5G4SA

Bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl-n- ethyl-2-methoxybenzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
116
structure length
116
Chain Sequence
EIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PEREGRIN
publication title Gsk6853, a Chemical Probe for Inhibition of the Brpf1 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5g4sA00
3QZSA 2RNWA 5L99A 5A7CA 5DW2A 5EPSA 4LDFA 4HXLA 4HXOA 3AQAA 4C67A 4J0RA 4YYMA 5LKTA 2DKWA 3SVHA 2RFJA 3P1FA 5L8UA 4QSWA 4BHWA 5KTXA 4QUTA 4NRBA 4NR5A 4YYDA 3NXBA 5EQ1A 4LZSA 4NR9A 5EISA 5CUDA 5CUEA 4UIWA 5I86A 4HBXA 4UITA 5FE0A 3UVXA 5E3DA 4YBMA 3DWYA 5L96A 4A9LA 5DYCA 2KTBB 5DYUA 2DVVA 5FFVA 5C4QA 2NXBA 4NQNA 5CQ4A 4HBVA 5D3LA 5F60A 3P1EA 4NRCA 2LSPB 5A5NA 5AD2A 4QR3A 3ZYUA 3JVKA 4DONA 3JVJA 2YDWA 5HEMA 3DAIA 5HQ5A 4NYXA 4UYFB 4O77A 3G0LA 4QSQA 5CQ5A 2DWWA 4NUDA 5E9IA 2R10A 4PTBA 3U5JA 5CUAA 3MB4A 5H85A 5HRXA 2YW5A 4HXKA 5CTLA 4N3WA 4UYHA 5FE4A 5L97A 4TT2A 4MR5A 4ALGA 4QSUA 4Q0NA 4QSSA 5F1HA 4KCXA 5TCMA 4TTEA 4YAXA 4OGJA 4MR6A 4A9JA 2F6NA 5F2PA 5E7DA 5HLSA 4ZC9A 1N72A 4A9NA 5FE9A 5C89A 4A9FA 3SVGA 5FG4A 4A9IA 3U5MA 4LYIA 5ETDA 4NR4A 5EWHA 4QSXA 5LVQA 5ENFA 2R0VA 2DATA 5CQ3A 4UIZA 5CQ8A 2DVSA 4MR3A 4QSRA 5A5RA 5J0DA 1JSPB 4CUQA 4YBTA 4CFKA 5C7NA 4QR5A 5IBNA 4YABA 4X2IA 5F1LA 5KTWA 3O37A 3UVYA 5D3JA 5FG6A 4BW3A 5DKCA 4NQMA 4PY6A 4O78A 5EVAA 5I80A 4IR6A 4NYVA 4LC2A 5E73A 2RNYA 5D7XA 3RCWA 5DLZA 5ENBA 4LZRA 3U5KA 3FKMX 4YYGA 4CURA 5JI8A 5I1QA 5FE1A 5BT4A 4PKLA 4ALHA 5CUBA 3UW9A 1EQFA 4UYGA 4ZW1A 3S92A 5HELA 5TB6A 5E9KA 5DW1A 4HXRA 4HXSA 1JM4B 4QSVA 5CY9A 4TU4A 4QR4A 5EPBA 5F36A 5LVRA 2G4AA 2GRCA 2YELA 4Z6HA 3UV5A 4LRGA 4GPJA 5E9VA 5E0RA 4MEOA 5A5SA 4IOOA 5EK9A 5CS8A 5CRZA 4NR8A 4E96A 3O36A 5FB0A 4NUEA 4N4HA 4CUSA 5IGNA 3GG3A 5EPRA 3I3JA 5ENJA 4XYAA 5DLXA 5DY7A 5FH7A 4A9HA 4MEQA 4OUFA 3U5PA 5FE3A 4BW1A 2FSAA 5D3HA 5A85A 5E9MA 5IGLA 4QB3A 4TZ8A 3G0JA 5ENCA 4QYLA 2L5EA 4YADA 5CP5A 5C8GA 5BT3A 2F6JA 5D3NA 3LQHA 4UYDA 4XUAA 5K29A 5EWCA 4O7CA 4MEPA 5FE5A 4QNSA 5IGKA 4A9MA 2YYNA 5KTUA 5HRVA 5COIA 5DFBA 4PCEA 4YH3A 4TT6A 5HM0A 4A9EA 4OGIA 4YYJA 5CRMA 5D3PA 4NS5A 3Q2FA 4NUCA 4O74A 5CU8A 5EWVA 5FBXA 2E7NA 5D0CA 5LJ1A 4TU6A 1WUGA 1ZS5A 4J0SA 5F61A 3HMHA 3IU6A 4YYNA 2D82A 4IR5A 5F25A 5A5PA 4O7BA 3LJWA 4HXNA 5ENIA 4TZ2A 5E74A 5II1A 4MENA 5CPEA 4IOQA 4CFLA 5C85A 4AKNA 5ENHA 3TLPA 5E9LA 4O70A 4CL9A 5FE6A 4Q0OA 4O72A 4QYDA 5EGUA 4CUTA 3HMFA 4XUBA 4YATA 5AD3A 3MB3A 4QY4A 5DFCA 3UVWA 4UYFA 4UYEA 5I29A 2R0YA 5L98A 4HBYA 2RO1A 5H1UA 5HJCA 3UVDA 4XY8A 4LR6A 3MQMA 4MR4A 4QSPA 3U5LA 4LYSA 4J3IA 5HCLA 4LZ2A 4O71A 5FH8A 3LXJA 5CZGA 2DVQA 5CQAA 5CQ6A 5LJ2A 5FB1A 2N9GA 1E6IA 5E3GA 4TS8A 4IR4A 4QSTA 3ONIA 4KV4A 4XY9A 4UIYA 2RS9B 4LYWA 4NR7A 5A5OA 3JVLA 3IU5A 5FE8A 5D24A 5HQ7A 5AMFA 3SVFA 4NXJA 5EV9A 5EU1A 5F63A 4A9OA 3D7CA 2E3KA 2H60A 4Z93A 5CUGA 4Y03A 5JWMA 4HBWA 3LQJA 5ACYA 5EWDA 5FDZA 2RNXA 4BW2A 4RVRA 4C66A 5F3AA 4YY6A 4YC9A 2WP1A 2DVRA 3O35A 3K2JA 5LJ0A 2L85A 4QZSA 4TT4A 5KU3A 4O7EA 3P5OA 4KV1A 2OUOA 5CFWA 4A9KA 5FE2A 5D26A 5DBMA 2WP2A 5DYAA 4F3IA 5D25A 4QEUA 4O7FA 5H1VA 5H1TA 5DKHA 4PCIA 5L8TA 5DYXA 1X0JA 4UIUA 4N4GA 5E9YA 2I7KA 5AMEA 5I40A 1F68A 4Z1SA 5A81A 5CGPA 2D9EA 5ENGA 4PS5A 3U5NA 5HRWA 5EWWA 3AADA 3JVMA 3MUKA 2RI7A 4N4IA 4CLBA 5II2A 4NRAA 5IGMA 4BJXA 5DKDA 4WHUA 2OSSA 2YQDA 5EICA 4IR3A 5CQTA 4HXPA 5HENA 4BW4A 2YEMA 5FG5A 4QBMA 4UIVA 4QC3A 5CQ7A 3HMEA 3O34A 5A5QA 4J1PA 4QUUA 3P1CA 3UV2A 5I83A 5LUUA 5LKXA 4N4FA 5I7XA 3MULA 4O75A 5A83A 4YYHA 4QC1A 3QZVA 3UV4A 5A82A 4YYKA 5DFDA 4UIXA 4CUPA 3Q2EA 4YH4A 4TQNA 5HFRA 5D3SA 5BT5A 3O33A 5I88A 5IIDA 2OO1A 2L84A 4O7AA 5EA1A 4TYLA 4YK0A 5HFQA 4QEVA 3MXFA 4CUUA 4YYIA 4Z1QA 5CUCA 1WUMA 3P1DA 5G4SA 5I7YA 4YY4A 5HQ6A 2MJVB 4IORA 4Z6IA 5F62A 5KHMA 4YBSA 2E7OA 5EI4A 5DX4A 4NYWA 2YEKA 5D3TA 4NR6A 4WHWA 3QZTA 5FFYA 5FE7A 5EM3A 5C87A 5FFWA 4ZQLA 5LKZA 5EP7A 5IG6A 4QEWA 5LKUA 3S91A 4HXMA 2R0SA 4O76A 4WIVA 3U5OA 5G4RA 5ETBA 5D3RA 4FLPA 5I89A 5KO4A 5F5ZA 5FH6A 5ENEA 2I8NA 3LQIA
