  4A9E A;  4QSX A;  4Z6H A;  5TCM A;  5BT4 A;  5LKZ A;  3MUL A;  4QBM A;  5EWC A;  5C89 A;  4O7F A;  4TT2 A;  5I89 A;  2WP2 A;  5ENE A;  4LZR A;  3UV2 A;  5E0R A;  4MEP A;  2OUO A;  4LZS A;  4NR7 A;  5F1L A;  5F60 A;  5K29 A;  5JWM A;  3LQJ A;  5ENG A;  5FE3 A;  4MEN A;  2OO1 A;  5C87 A;  4QEW A;  5DW2 A;  1WUM A;  3MB4 A;  2DAT A;  4CUT A;  2DVQ A;  2RNY A;  4J0S A;  3P1E A;  4ALG A;  4QST A;  5F25 A;  3S91 A;  5EPR A;  4QNS A;  4YYH A;  5EVA A;  5CUG A;  4AKN A;  3O34 A;  4O75 A;  3UVX A;  2L84 A;  4O78 A;  3RCW A;  4BW4 A;  5FE2 A;  4HXO A;  5A5S A;  5FFV A;  4TS8 A;  5CQ8 A;  5I29 A;  5HEL A;  5G4S A;  5FE8 A;  4PS5 A;  5EU1 A;  5KO4 A;  5CQ5 A;  5ENI A;  4LYS A;  5HJC A;  5LJ2 A;  4UYE A;  5FH7 A;  4YAD A;  2RO1 A;  4QUT A;  5DYX A;  5CQ3 A;  5HRV A;  4CUS A;  4QY4 A;  4NR8 A;  5CPE A;  5E3G A;  4C67 A;  4QR5 A;  3U5M A;  5E9I A;  5I40 A;  4MEQ A;  5LVR A;  4MR4 A;  5EPB A;  2YDW A;  4IR6 A;  3U5O A;  4PTB A;  4A9K A;  4HXR A;  5ENH A;  2YEL A;  4IOR A;  3IU6 A;  5L96 A;  3UW9 A;  3MB3 A;  5FE9 A;  4TYL A;  5A5Q A;  4BHW A;  2RNW A;  4NRB A;  1E6I A;  4O77 A;  4O70 A;  5FE0 A;  4A9I A;  5C8G A;  4HBW A;  4IR4 A;  2YQD A;  3ONI A;  5ENF A;  4YBS A;  5A5R A;  3UV5 A;  4HXP A;  4CUQ A;  5AMF A;  4LZ2 A;  3U5J A;  4QSS A;  4TTE A;  4XY8 A;  3LJW A;  5KTW A;  3U5K A;  5D3P A;  5EA1 A;  2DWW A;  2I7K A;  5D0C A;  5II2 A;  4Z1S A;  4YAT A;  3MUK A;  5H1U A;  5DFD A;  4LR6 A;  3G0L A;  5HQ5 A;  4TU4 A;  5HFQ A;  5A7C A;  5EWW A;  5HM0 A;  5FH6 A;  5HLS A;  4LC2 A;  5D25 A;  5EIC A;  3O35 A;  4YK0 A;  2RI7 A;  4A9O A;  5G4R A;  4NYV A;  5F3A A;  4QB3 A;  5D3T A;  4A9J A;  5CFW A;  4Q0N A;  2H60 A;  3TLP A;  5D3L A;  2FSA A;  4CUR A;  5D24 A;  4QC1 A;  4BW3 A;  4UYG A;  5AD3 A;  4N4F A;  3LQI A;  5D3R A;  3HMF A;  5II1 A;  5HRW A;  2R0Y A;  5IBN A;  5E73 A;  4A9L A;  3DAI A;  5I88 A;  4Z93 A;  3O37 A;  4XY9 A;  4F3I A;  4O7E A;  2YEK A;  5E74 A;  4QC3 A;  4ZW1 A;  1N72 A;  4CUP A;  1JSP B;  4MEO A;  4UIZ A;  5FH8 A;  5FFY A;  3P1D A;  3SVH A;  5EK9 A;  4OGI A;  4CFK A;  4Z1Q A;  3AQA A;  4TZ2 