chains in the Genus database with same CATH superfamily
3QZSA 2RNWA 5L99A 5A7CA 4AKHA 5DW2A 5EPSA 4LDFA 4HXLA 4HXOA 3AQAA 4C67A 4J0RA 4YYMA 5LKTA 2DKWA 3SVHA 2RFJA 3P1FA 5L8UA 4QSWA 4BHWA 5KTXA 4QUTA 4NRBA 4NR5A 4YYDA 3NXBA 5EQ1A 4LZSA 4NR9A 5EISA 5CUDA 5CUEA 4UIWA 5I86A 4HBXA 4UITA 5FE0A 3UVXA 5E3DA 4YBMA 3DWYA 5L96A 4A9LA 5DYCA 2KTBB 5DYUA 2DVVA 5FFVA 5C4QA 2NXBA 4NQNA 5CQ4A 4HBVA 5D3LA 5F60A 3P1EA 4NRCA 2LSPB 5A5NA 5AD2A 4QR3A 3ZYUA 3JVKA 4DONA 3JVJA 2YDWA 5HEMA 3DAIA 5HQ5A 4NYXA 4UYFB 4O77A 3G0LA 4QSQA 5CQ5A 2DWWA 4NUDA 5E9IA 2R10A 4PTBA 3U5JA 5CUAA 3MB4A 5H85A 5HRXA 2YW5A 4HXKA 5CTLA 4N3WA 4UYHA 5FE4A 5L97A 4TT2A 4MR5A 4ALGA 4QSUA 4Q0NA 4QSSA 5F1HA 4KCXA 5TCMA 4TTEA 4YAXA 4OGJA 4MR6A 4A9JA 2F6NA 5F2PA 5E7DA 5HLSA 4ZC9A 1N72A 4A9NA 5FE9A 5C89A 4A9FA 3SVGA 5FG4A 4A9IA 3U5MA 4LYIA 5ETDA 4NR4A 5EWHA 4QSXA 5LVQA 5ENFA 2R0VA 2DATA 5CQ3A 4UIZA 5CQ8A 2DVSA 4MR3A 4QSRA 5A5RA 5J0DA 1JSPB 4CUQA 4YBTA 4CFKA 5C7NA 4QR5A 5IBNA 4YABA 4X2IA 5F1LA 5KTWA 3O37A 3UVYA 5D3JA 5FG6A 4BW3A 5DKCA 4NQMA 4PY6A 4O78A 5EVAA 5I80A 4IR6A 4NYVA 4LC2A 5E73A 2RNYA 5D7XA 3RCWA 5DLZA 5ENBA 4LZRA 3U5KA 3FKMX 4YYGA 4CURA 5JI8A 5I1QA 5FE1A 5BT4A 4PKLA 4ALHA 5CUBA 3UW9A 1EQFA 4UYGA 4ZW1A 3S92A 5HELA 5TB6A 5E9KA 5DW1A 4HXRA 4HXSA 1JM4B 4QSVA 5CY9A 4TU4A 4QR4A 5EPBA 5F36A 5LVRA 2G4AA 2GRCA 2YELA 4Z6HA 3UV5A 4LRGA 4GPJA 5E9VA 5E0RA 4MEOA 5A5SA 4IOOA 5EK9A 5CS8A 5CRZA 4NR8A 4E96A 3ERRA 3O36A 5FB0A 4NUEA 4N4HA 4CUSA 5IGNA 3D1BA 3GG3A 5EPRA 3I3JA 5ENJA 4XYAA 5DLXA 5DY7A 5FH7A 4A9HA 4MEQA 4OUFA 3U5PA 5FE3A 4BW1A 2FSAA 5D3HA 5A85A 5E9MA 5IGLA 4QB3A 4TZ8A 3G0JA 5ENCA 4QYLA 2L5EA 4YADA 5CP5A 5C8GA 5BT3A 2F6JA 5D3NA 3LQHA 4UYDA 4XUAA 5K29A 5EWCA 1ZKRA 4O7CA 4MEPA 5FE5A 4QNSA 5IGKA 4A9MA 2YYNA 5KTUA 5HRVA 5COIA 5DFBA 4PCEA 4YH3A 4TT6A 5HM0A 4A9EA 4OGIA 4YYJA 5CRMA 5D3PA 4NS5A 3Q2FA 4NUCA 4O74A 5CU8A 5EWVA 5FBXA 2E7NA 5D0CA 5LJ1A 4TU6A 1WUGA 1ZS5A 4J0SA 5F61A 3HMHA 3IU6A 4YYNA 2D82A 4IR5A 5F25A 5A5PA 4O7BA 3LJWA 4HXNA 5ENIA 4TZ2A 5E74A 5II1A 4MENA 5CPEA 4IOQA 4CFLA 5C85A 4AKNA 5ENHA 3TLPA 5E9LA 4O70A 4CL9A 5FE6A 4Q0OA 4O72A 4QYDA 5EGUA 4CUTA 3HMFA 4XUBA 4YATA 5AD3A 3MB3A 4QY4A 5DFCA 3UVWA 4UYFA 1PUOA 4UYEA 2R0YA 5L98A 5I29A 4HBYA 2RO1A 5H1UA 5HJCA 3VKGA 3UVDA 4XY8A 4LR6A 3MQMA 4MR4A 4QSPA 3U5LA 4LYSA 4J3IA 5HCLA 4LZ2A 4O71A 5FH8A 3LXJA 5CZGA 2DVQA 5CQAA 5CQ6A 5LJ2A 5FB1A 2N9GA 1E6IA 5E3GA 4TS8A 4IR4A 4QSTA 3ONIA 4KV4A 4XY9A 4UIYA 3VKHA 2RS9B 4LYWA 4NR7A 5A5OA 3JVLA 3IU5A 5FE8A 5D24A 5HQ7A 5AMFA 3SVFA 4NXJA 5EV9A 5EU1A 5F63A 4A9OA 3D7CA 2E3KA 2H60A 4Z93A 5CUGA 4Y03A 5JWMA 4HBWA 3LQJA 5ACYA 5EWDA 5FDZA 2RNXA 4BW2A 4RVRA 4C66A 5F3AA 4YY6A 4YC9A 2WP1A 2DVRA 3O35A 2EJNA 3K2JA 2L85A 5LJ0A 4QZSA 4TT4A 5KU3A 4O7EA 3P5OA 4KV1A 2OUOA 5CFWA 4A9KA 5FE2A 5D26A 5DBMA 2WP2A 5DYAA 4F3IA 4AI6A 5D25A 4QEUA 4O7FA 5H1VA 5H1TA 5DKHA 4PCIA 5L8TA 5DYXA 1X0JA 4UIUA 4N4GA 5E9YA 2I7KA 5AMEA 5I40A 1F68A 4Z1SA 5A81A 5CGPA 2D9EA 5ENGA 4PS5A 3U5NA 5HRWA 5EWWA 3AADA 3JVMA 3MUKA 2RI7A 4N4IA 4CLBA 5II2A 4NRAA 5IGMA 4BJXA 5DKDA 4WHUA 2OSSA 2YQDA 5EICA 4IR3A 5CQTA 4HXPA 5HENA 4BW4A 2YEMA 5FG5A 4QBMA 4UIVA 4QC3A 5CQ7A 3HMEA 3O34A 5A5QA 4J1PA 4QUUA 3P1CA 3UV2A 5I83A 5LUUA 5LKXA 4N4FA 5I7XA 3MULA 4O75A 5A83A 4YYHA 4QC1A 3QZVA 3UV4A 5A82A 4YYKA 5DFDA 4UIXA 4CUPA 3Q2EA 3D1DA 4YH4A 4TQNA 5HFRA 5D3SA 5BT5A 3O33A 5I88A 5IIDA 2OO1A 2L84A 4O7AA 5EA1A 4TYLA 4YK0A 5HFQA 4QEVA 3MXFA 4CUUA 4YYIA 4Z1QA 5CUCA 1WUMA 3P1DA 5G4SA 5I7YA 4YY4A 5HQ6A 2MJVB 4IORA 4Z6IA 5F62A 5KHMA 4YBSA 2E7OA 5EI4A 5DX4A 4NYWA 2YEKA 5D3TA 4NR6A 4WHWA 3QZTA 5FFYA 5FE7A 5EM3A 5C87A 5FFWA 4AKGA 4ZQLA 5LKZA 4AKIA 5EP7A 5IG6A 4QEWA 5LKUA 3S91A 4HXMA 2R0SA 4O76A 4WIVA 3U5OA 5G4RA 5ETBA 5D3RA 4FLPA 5I89A 5KO4A 5F5ZA 5FH6A 5ENEA 2I8NA 3LQIA
chains in the Genus database with same CATH topology
3QZSA 2RNWA 5L99A 5A7CA 5DW2A 5EPSA 4LDFA 4HXLA 4HXOA 3AQAA 4C67A 4J0RA 4YYMA 5LKTA 2DKWA 3SVHA 2RFJA 3P1FA 5L8UA 4QSWA 4BHWA 5KTXA 4QUTA 4NRBA 4NR5A 4YYDA 3NXBA 5EQ1A 4LZSA 4NR9A 5EISA 5CUDA 5CUEA 4UIWA 5I86A 4HBXA 4UITA 5FE0A 3UVXA 5E3DA 4YBMA 3DWYA 5L96A 4A9LA 5DYCA 2KTBB 5DYUA 2DVVA 5FFVA 5C4QA 2NXBA 4NQNA 5CQ4A 4HBVA 5D3LA 5F60A 3P1EA 4NRCA 2LSPB 5A5NA 5AD2A 4QR3A 3ZYUA 3JVKA 4DONA 3JVJA 2YDWA 5HEMA 3DAIA 5HQ5A 4NYXA 4UYFB 4O77A 3G0LA 4QSQA 5CQ5A 2DWWA 4NUDA 5E9IA 2R10A 4PTBA 3U5JA 5CUAA 3MB4A 5H85A 5HRXA 2YW5A 4HXKA 5CTLA 4N3WA 4UYHA 5FE4A 5L97A 4TT2A 4MR5A 4ALGA 4QSUA 4Q0NA 4QSSA 5F1HA 4KCXA 5TCMA 4TTEA 4YAXA 4OGJA 4MR6A 4A9JA 2F6NA 5F2PA 5E7DA 5HLSA 4ZC9A 1N72A 4A9NA 5FE9A 5C89A 4A9FA 3SVGA 5FG4A 4A9IA 3U5MA 4LYIA 5ETDA 4NR4A 5EWHA 4QSXA 5LVQA 5ENFA 2R0VA 2DATA 5CQ3A 4UIZA 5CQ8A 2DVSA 4MR3A 4QSRA 5A5RA 5J0DA 1JSPB 4CUQA 4YBTA 4CFKA 5C7NA 4QR5A 5IBNA 4YABA 4X2IA 5F1LA 5KTWA 3O37A 3UVYA 5D3JA 5FG6A 4BW3A 5DKCA 4NQMA 4PY6A 4O78A 5EVAA 5I80A 4IR6A 4NYVA 4LC2A 5E73A 2RNYA 5D7XA 3RCWA 5DLZA 5ENBA 4LZRA 3U5KA 3FKMX 4YYGA 4CURA 5JI8A 5I1QA 5FE1A 5BT4A 4PKLA 4ALHA 5CUBA 3UW9A 1EQFA 4UYGA 4ZW1A 3S92A 5HELA 5TB6A 5E9KA 5DW1A 4HXRA 4HXSA 1JM4B 4QSVA 5CY9A 4TU4A 4QR4A 5EPBA 5F36A 5LVRA 2G4AA 2GRCA 2YELA 4Z6HA 3UV5A 4LRGA 4GPJA 5E9VA 5E0RA 4MEOA 5A5SA 4IOOA 5EK9A 5CS8A 5CRZA 4NR8A 4E96A 3O36A 5FB0A 4NUEA 4N4HA 4CUSA 5IGNA 3GG3A 5EPRA 3I3JA 5ENJA 4XYAA 5DLXA 5DY7A 5FH7A 4A9HA 4MEQA 4OUFA 3U5PA 5FE3A 4BW1A 2FSAA 5D3HA 5A85A 5E9MA 5IGLA 4QB3A 4TZ8A 3G0JA 5ENCA 4QYLA 2L5EA 4YADA 5CP5A 5C8GA 5BT3A 2F6JA 5D3NA 3LQHA 4UYDA 4XUAA 5K29A 5EWCA 4O7CA 4MEPA 5FE5A 4QNSA 5IGKA 4A9MA 2YYNA 5KTUA 5HRVA 5COIA 5DFBA 4PCEA 4YH3A 4TT6A 5HM0A 4A9EA 4OGIA 4YYJA 5CRMA 5D3PA 4NS5A 3Q2FA 4NUCA 4O74A 5CU8A 5EWVA 5FBXA 2E7NA 5D0CA 5LJ1A 4TU6A 1WUGA 1ZS5A 4J0SA 5F61A 3HMHA 3IU6A 4YYNA 2D82A 4IR5A 5F25A 5A5PA 4O7BA 3LJWA 4HXNA 5ENIA 4TZ2A 5E74A 5II1A 4MENA 5CPEA 4IOQA 4CFLA 5C85A 4AKNA 5ENHA 3TLPA 5E9LA 4O70A 4CL9A 5FE6A 4Q0OA 4O72A 4QYDA 5EGUA 4CUTA 3HMFA 4XUBA 4YATA 5AD3A 3MB3A 4QY4A 5DFCA 3UVWA 4UYFA 4UYEA 5I29A 2R0YA 5L98A 4HBYA 2RO1A 5H1UA 5HJCA 3UVDA 4XY8A 4LR6A 3MQMA 4MR4A 4QSPA 3U5LA 4LYSA 4J3IA 5HCLA 4LZ2A 4O71A 5FH8A 3LXJA 5CZGA 2DVQA 5CQAA 5CQ6A 5LJ2A 5FB1A 2N9GA 1E6IA 5E3GA 4TS8A 4IR4A 4QSTA 3ONIA 4KV4A 4XY9A 4UIYA 2RS9B 4LYWA 4NR7A 5A5OA 3JVLA 3IU5A 5FE8A 5D24A 5HQ7A 5AMFA 3SVFA 4NXJA 5EV9A 5EU1A 5F63A 4A9OA 3D7CA 2E3KA 2H60A 4Z93A 5CUGA 4Y03A 5JWMA 4HBWA 3LQJA 5ACYA 5EWDA 5FDZA 2RNXA 4BW2A 4RVRA 4C66A 5F3AA 4YY6A 4YC9A 2WP1A 2DVRA 3O35A 3K2JA 5LJ0A 2L85A 4QZSA 4TT4A 5KU3A 4O7EA 3P5OA 4KV1A 2OUOA 5CFWA 4A9KA 5FE2A 5D26A 5DBMA 2WP2A 5DYAA 4F3IA 