A;  3MQM A;  4NR6 A;  2E3K A;  5C7N A;  5CZG A;  5D3N A;  5FG6 A;  4NQN A;  2E7N A;  3IU5 A;  4WHW A;  5FE6 A;  4TT4 A;  5AME A;  5DY7 A;  5FG4 A;  5KU3 A;  5E9Y A;  4YYN A;  5IID A;  5CUE A;  2I8N A;  5CQT A;  1WUG A;  5EPS A;  2WP1 A;  4PCI A;  4J1P A;  4NR9 A;  4NUD A;  2F6N A;  4KV4 A;  4O7A A;  5DYC A;  5IGK A;  3Q2F A;  5F1H A;  5HQ6 A;  2E7O A;  5DYA A;  5I7X A;  4Z6I A;  2D9E A;  2RFJ A;  5DKC A;  1JM4 B;  4LRG A;  4QYD A;  2YW5 A;  4QSR A;  2LSP B;  5KTU A;  3JVJ A;  4J3I A;  5DYU A;  3S92 A;  5LKT A;  4O7B A;  5FE4 A;  2DVS A;  4QSU A;  5CUD A;  3DWY A;  4GPJ A;  3MXF A;  4BJX A;  5A5N A;  4UYH A;  2DKW A;  5EQ1 A;  5E9K A;  5CQA A;  5J0D A;  4QUU A;  4YH4 A;  4ALH A;  5CP5 A;  5L98 A;  5BT5 A;  4UYD A;  4XUA A;  3JVL A;  5LUU A;  4NXJ A;  3JVK A;  3P5O A;  4TU6 A;  4O76 A;  4QSQ A;  5EGU A;  5L99 A;  5LJ1 A;  5H1V A;  4ZC9 A;  4FLP A;  4HXN A;  1F68 A;  5I86 A;  4TT6 A;  4HXM A;  4J0R A;  4YYD A;  1EQF A;  4WHU A;  4XUB A;  5HEN A;  5FE5 A;  4O74 A;  4Y03 A;  5E3D A;  5ENC A;  3Q2E A;  4UIT A;  4HBY A;  4MR5 A;  4YH3 A;  4NRA A;  4UIV A;  5DLX A;  5ACY A;  2L5E A;  5DFC A;  5HFR A;  3UVD A;  5CUC A;  4QSV A;  5DW1 A;  4BW2 A;  5IGM A;  4YYM A;  5LKU A;  3AAD A;  3O36 A;  5LVQ A;  5C4Q A;  4O72 A;  3SVF A;  5F36 A;  4N4H A;  4O71 A;  4UIU A;  4XYA A;  5ENB A;  5CTL A;  3JVM A;  4IR3 A;  4QYL A;  2KTB B;  3P1F A;  4CFL A;  3LQH A;  2NXB A;  4HBV A;  5D7X A;  3HME A;  5DX4 A;  3FKM X;  4BW1 A;  5EI4 A;  2DVV A;  5I7Y A;  3UV4 A;  5CUB A;  5E9L A;  4A9H A;  5D3J A;  3U5N A;  4CL9 A;  2DVR A;  4YYG A; 
#chains in the Genus database with same CATH topology
 4KCX A;  5COI A;  5FFW A;  5IG6 A;  2MJV B;  5E9M A;  3G0J A;  4PCE A;  5HEM A;  5D26 A;  5CS8 A;  3UVW A;  4QEV A;  4HXL A;  5FB1 A;  4WIV A;  4YC9 A;  2N9G A;  4NQM A;  2R0V A;  3QZT A;  5FB0 A;  4UYF A;  4NUC A;  4QR3 A;  5EM3 A;  4PKL A;  5CGP A;  5FDZ A;  2F6J A;  4QZS A;  4A9F A;  5A5O A;  4TZ8 A;  4O7C A;  4UIX A;  5EIS A;  3SVG A;  4QR4 A;  4A9N A;  4DON A;  3NXB A;  5AD2 A;  3QZV A;  5A85 A;  4QSW A;  4CLB A;  3I3J A;  5F5Z