5D25A 4QEUA 4O7FA 5H1VA 5H1TA 5DKHA 4PCIA 5L8TA 5DYXA 1X0JA 4UIUA 4N4GA 5E9YA 2I7KA 5AMEA 5I40A 1F68A 4Z1SA 5A81A 5CGPA 2D9EA 5ENGA 4PS5A 3U5NA 5HRWA 5EWWA 3AADA 3JVMA 3MUKA 2RI7A 4N4IA 4CLBA 5II2A 4NRAA 5IGMA 4BJXA 5DKDA 4WHUA 2OSSA 2YQDA 5EICA 4IR3A 5CQTA 4HXPA 5HENA 4BW4A 2YEMA 5FG5A 4QBMA 4UIVA 4QC3A 5CQ7A 3HMEA 3O34A 5A5QA 4J1PA 4QUUA 3P1CA 3UV2A 5I83A 5LUUA 5LKXA 4N4FA 5I7XA 3MULA 4O75A 5A83A 4YYHA 4QC1A 3QZVA 3UV4A 5A82A 4YYKA 5DFDA 4UIXA 4CUPA 3Q2EA 4YH4A 4TQNA 5HFRA 5D3SA 5BT5A 3O33A 5I88A 5IIDA 2OO1A 2L84A 4O7AA 5EA1A 4TYLA 4YK0A 5HFQA 4QEVA 3MXFA 4CUUA 4YYIA 4Z1QA 5CUCA 1WUMA 3P1DA 5G4SA 5I7YA 4YY4A 5HQ6A 2MJVB 4IORA 4Z6IA 5F62A 5KHMA 4YBSA 2E7OA 5EI4A 5DX4A 4NYWA 2YEKA 5D3TA 4NR6A 4WHWA 3QZTA 5FFYA 5FE7A 5EM3A 5C87A 5FFWA 4ZQLA 5LKZA 5EP7A 5IG6A 4QEWA 5LKUA 3S91A 4HXMA 2R0SA 4O76A 4WIVA 3U5OA 5G4RA 5ETBA 5D3RA 4FLPA 5I89A 5KO4A 5F5ZA 5FH6A 5ENEA 2I8NA 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZS A;  2RNW A;  5L99 A;  5A7C A;  5DW2 A;  5EPS A;  4LDF A;  4HXL A;  4HXO A;  3AQA A;  4C67 A;  4J0R A;  4YYM A;  5LKT A;  2DKW A;  3SVH A;  2RFJ A;  3P1F A;  5L8U A;  4QSW A;  4BHW A;  5KTX A;  4QUT A;  4NRB A;  4NR5 A;  4YYD A;  3NXB A;  5EQ1 A;  4LZS A;  4NR9 A;  5EIS A;  5CUD A;  5CUE A;  4UIW A;  5I86 A;  4HBX A;  4UIT A;  5FE0 A;  3UVX A;  5E3D A;  4YBM A;  3DWY A;  5L96 A;  4A9L A;  5DYC A;  2KTB B;  5DYU A;  2DVV A;  5FFV A;  5C4Q A;  2NXB A;  4NQN A;  5CQ4 A;  4HBV A;  5D3L A;  5F60 A;  3P1E A;  4NRC A;  2LSP B;  5A5N A;  5AD2 A;  4QR3 A;  3ZYU A;  3JVK A;  4DON A;  3JVJ A;  2YDW A;  5HEM A;  3DAI A;  5HQ5 A;  4NYX A;  4UYF B;  4O77 A;  3G0L A;  4QSQ A;  5CQ5 A;  2DWW A;  4NUD A;  5E9I A;  2R10 A;  4PTB A;  3U5J A;  5CUA A;  3MB4 A;  5H85 A;  5HRX A;  2YW5 A;  4HXK A;  5CTL A;  4N3W A;  4UYH A;  5FE4 A;  5L97 A;  4TT2 A;  4MR5 A;  4ALG A;  4QSU A;  4Q0N A;  4QSS A;  5F1H A;  4KCX A;  5TCM A;  4TTE A;  4YAX A;  4OGJ A;  4MR6 A;  4A9J A;  2F6N A;  5F2P A;  5E7D A;  5HLS A;  4ZC9 A;  1N72 A;  4A9N A;  5FE9 A;  5C89 A;  4A9F A;  3SVG A;  5FG4 A;  4A9I A;  3U5M A;  4LYI A;  5ETD A;  4NR4 A;  5EWH A;  4QSX A;  5LVQ A;  5ENF A;  2R0V A;  2DAT A;  5CQ3 A;  4UIZ A;  5CQ8 A;  2DVS A;  4MR3 A;  4QSR A;  5A5R A;  5J0D A;  1JSP B;  4CUQ A;  4YBT A;  4CFK A;  5C7N A;  4QR5 A;  5IBN A;  4YAB A;  4X2I A;  5F1L A;  5KTW A;  3O37 A;  3UVY A;  5D3J A;  5FG6 A;  4BW3 A;  5DKC A;  4NQM A;  4PY6 A;  4O78 A;  5EVA A;  5I80 A;  4IR6 A;  4NYV A;  4LC2 A;  5E73 A;  2RNY A;  5D7X A;  3RCW A;  5DLZ A;  5ENB A;  4LZR A;  3U5K A;  3FKM X;  4YYG A;  4CUR A;  5JI8 A;  5I1Q A;  5FE1 A;  5BT4 A;  4PKL A;  4ALH A;  5CUB A;  3UW9 A;  1EQF A;  4UYG A;  4ZW1 A;  3S92 A;  5HEL A;  5TB6 A;  5E9K A;  5DW1 A;  4HXR A;  4HXS A;  1JM4 B;  4QSV A;  5CY9 A;  4TU4 A;  4QR4 A;  5EPB A;  5F36 A;  5LVR A;  2G4A A;  2GRC A;  2YEL A;  4Z6H A;  3UV5 A;  4LRG A;  4GPJ A;  5E9V A;  5E0R A;  4MEO A;  5A5S A;  4IOO A;  5EK9 A;  5CS8 A;  5CRZ A;  4NR8 A;  4E96 A;  3O36 A;  5FB0 A;  4NUE A;  4N4H A;  4CUS A;  5IGN A;  3GG3 A;  5EPR A;  3I3J A;  5ENJ A;  4XYA A;  5DLX A;  5DY7 A;  5FH7 A;  4A9H A;  4MEQ A;  4OUF A;  3U5P A;  5FE3 A;  4BW1 A;  2FSA A;  5D3H A;  5A85 A;  5E9M A;  5IGL A;  4QB3 A;  4TZ8 A;  3G0J A;  5ENC A;  4QYL A;  2L5E A;  4YAD A;  5CP5 A;  5C8G A;  5BT3 A;  2F6J A;  5D3N A;  3LQH A;  4UYD A;  4XUA A;  5K29 A;  5EWC A;  4O7C A;  4MEP A;  5FE5 A;  4QNS A;  5IGK A;  4A9M A;  2YYN A;  5KTU A;  5HRV A;  5COI A;  5DFB A;  4PCE A;  4YH3 A;  4TT6 A;  5HM0 A;  4A9E A;  4OGI A;  4YYJ A;  5CRM A;  5D3P A;  4NS5 A;  3Q2F A;  4NUC A;  4O74 A;  5CU8 A;  5EWV A;  5FBX A;  2E7N A;  5D0C A;  5LJ1 A;  4TU6 A;  1WUG A;  1ZS5 A;  4J0S A;  5F61 A;  3HMH A;  3IU6 A;  4YYN A;  2D82 A;  4IR5 A;  5F25 A;  5A5P A;  4O7B A;  3LJW A;  4HXN A;  5ENI A;  4TZ2 A;  5E74 A;  5II1 A;  4MEN A;  5CPE A;  4IOQ A;  4CFL A;  5C85 A;  4AKN A;  5ENH A;  3TLP A;  5E9L A;  4O70 A;  4CL9 A;  5FE6 A;  4Q0O A;  4O72 A;  4QYD A;  5EGU A;  4CUT A;  3HMF A;  4XUB A;  4YAT A;  5AD3 A;  3MB3 A;  4QY4 A;  5DFC A;  3UVW A;  4UYF A;  4UYE A;  5I29 A;  2R0Y A;  5L98 A;  4HBY A;  2RO1 A;  5H1U A;  5HJC A;  3UVD A;  4XY8 A;  4LR6 A;  3MQM A;  4MR4 A;  4QSP A;  3U5L A;  4LYS A;  4J3I A;  5HCL A;  4LZ2 A;  4O71 A;  5FH8 A;  3LXJ A;  5CZG A;  2DVQ A;  5CQA A;  5CQ6 A;  5LJ2 A;  5FB1 A;  2N9G A;  1E6I A;  5E3G A;  4TS8 A;  4IR4 A;  4QST A;  3ONI A;  4KV4 A;  4XY9 A;  4UIY A;  2RS9 B;  4LYW A;  4NR7 A;  5A5O A;  3JVL A;  3IU5 A;  5FE8 A;  5D24 A;  5HQ7 A;  5AMF A;  3SVF A;  4NXJ A;  5EV9 A;  5EU1 A;  5F63 A;  4A9O A;  3D7C A;  2E3K A;  2H60 A;  4Z93 A;  5CUG A;  4Y03 A;  5JWM A;  4HBW A;  3LQJ A;  5ACY A;  5EWD A;  5FDZ A;  2RNX A;  4BW2 A;  4RVR A;  4C66 A;  5F3A A;  4YY6 A;  4YC9 A;  2WP1 A;  2DVR A;  3O35 A;  3K2J A;  5LJ0 A;  2L85 A;  4QZS A;  4TT4 A;  5KU3 A;  4O7E A;  3P5O A;  4KV1 A;  2OUO A;  5CFW A;  4A9K A;  5FE2 A;  5D26 A;  5DBM A;  2WP2 A;  5DYA A;  4F3I A;  5D25 A;  4QEU A;  4O7F A;  5H1V A;  5H1T A;  5DKH A;  4PCI A;  5L8T A;  5DYX A;  1X0J A;  4UIU A;  4N4G A;  5E9Y A;  2I7K A;  5AME A;  5I40 A;  1F68 A;  4Z1S A;  5A81 A;  5CGP A;  2D9E A;  5ENG A;  4PS5 A;  3U5N A;  5HRW A;  5EWW A;  3AAD A;  3JVM A;  3MUK A;  2RI7 A;  4N4I A;  4CLB A;  5II2 A;  4NRA A;  5IGM A;  4BJX A;  5DKD A;  4WHU A;  2OSS A;  2YQD A;  5EIC A;  4IR3 A;  5CQT A;  4HXP A;  5HEN A;  4BW4 A;  2YEM A;  5FG5 A;  4QBM A;  4UIV A;  4QC3 A;  5CQ7 A;  3HME A;  3O34 A;  5A5Q A;  4J1P A;  4QUU A;  3P1C A;  3UV2 A;  5I83 A;  5LUU A;  5LKX A;  4N4F A;  5I7X A;  3MUL A;  4O75 A;  5A83 A;  4YYH A;  4QC1 A;  3QZV A;  3UV4 A;  5A82 A;  4YYK A;  5DFD A;  4UIX A;  4CUP A;  3Q2E A;  4YH4 A;  4TQN A;  5HFR A;  5D3S A;  5BT5 A;  3O33 A;  5I88 A;  5IID A;  2OO1 A;  2L84 A;  4O7A A;  5EA1 A;  4TYL A;  4YK0 A;  5HFQ A;  4QEV A;  3MXF A;  4CUU A;  4YYI A;  4Z1Q A;  5CUC A;  1WUM A;  3P1D A;  5G4S A;  5I7Y A;  4YY4 A;  5HQ6 A;  2MJV B;  4IOR A;  4Z6I A;  5F62 A;  5KHM A;  4YBS A;  2E7O A;  5EI4 A;  5DX4 A;  4NYW A;  2YEK A;  5D3T A;  4NR6 A;  4WHW A;  3QZT A;  5FFY A;  5FE7 A;  5EM3 A;  5C87 A;  5FFW A;  4ZQL A;  5LKZ A;  5EP7 A;  5IG6 A;  4QEW A;  5LKU A;  3S91 A;  4HXM A;  2R0S A;  4O76 A;  4WIV A;  3U5O A;  5G4R A;  5ETB A;  5D3R A;  4FLP A;  5I89 A;  5KO4 A;  5F5Z A;  5FH6 A;  5ENE A;  2I8N A;  3LQI A; 
#chains in the Genus database with same CATH topology
 3QZS A;  2RNW A;  5L99 A;  5A7C A;  4AKH A;  5DW2 A;  5EPS A;  4LDF A;  4HXL A;  4HXO A;  3AQA A;  4C67 A;  4J0R A;  4YYM A;  5LKT A;  2DKW A;  3SVH A;  2RFJ A;  3P1F A;  5L8U A;  4QSW A;  4BHW A;  5KTX A;  4QUT A;  4NRB A;  4NR5 A;  4YYD A;  3NXB A;  5EQ1 A;  4LZS A;  4NR9 A;  5EIS A;  5CUD A;  5CUE A;  4UIW A;  5I86 A;  4HBX A;  4UIT A;  5FE0 A;  3UVX A;  5E3D A;  4YBM A;  3DWY A;  5L96 A;  4A9L A;  5DYC A;  2KTB B;  5DYU A;  2DVV A;  5FFV A;  5C4Q A;  2NXB A;  4NQN A;  5CQ4 A;  4HBV A;  5D3L A;  5F60 A;  3P1E A;  4NRC A;  2LSP B;  5A5N A;  5AD2 A;  4QR3 A;  3ZYU A;  3JVK A;  4DON A;  3JVJ A;  2YDW A;  5HEM A;  3DAI A;  5HQ5 A;  4NYX A;  4UYF B;  4O77 A;  3G0L A;  4QSQ A;  5CQ5 A;  2DWW A;  4NUD A;  5E9I A;  2R10 A;  4PTB A;  3U5J A;  5CUA A;  3MB4 A;  5H85 A;  5HRX A;  2YW5 A;  4HXK A;  5CTL A;  4N3W A;  4UYH A;  5FE4 A;  5L97 A;  4TT2 A;  4MR5 A;  4ALG A;  4QSU A;  4Q0N A;  4QSS A;  5F1H A;  4KCX A;  5TCM A;  4TTE A;  4YAX A;  4OGJ A;  4MR6 A;  4A9J A;  2F6N A;  5F2P A;  5E7D A;  5HLS A;  4ZC9 A;  1N72 A;  4A9N A;  5FE9 A;  5C89 A;  4A9F A;  3SVG A;  5FG4 A;  4A9I A;  3U5M A;  4LYI A;  5ETD A;  4NR4 A;  5EWH A;  4QSX A;  5LVQ A;  5ENF A;  2R0V A;  2DAT A;  5CQ3 A;  4UIZ A;  5CQ8 A;  2DVS A;  4MR3 A;  4QSR A;  5A5R A;  5J0D A;  1JSP B;  4CUQ A;  4YBT A;  4CFK A;  5C7N A;  4QR5 A;  5IBN A;  4YAB A;  4X2I A;  5F1L A;  5KTW A;  3O37 A;  3UVY A;  5D3J A;  5FG6 A;  4BW3 A;  5DKC A;  4NQM A;  4PY6 A;  4O78 A;  5EVA A;  5I80 A;  4IR6 A;  4NYV A;  4LC2 A;  5E73 A;  2RNY A;  5D7X A;  3RCW A;  5DLZ A;  5ENB A;  4LZR A;  3U5K A;  3FKM X;  4YYG A;  4CUR A;  5JI8 A;  5I1Q A;  5FE1 A;  5BT4 A;  4PKL A;  4ALH A;  5CUB A;  3UW9 A;  1EQF A;  4UYG A;  4ZW1 A;  3S92 A;  5HEL A;  5TB6 A;  5E9K A;  5DW1 A;  4HXR A;  4HXS A;  1JM4 B;  4QSV A;  5CY9 A;  4TU4 A;  4QR4 A;  5EPB A;  5F36 A;  5LVR A;  2G4A A;  2GRC A;  2YEL A;  4Z6H A;  3UV5 A;  4LRG A;  4GPJ A;  5E9V A;  5E0R A;  4MEO A;  5A5S A;  4IOO A;  5EK9 A;  5CS8 A;  5CRZ A;  4NR8 A;  4E96 A;  3ERR A;  3O36 A;  5FB0 A;  4NUE A;  4N4H A;  4CUS A;  5IGN A;  3D1B A;  3GG3 A;  5EPR A;  3I3J A;  5ENJ A;  4XYA A;  5DLX A;  5DY7 A;  5FH7 A;  4A9H A;  4MEQ A;  4OUF A;  3U5P A;  5FE3 A;  4BW1 A;  2FSA A;  5D3H A;  5A85 A;  5E9M A;  5IGL A;  4QB3 A;  4TZ8 A;  3G0J A;  5ENC A;  4QYL A;  2L5E A;  4YAD A;  5CP5 A;  5C8G A;  5BT3 A;  2F6J A;  5D3N A;  3LQH A;  4UYD A;  4XUA A;  5K29 A;  5EWC A;  1ZKR A;  4O7C A;  4MEP A;  5FE5 A;  4QNS A;  5IGK A;  4A9M A;  2YYN A;  5KTU A;  5HRV A;  5COI A;  5DFB A;  4PCE A;  4YH3 A;  4TT6 A;  5HM0 A;  4A9E A;  4OGI A;  4YYJ A;  5CRM A;  5D3P A;  4NS5 A;  3Q2F A;  4NUC A;  4O74 A;  5CU8 A;  5EWV A;  5FBX A;  2E7N A;  5D0C A;  5LJ1 A;  4TU6 A;  1WUG A;  1ZS5 A;  4J0S A;  5F61 A;  3HMH A;  3IU6 A;  4YYN A;  2D82 A;  4IR5 A;  5F25 A;  5A5P A;  4O7B A;  3LJW A;  4HXN A;  5ENI A;  4TZ2 A;  5E74 A;  5II1 A;  4MEN A;  5CPE A;  4IOQ A;  4CFL A;  5C85 A;  4AKN A;  5ENH A;  3TLP A;  5E9L A;  4O70 A;  4CL9 A;  5FE6 A;  4Q0O A;  4O72 A;  4QYD A;  5EGU A;  4CUT A;  3HMF A;  4XUB A;  4YAT A;  5AD3 A;  3MB3 A;  4QY4 A;  5DFC A;  3UVW A;  4UYF A;  1PUO A;  4UYE A;  2R0Y A;  5L98 A;  5I29 A;  4HBY A;  2RO1 A;  5H1U A;  5HJC A;  3VKG A;  3UVD A;  4XY8 A;  4LR6 A;  3MQM A;  4MR4 A;  4QSP A;  3U5L A;  4LYS A;  4J3I A;  5HCL A;  4LZ2 A;  4O71 A;  5FH8 A;  3LXJ A;  5CZG A;  2DVQ A;  5CQA A;  5CQ6 A;  5LJ2 A;  5FB1 A;  2N9G A;  1E6I A;  5E3G A;  4TS8 A;  4IR4 A;  4QST A;  3ONI A;  4KV4 A;  4XY9 A;  4UIY A;  3VKH A;  2RS9 B;  4LYW A;  4NR7 A;  5A5O A;  3JVL A;  3IU5 A;  5FE8 A;  5D24 A;  5HQ7 A;  5AMF A;  3SVF A;  4NXJ A;  5EV9 A;  5EU1 A;  5F63 A;  4A9O A;  3D7C A;  2E3K A;  2H60 A;  4Z93 A;  5CUG A;  4Y03 A;  5JWM A;  4HBW A;  3LQJ A;  5ACY A;  5EWD A;  5FDZ A;  2RNX A;  4BW2 A;  4RVR A;  4C66 A;  5F3A A;  4YY6 A;  4YC9 A;  2WP1 A;  2DVR A;  3O35 A;  2EJN A;  3K2J A;  2L85 A;  5LJ0 A;  4QZS A;  4TT4 A;  5KU3 A;  4O7E A;  3P5O A;  4KV1 A;  2OUO A;  5CFW A;  4A9K A;  5FE2 