A;  3VKH A;  2OSS A;  5I83 A;  3ERR A;  3O33 A;  2D82 A;  5FBX A;  4OUF A;  5ENJ A;  3LXJ A;  5DKH A;  4QSP A;  4NR5 A;  5H1T A;  3VKG A;  4KV1 A;  5JI8 A;  4QEU A;  5CY9 A;  5FG5 A;  4C66 A;  5L8U A;  5BT3 A;  4E96 A;  3QZS A;  4CUU A;  5LJ0 A;  5IGN A;  5I1Q A;  5EP7 A;  4LYW A;  4HXK A;  5DBM A;  5D3H A;  4HXS A;  5TB6 A;  5CRZ A;  4NUE A;  5E9V A;  4UIY A;  2RS9 B;  3GG3 A;  5IGL A;  4MR6 A;  5A83 A;  4ZQL A;  5F2P A;  4YAX A;  3HMH A;  5F62 A;  5D3S A;  5ETD A;  5CQ7 A;  5KTX A;  5FE7 A;  2R10 A;  4NYW A;  5ETB A;  2RNX A;  5FE1 A;  4YAB A;  5HRX A;  3K2J A;  2YEM A;  4NYX A;  4NS5 A;  5F61 A;  4YYI A;  3D7C A;  5EV9 A;  5CUA A;  4N4I A;  5CQ4 A;  5CRM A;  5A5P A;  4YYJ A;  2L85 A;  4MR3 A;  4HBX A;  4RVR A;  4X2I A;  5HQ7 A;  4TQN A;  4YBT A;  4NR4 A;  5A82 A;  5EWV A;  5EWD A;  4UYF B;  4IOO A;  4NRC A;  5F63 A;  5KHM A;  5EWH A;  5CU8 A;  4YY6 A;  4YBM A;  2R0S A;  1X0J A;  5DFB A;  4PY6 A;  5A81 A;  2GRC A;  3U5P A;  5CQ6 A;  3U5L A;  4YY4 A;  5C85 A;  4Q0O A;  4YYK A;  4N3W A;  5L8T A;  5DLZ A;  4IR5 A;  5HCL A;  4OGJ A;  3D1D A;  3P1C A;  5LKX A;  4IOQ A;  5DKD A;  1ZS5 A;  4LYI A;  3ZYU A;  2G4A A;  5H85 A;  5E7D A;  5L97 A;  5I80 A;  2YYN A;  3UVY A;  4LDF A;  4UIW A;  4N4G A;  4A9M A;  4A9E A;  4QSX A;  4Z6H A;  5TCM A;  5BT4 A;  5LKZ A;  3MUL A;  4QBM A;  5EWC A;  5C89 A;  4O7F A;  4TT2 A;  5I89 A;  2WP2 A;  5ENE A;  4LZR A;  3UV2 A;  5E0R A;  4MEP A;  2OUO A;  4LZS A;  4NR7 A;  5F1L A;  5F60 A;  5K29 A;  5JWM A;  3LQJ A;  5ENG A;  5FE3 A;  4MEN A;  2OO1 A;  5C87 A;  4QEW A;  5DW2 A;  1WUM A;  3MB4 A;  2DAT A;  4CUT A;  2DVQ A;  2RNY A;  4J0S A;  3P1E A;  4ALG A;  4QST A;  5F25 A;  3S91 A;  5EPR A;  4QNS A;  4YYH A;  2EJN A;  5EVA A;  5CUG A;  4AKN A;  3O34 A;  4O75 A;  3UVX A;  2L84 A;  4O78 A;  3RCW A;  4BW4 A;  5FE2 A;  4HXO A;  5A5S A;  5FFV A;  4TS8 A;  5CQ8 A;  5I29 A;  5HEL A;  5G4S A;  5FE8 A;  4PS5 A;  5EU1 A;  5KO4 A;  5CQ5 A;  5ENI A;  4LYS A;  5HJC A;  5LJ2 A;  4UYE A;  5FH7 A;  4YAD A;  2RO1 A;  4AKG A;  4QUT A;  5DYX A;  5CQ3 A;  5HRV A;  4CUS A;  4QY4 A;  4NR8 