A;  5D26 A;  5DBM A;  2WP2 A;  5DYA A;  4F3I A;  4AI6 A;  5D25 A;  4QEU A;  4O7F A;  5H1V A;  5H1T A;  5DKH A;  4PCI A;  5L8T A;  5DYX A;  1X0J A;  4UIU A;  4N4G A;  5E9Y A;  2I7K A;  5AME A;  5I40 A;  1F68 A;  4Z1S A;  5A81 A;  5CGP A;  2D9E A;  5ENG A;  4PS5 A;  3U5N A;  5HRW A;  5EWW A;  3AAD A;  3JVM A;  3MUK A;  2RI7 A;  4N4I A;  4CLB A;  5II2 A;  4NRA A;  5IGM A;  4BJX A;  5DKD A;  4WHU A;  2OSS A;  2YQD A;  5EIC A;  4IR3 A;  5CQT A;  4HXP A;  5HEN A;  4BW4 A;  2YEM A;  5FG5 A;  4QBM A;  4UIV A;  4QC3 A;  5CQ7 A;  3HME A;  3O34 A;  5A5Q A;  4J1P A;  4QUU A;  3P1C A;  3UV2 A;  5I83 A;  5LUU A;  5LKX A;  4N4F A;  5I7X A;  3MUL A;  4O75 A;  5A83 A;  4YYH A;  4QC1 A;  3QZV A;  3UV4 A;  5A82 A;  4YYK A;  5DFD A;  4UIX A;  4CUP A;  3Q2E A;  3D1D A;  4YH4 A;  4TQN A;  5HFR A;  5D3S A;  5BT5 A;  3O33 A;  5I88 A;  5IID A;  2OO1 A;  2L84 A;  4O7A A;  5EA1 A;  4TYL A;  4YK0 A;  5HFQ A;  4QEV A;  3MXF A;  4CUU A;  4YYI A;  4Z1Q A;  5CUC A;  1WUM A;  3P1D A;  5G4S A;  5I7Y A;  4YY4 A;  5HQ6 A;  2MJV B;  4IOR A;  4Z6I A;  5F62 A;  5KHM A;  4YBS A;  2E7O A;  5EI4 A;  5DX4 A;  4NYW A;  2YEK A;  5D3T A;  4NR6 A;  4WHW A;  3QZT A;  5FFY A;  5FE7 A;  5EM3 A;  5C87 A;  5FFW A;  4AKG A;  4ZQL A;  5LKZ A;  4AKI A;  5EP7 A;  5IG6 A;  4QEW A;  5LKU A;  3S91 A;  4HXM A;  2R0S A;  4O76 A;  4WIV A;  3U5O A;  5G4R A;  5ETB A;  5D3R A;  4FLP A;  5I89 A;  5KO4 A;  5F5Z A;  5FH6 A;  5ENE A;  2I8N A;  3LQI A; 
#chains in the Genus database with same CATH homology
 3QZS A;  2RNW A;  5L99 A;  5A7C A;  5DW2 A;  5EPS A;  4LDF A;  4HXL A;  4HXO A;  3AQA A;  4C67 A;  4J0R A;  4YYM A;  5LKT A;  2DKW A;  3SVH A;  2RFJ A;  3P1F A;  5L8U A;  4QSW A;  4BHW A;  5KTX A;  4QUT A;  4NRB A;  4NR5 A;  4YYD A;  3NXB A;  5EQ1 A;  4LZS A;  4NR9 A;  5EIS A;  5CUD A;  5CUE A;  4UIW A;  5I86 A;  4HBX A;  4UIT A;  5FE0 A;  3UVX A;  5E3D A;  4YBM A;  3DWY A;  5L96 A;  4A9L A;  5DYC A;  2KTB B;  5DYU A;  2DVV A;  5FFV A;  5C4Q A;  2NXB A;  4NQN A;  5CQ4 A;  4HBV A;  5D3L A;  5F60 A;  3P1E A;  4NRC A;  2LSP B;  5A5N A;  5AD2 A;  4QR3 A;  3ZYU A;  3JVK A;  4DON A;  3JVJ A;  2YDW A;  5HEM A;  3DAI A;  5HQ5 A;  4NYX A;  4UYF B;  4O77 A;  3G0L A;  4QSQ A;  5CQ5 A;  2DWW A;  4NUD A;  5E9I A;  2R10 A;  4PTB A;  3U5J A;  5CUA A;  3MB4 A;  5H85 A;  5HRX A;  2YW5 A;  4HXK A;  5CTL A;  4N3W A;  4UYH A;  5FE4 A;  5L97 A;  4TT2 A;  4MR5 A;  4ALG A;  4QSU A;  4Q0N A;  4QSS A;  5F1H A;  4KCX A;  5TCM A;  4TTE A;  4YAX A;  4OGJ A;  4MR6 A;  4A9J A;  2F6N A;  5F2P A;  5E7D A;  5HLS A;  4ZC9 A;  1N72 A;  4A9N A;  5FE9 A;  5C89 A;  4A9F A;  3SVG A;  5FG4 A;  4A9I A;  3U5M A;  4LYI A;  5ETD A;  4NR4 A;  5EWH A;  4QSX A;  5LVQ A;  5ENF A;  2R0V A;  2DAT A;  5CQ3 A;  4UIZ A;  5CQ8 A;  2DVS A;  4MR3 A;  4QSR A;  5A5R A;  5J0D A;  1JSP B;  4CUQ A;  4YBT A;  4CFK A;  5C7N A;  4QR5 A;  5IBN A;  4YAB A;  4X2I A;  5F1L A;  5KTW A;  3O37 A;  3UVY A;  5D3J A;  5FG6 A;  4BW3 A;  5DKC A;  4NQM A;  4PY6 A;  4O78 A;  5EVA A;  5I80 A;  4IR6 A;  4NYV A;  4LC2 A;  5E73 A;  2RNY A;  5D7X A;  3RCW A;  5DLZ A;  5ENB A;  4LZR A;  3U5K A;  3FKM X;  4YYG A;  4CUR A;  5JI8 A;  5I1Q A;  5FE1 A;  5BT4 A;  4PKL A;  4ALH A;  5CUB A;  3UW9 A;  1EQF A;  4UYG A;  4ZW1 A;  3S92 A;  5HEL A;  5TB6 A;  5E9K A;  5DW1 A;  4HXR A;  4HXS A;  1JM4 B;  4QSV A;  5CY9 A;  4TU4 A;  4QR4 A;  5EPB A;  5F36 A;  5LVR A;  2G4A A;  2GRC A;  2YEL A;  4Z6H A;  3UV5 A;  4LRG A;  4GPJ A;  5E9V A;  5E0R A;  4MEO A;  5A5S A;  4IOO A;  5EK9 A;  5CS8 A;  5CRZ A;  4NR8 A;  4E96 A;  3O36 A;  5FB0 A;  4NUE A;  4N4H A;  4CUS A;  5IGN A;  3GG3 A;  5EPR A;  3I3J A;  5ENJ A;  4XYA A;  5DLX A;  5DY7 A;  5FH7 A;  4A9H A;  4MEQ A;  4OUF A;  3U5P A;  5FE3 A;  4BW1 A;  2FSA A;  5D3H A;  5A85 A;  5E9M A;  5IGL A;  4QB3 A;  4TZ8 A;  3G0J A;  5ENC A;  4QYL A;  2L5E A;  4YAD A;  5CP5 A;  5C8G A;  5BT3 A;  2F6J A;  5D3N A;  3LQH A;  4UYD A;  4XUA A;  5K29 A;  5EWC A;  4O7C A;  4MEP A;  5FE5 A;  4QNS A;  5IGK A;  4A9M A;  2YYN A;  5KTU A;  5HRV A;  5COI A;  5DFB A;  4PCE A;  4YH3 A;  4TT6 A;  5HM0 A;  4A9E A;  4OGI A;  4YYJ A;  5CRM A;  5D3P A;  4NS5 A;  3Q2F A;  4NUC A;  4O74 A;  5CU8 A;  5EWV A;  5FBX A;  2E7N A;  5D0C A;  5LJ1 A;  4TU6 A;  1WUG A;  1ZS5 A;  4J0S A;  5F61 A;  3HMH A;  3IU6 A;  4YYN A;  2D82 A;  4IR5 A;  5F25 A;  5A5P A;  4O7B A;  3LJW A;  4HXN A;  5ENI A;  4TZ2 A;  5E74 A;  5II1 A;  4MEN A;  5CPE A;  4IOQ A;  4CFL A;  5C85 A;  4AKN A;  5ENH A;  3TLP A;  5E9L A;  4O70 A;  4CL9 A;  5FE6 A;  4Q0O A;  4O72 A;  4QYD A;  5EGU A;  4CUT A;  3HMF A;  4XUB A;  4YAT A;  5AD3 A;  3MB3 A;  4QY4 A;  5DFC A;  3UVW A;  4UYF A;  4UYE A;  5I29 A;  2R0Y A;  5L98 A;  4HBY A;  2RO1 A;  5H1U A;  5HJC A;  3UVD A;  4XY8 A;  4LR6 A;  3MQM A;  4MR4 A;  4QSP A;  3U5L A;  4LYS A;  4J3I A;  5HCL A;  4LZ2 A;  4O71 A;  5FH8 A;  3LXJ A;  5CZG A;  2DVQ A;  5CQA A;  5CQ6 A;  5LJ2 A;  5FB1 A;  2N9G A;  1E6I A;  5E3G A;  4TS8 A;  4IR4 A;  4QST A;  3ONI A;  4KV4 A;  4XY9 A;  4UIY A;  2RS9 B;  4LYW A;  4NR7 A;  5A5O A;  3JVL A;  3IU5 A;  5FE8 A;  5D24 A;  5HQ7 A;  5AMF A;  3SVF A;  4NXJ A;  5EV9 A;  5EU1 A;  5F63 A;  4A9O A;  3D7C A;  2E3K A;  2H60 A;  4Z93 A;  5CUG A;  4Y03 A;  5JWM A;  4HBW A;  3LQJ A;  5ACY A;  5EWD A;  5FDZ A;  2RNX A;  4BW2 A;  4RVR A;  4C66 A;  5F3A A;  4YY6 A;  4YC9 A;  2WP1 A;  2DVR A;  3O35 A;  3K2J A;  5LJ0 A;  2L85 A;  4QZS A;  4TT4 A;  5KU3 A;  4O7E A;  3P5O A;  4KV1 A;  2OUO A;  5CFW A;  4A9K A;  5FE2 A;  5D26 A;  5DBM A;  2WP2 A;  5DYA A;  4F3I A;  5D25 A;  4QEU A;  4O7F A;  5H1V A;  5H1T A;  5DKH A;  4PCI A;  5L8T A;  5DYX A;  1X0J A;  4UIU A;  4N4G A;  5E9Y A;  2I7K A;  5AME A;  5I40 A;  1F68 A;  4Z1S A;  5A81 A;  5CGP A;  2D9E A;  5ENG A;  4PS5 A;  3U5N A;  5HRW A;  5EWW A;  3AAD A;  3JVM A;  3MUK A;  2RI7 A;  4N4I A;  4CLB A;  5II2 A;  4NRA A;  5IGM A;  4BJX A;  5DKD A;  4WHU A;  2OSS A;  2YQD A;  5EIC A;  4IR3 A;  5CQT A;  4HXP A;  5HEN A;  4BW4 A;  2YEM A;  5FG5 A;  4QBM A;  4UIV A;  4QC3 A;  5CQ7 A;  3HME A;  3O34 A;  5A5Q A;  4J1P A;  4QUU A;  3P1C A;  3UV2 A;  5I83 A;  5LUU A;  5LKX A;  4N4F A;  5I7X A;  3MUL A;  4O75 A;  5A83 A;  4YYH A;  4QC1 A;  3QZV A;  3UV4 A;  5A82 A;  4YYK A;  5DFD A;  4UIX A;  4CUP A;  3Q2E A;  4YH4 A;  4TQN A;  5HFR A;  5D3S A;  5BT5 A;  3O33 A;  5I88 A;  5IID A;  2OO1 A;  2L84 A;  4O7A A;  5EA1 A;  4TYL A;  4YK0 A;  5HFQ A;  4QEV A;  3MXF A;  4CUU A;  4YYI A;  4Z1Q A;  5CUC A;  1WUM A;  3P1D A;  5G4S A;  5I7Y A;  4YY4 A;  5HQ6 A;  2MJV B;  4IOR A;  4Z6I A;  5F62 A;  5KHM A;  4YBS A;  2E7O A;  5EI4 A;  5DX4 A;  4NYW A;  2YEK A;  5D3T A;  4NR6 A;  4WHW A;  3QZT A;  5FFY A;  5FE7 A;  5EM3 A;  5C87 A;  5FFW A;  4ZQL A;  5LKZ A;  5EP7 A;  5IG6 A;  4QEW A;  5LKU A;  3S91 A;  4HXM A;  2R0S A;  4O76 A;  4WIV A;  3U5O A;  5G4R A;  5ETB A;  5D3R A;  4FLP A;  5I89 A;  5KO4 A;  5F5Z A;  5FH6 A;  5ENE A;  2I8N A;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...