A;  5CPE A;  5E3G A;  4C67 A;  4QR5 A;  3U5M A;  5E9I A;  5I40 A;  4MEQ A;  5LVR A;  4MR4 A;  5EPB A;  2YDW A;  4IR6 A;  3U5O A;  4PTB A;  4A9K A;  4HXR A;  5ENH A;  2YEL A;  4IOR A;  3IU6 A;  5L96 A;  3UW9 A;  3MB3 A;  5FE9 A;  4TYL A;  5A5Q A;  4BHW A;  2RNW A;  4NRB A;  1E6I A;  4O77 A;  4O70 A;  5FE0 A;  4A9I A;  5C8G A;  4AKI A;  4HBW A;  4IR4 A;  2YQD A;  3ONI A;  5ENF A;  4YBS A;  5A5R A;  3UV5 A;  4HXP A;  4CUQ A;  5AMF A;  4LZ2 A;  3U5J A;  4QSS A;  4AKH A;  4TTE A;  4XY8 A;  3LJW A;  5KTW A;  3U5K A;  5D3P A;  5EA1 A;  2DWW A;  2I7K A;  5D0C A;  5II2 A;  4Z1S A;  4YAT A;  3MUK A;  5H1U A;  5DFD A;  4LR6 A;  3G0L A;  5HQ5 A;  4TU4 A;  5HFQ A;  5A7C A;  5EWW A;  5HM0 A;  5FH6 A;  5HLS A;  4LC2 A;  5D25 A;  5EIC A;  3O35 A;  4YK0 A;  2RI7 A;  4A9O A;  5G4R A;  4NYV A;  5F3A A;  4QB3 A;  1ZKR A;  5D3T A;  4A9J A;  5CFW A;  4Q0N A;  2H60 A;  3TLP A;  5D3L A;  2FSA A;  4CUR A;  5D24 A;  4QC1 A;  4BW3 A;  4UYG A;  5AD3 A;  4N4F A;  3LQI A;  5D3R A;  3HMF A;  5II1 A;  5HRW A;  2R0Y A;  5IBN A;  5E73 A;  4A9L A;  3DAI A;  5I88 A;  4Z93 A;  3O37 A;  4XY9 A;  4F3I A;  4O7E A;  2YEK A;  5E74 A;  4QC3 A;  4ZW1 A;  1N72 A;  4CUP A;  1JSP B;  4MEO A;  4UIZ A;  5FH8 A;  5FFY A;  3P1D A;  3SVH A;  5EK9 A;  4OGI A;  4CFK A;  4Z1Q A;  3AQA A;  4TZ2 A;  3MQM A;  4NR6 A;  2E3K A;  5C7N A;  5CZG A;  5D3N A;  5FG6 A;  4NQN A;  2E7N A;  3IU5 A;  4WHW A;  5FE6 A;  4TT4 A;  5AME A;  5DY7 A;  5FG4 A;  5KU3 A;  5E9Y A;  4YYN A;  5IID A;  5CUE A;  2I8N A;  5CQT A;  1WUG A;  5EPS A;  2WP1 A;  4PCI A;  4J1P A;  4NR9 A;  4NUD A;  2F6N A;  4KV4 A;  4O7A A;  5DYC A;  5IGK A;  3Q2F A;  5F1H A;  5HQ6 A;  2E7O A;  5DYA A;  5I7X A;  4Z6I A;  2D9E A;  2RFJ A;  5DKC A;  1JM4 B;  4LRG A;  4QYD A;  2YW5 A;  4QSR A;  2LSP B;  5KTU A;  3JVJ A;  4J3I A;  5DYU A;  3S92 A;  5LKT A;  3D1B A;  4O7B A;  5FE4 A;  2DVS A;  4QSU A;  5CUD A;  3DWY A;  4GPJ A;  3MXF A;  4BJX A;  5A5N A;  4UYH A;  2DKW A;  5EQ1 A;  5E9K A;  5CQA A;  5J0D A;  4QUU A;  4YH4 A;  4ALH A;  5CP5 A;  5L98 A;  5BT5 A;  4UYD A;  4XUA A;  3JVL A;  5LUU A;  4NXJ A;  1PUO A;  3JVK A;  3P5O A;  4TU6 A;  4O76 A;  4QSQ A;  5EGU A;  5L99 A;  5LJ1 A;  5H1V A;  4ZC9 A;  4FLP A;  4HXN A;  1F68 A;  5I86 A;  4TT6 A;  4HXM A;  4AI6 A;  4J0R A;  4YYD A;  1EQF A;  4WHU A;  4XUB A;  5HEN A;  5FE5 A;  4O74 A;  4Y03 A;  5E3D A;  5ENC A;  3Q2E A;  4UIT A;  4HBY A;  4MR5 A;  4YH3 A;  4NRA A;  4UIV A;  5DLX A;  5ACY A;  2L5E A;  5DFC A;  5HFR A;  3UVD A;  5CUC A;  4QSV A;  5DW1 A;  4BW2 A;  5IGM A;  4YYM A;  5LKU A;  3AAD A;  3O36 A;  5LVQ A;  5C4Q A;  4O72 A;  3SVF A;  5F36 A;  4N4H A;  4O71 A;  4UIU A;  4XYA A;  5ENB A;  5CTL A;  3JVM A;  4IR3 A;  4QYL A;  2KTB B;  3P1F A;  4CFL A;  3LQH A;  2NXB A;  4HBV A;  5D7X A;  3HME A;  5DX4 A;  3FKM X;  4BW1 A;  5EI4 A;  2DVV A;  5I7Y A;  3UV4 A;  5CUB A;  5E9L A;  4A9H A;  5D3J A;  3U5N A;  4CL9 A;  2DVR A;  4YYG A; 
#chains in the Genus database with same CATH homology
 4KCX A;  5COI A;  5FFW A;  5IG6 A;  2MJV B;  5E9M A;  3G0J A;  4PCE A;  5HEM A;  5D26 A;  5CS8 A;  3UVW A;  4QEV A;  4HXL A;  5FB1 A;  4WIV A;  4YC9 A;  2N9G A;  4NQM A;  2R0V A;  3QZT A;  5FB0 A;  4UYF A;  4NUC A;  4QR3 A;  5EM3 A;  4PKL A;  5CGP A;  5FDZ A;  2F6J A;  4QZS A;  4A9F A;  5A5O A;  4TZ8 A;  4O7C A;  4UIX A;  5EIS A;  3SVG A;  4QR4 A;  4A9N A;  4DON A;  3NXB A;  5AD2 A;  3QZV A;  5A85 A;  4QSW A;  4CLB A;  3I3J A;  5F5Z A;  2OSS A;  5I83 A;  3O33 A;  2D82 A;  5FBX A;  4OUF A;  5ENJ A;  3LXJ A;  5DKH A;  4QSP A;  4NR5 A;  5H1T A;  4KV1 A;  5JI8 A;  4QEU A;  5CY9 A;  5FG5 A;  4C66 A;  5L8U A;  5BT3 A;  4E96 A;  3QZS A;  4CUU A;  5LJ0 A;  5IGN A;  5I1Q A;  5EP7 A;  4LYW A;  4HXK A;  5DBM A;  5D3H A;  4HXS A;  5TB6 A;  5CRZ A;  4NUE A;  5E9V A;  4UIY A;  2RS9 B;  3GG3 A;  5IGL A;  4MR6 A;  5A83 A;  4ZQL A;  5F2P A;  4YAX A;  3HMH A;  5F62 A;  5D3S A;  5ETD A;  5CQ7 A;  5KTX A;  5FE7 A;  2R10 A;  4NYW A;  5ETB A;  2RNX A;  5FE1 A;  4YAB A;  5HRX A;  3K2J A;  2YEM A;  4NYX A;  4NS5 A;  5F61 A;  4YYI A;  3D7C A;  5EV9 A;  5CUA A;  4N4I A;  5CQ4 A;  5CRM A;  5A5P A;  4YYJ A;  2L85 A;  4MR3 A;  4HBX A;  4RVR A;  4X2I A;  5HQ7 A;  4TQN A;  4YBT A;  4NR4 A;  5A82 A;  5EWV A;  5EWD A;  4UYF B;  4IOO A;  4NRC A;  5F63 A;  5KHM A;  5EWH A;  5CU8 A;  4YY6 A;  4YBM A;  2R0S A;  1X0J A;  5DFB A;  4PY6 A;  5A81 A;  2GRC A;  3U5P A;  5CQ6 A;  3U5L A;  4YY4 A;  5C85 A;  4Q0O A;  4YYK A;  4N3W A;  5L8T A;  5DLZ A;  4IR5 A;  5HCL A;  4OGJ A;  3P1C A;  5LKX A;  4IOQ A;  5DKD A;  1ZS5 A;  4LYI A;  3ZYU A;  2G4A A;  5H85 A;  5E7D A;  5L97 A;  5I80 A;  2YYN A;  3UVY A;  4LDF A;  4UIW A;  4N4G A;  4A9M A;  4A9E A;  4QSX A;  4Z6H A;  5TCM A;  5BT4 A;  5LKZ A;  3MUL A;  4QBM A;  5EWC A;  5C89 A;  4O7F A;  4TT2 A;  5I89 A;  2WP2 A;  5ENE A;  4LZR A;  3UV2 A;  5E0R A;  4MEP A;  2OUO A;  4LZS A;  4NR7 A;  5F1L A;  5F60 A;  5K29 A;  5JWM A;  3LQJ A;  5ENG A;  5FE3 A;  4MEN A;  2OO1 A;  5C87 A;  4QEW A;  5DW2 A;  1WUM A;  3MB4 A;  2DAT A;  4CUT A;  2DVQ A;  2RNY A;  4J0S A;  3P1E A;  4ALG A;  4QST A;  5F25 A;  3S91 A;  5EPR A;  4QNS A;  4YYH A;  5EVA A;  5CUG A;  4AKN A;  3O34 A;  4O75 A;  3UVX A;  2L84 A;  4O78 A;  3RCW A;  4BW4 A;  5FE2 A;  4HXO A;  5A5S A;  5FFV A;  4TS8 A;  5CQ8 A;  5I29 A;  5HEL A;  5G4S A;  5FE8 A;  4PS5 A;  5EU1 A;  5KO4 A;  5CQ5 A;  5ENI A;  4LYS A;  5HJC A;  5LJ2 A;  4UYE A;  5FH7 A;  4YAD A;  2RO1 A;  4QUT A;  5DYX A;  5CQ3 A;  5HRV A;  4CUS A;  4QY4 A;  4NR8 A;  5CPE A;  5E3G A;  4C67 A;  4QR5 A;  3U5M A;  5E9I A;  5I40 A;  4MEQ A;  5LVR A;  4MR4 A;  5EPB A;  2YDW A;  4IR6 A;  3U5O A;  4PTB A;  4A9K A;  4HXR A;  5ENH A;  2YEL A;  4IOR A;  3IU6 A;  5L96 A;  3UW9 A;  3MB3 A;  5FE9 A;  4TYL A;  5A5Q A;  4BHW A;  2RNW A;  4NRB A;  1E6I A;  4O77 A;  4O70 A;  5FE0 A;  4A9I A;  5C8G A;  4HBW A;  4IR4 A;  2YQD A;  3ONI A;  5ENF A;  4YBS A;  5A5R A;  3UV5 A;  4HXP A;  4CUQ A;  5AMF A;  4LZ2 A;  3U5J A;  4QSS A;  4TTE A;  4XY8 A;  3LJW A;  5KTW A;  3U5K A;  5D3P A;  5EA1 A;  2DWW A;  2I7K A;  5D0C A;  5II2 A;  4Z1S A;  4YAT A;  3MUK A;  5H1U A;  5DFD A;  4LR6 A;  3G0L A;  5HQ5 A;  4TU4 A;  5HFQ A;  5A7C A;  5EWW A;  5HM0 A;  5FH6 A;  5HLS A;  4LC2 A;  5D25 A;  5EIC A;  3O35 A;  4YK0 A;  2RI7 A;  4A9O A;  5G4R A;  4NYV A;  5F3A A;  4QB3 A;  5D3T A;  4A9J A;  5CFW A;  4Q0N A;  2H60 A;  3TLP A;  5D3L A;  2FSA A;  4CUR A;  5D24 A;  4QC1 A;  4BW3 A;  4UYG A;  5AD3 A;  4N4F A;  3LQI A;  5D3R A;  3HMF A;  5II1 A;  5HRW A;  2R0Y A;  5IBN A;  5E73 A;  4A9L A;  3DAI A;  5I88 A;  4Z93 A;  3O37 A;  4XY9 A;  4F3I A;  4O7E A;  2YEK A;  5E74 A;  4QC3 A;  4ZW1 A;  1N72 A;  4CUP A;  1JSP B;  4MEO A;  4UIZ A;  5FH8 A;  5FFY A;  3P1D A;  3SVH A;  5EK9 A;  4OGI A;  4CFK A;  4Z1Q A;  3AQA A;  4TZ2 A;  3MQM A;  4NR6 A;  2E3K A;  5C7N A;  5CZG A;  5D3N A;  5FG6 A;  4NQN A;  2E7N A;  3IU5 A;  4WHW A;  5FE6 A;  4TT4 A;  5AME A;  5DY7 A;  5FG4 A;  5KU3 A;  5E9Y A;  4YYN A;  5IID A;  5CUE A;  2I8N A;  5CQT A;  1WUG A;  5EPS A;  2WP1 A;  4PCI A;  4J1P A;  4NR9 A;  4NUD A;  2F6N A;  4KV4 A;  4O7A A;  5DYC A;  5IGK A;  3Q2F A;  5F1H A;  5HQ6 A;  2E7O A;  5DYA A;  5I7X A;  4Z6I A;  2D9E A;  2RFJ A;  5DKC A;  1JM4 B;  4LRG A;  4QYD A;  2YW5 A;  4QSR A;  2LSP B;  5KTU A;  3JVJ A;  4J3I A;  5DYU A;  3S92 A;  5LKT A;  4O7B A;  5FE4 A;  2DVS A;  4QSU A;  5CUD A;  3DWY A;  4GPJ A;  3MXF A;  4BJX A;  5A5N A;  4UYH A;  2DKW A;  5EQ1 A;  5E9K A;  5CQA A;  5J0D A;  4QUU A;  4YH4 A;  4ALH A;  5CP5 A;  5L98 A;  5BT5 A;  4UYD A;  4XUA A;  3JVL A;  5LUU A;  4NXJ A;  3JVK A;  3P5O A;  4TU6 A;  4O76 A;  4QSQ A;  5EGU A;  5L99 A;  5LJ1 A;  5H1V A;  4ZC9 A;  4FLP A;  4HXN A;  1F68 A;  5I86 A;  4TT6 A;  4HXM A;  4J0R A;  4YYD A;  1EQF A;  4WHU A;  4XUB A;  5HEN A;  5FE5 A;  4O74 A;  4Y03 A;  5E3D A;  5ENC A;  3Q2E A;  4UIT A;  4HBY A;  4MR5 A;  4YH3 A;  4NRA A;  4UIV A;  5DLX A;  5ACY A;  2L5E A;  5DFC A;  5HFR A;  3UVD A;  5CUC A;  4QSV A;  5DW1 A;  4BW2 A;  5IGM A;  4YYM A;  5LKU A;  3AAD A;  3O36 A;  5LVQ A;  5C4Q A;  4O72 A;  3SVF A;  5F36 A;  4N4H A;  4O71 A;  4UIU A;  4XYA A;  5ENB A;  5CTL A;  3JVM A;  4IR3 A;  4QYL A;  2KTB B;  3P1F A;  4CFL A;  3LQH A;  2NXB A;  4HBV A;  5D7X A;  3HME A;  5DX4 A;  3FKM X;  4BW1 A;  5EI4 A;  2DVV A;  5I7Y A;  3UV4 A;  5CUB A;  5E9L A;  4A9H A;  5D3J A;  3U5N A;  4CL9 A;  2DVR A;  4YYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...