4TU6A

Crystal structure of apo atad2a bromodomain with n1064 alternate conformation
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 54
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tu6A00
5BT3A 3O35A 4NR8A 4BW3A 4MEOA 5ENHA 4FLPA 4Z93A 5FG5A 3IU5A 5CPEA 4TT2A 5E9LA 4NUEA 5DYUA 4LYSA 4PCIA 5H1UA 3K2JA 3JVJA 4A9KA 5EWWA 4IORA 3MB3A 4NQMA 4NXJA 4UYGA 1JM4B 2OUOA 5D3SA 5HRXA 5E74A 3NXBA 4UYEA 5D3PA 5A5OA 5G4RA 5D25A 5I7XA 4A9FA 4YYIA 4CURA 5C4QA 5DFDA 4YYDA 5D3RA 3ONIA 3UV4A 4LYIA 5CRMA 4LC2A 5A5NA 5CFWA 5FE4A 4O77A 4QSPA 5FFYA 4QSTA 4MR6A 3SVFA 3D7CA 4TYLA 4O75A 5CQ3A 4YAXA 4QSQA 2DVSA 4NYWA 5AD2A 5IIDA 3SVGA 5D3JA 5L8TA 4LZ2A 4IR6A 4CUTA 5KTUA 5CP5A 5FH6A 4N4FA 2RO1A 5DYCA 5CTLA 4GPJA 5CUBA 3ZYUA 4J1PA 4PCEA 2D9EA 4LDFA 5EP7A 3LJWA 4A9IA 2D82A 4QSUA 4X2IA 4NR9A 4O7EA 5F36A 5FDZA 3UW9A 5F2PA 4DONA 5F25A 5A81A 4NR6A 5ENJA 4MR5A 5COIA 4YYKA 3LQHA 5FFVA 4HXLA 5LJ2A 4TT6A 3U5PA 4ZQLA 4TTEA 4UIXA 5EM3A 3U5NA 5F62A 5FFWA 4Q0OA 4QSXA 4IOOA 4A9HA 4HBXA 1N72A 3P1DA 4CUQA 2MJVB 4BHWA 5FBXA 5L97A 3O33A 5CZGA 4O72A 5IG6A 2H60A 4UYFB 4HXPA 5HCLA 5FB1A 5A82A 1EQFA 5LVRA 5HQ5A 5HJCA 4CFKA 4NQNA 4LZRA 4NYXA 5CUCA 5DY7A 5EPRA 5LKXA 5EK9A 5IBNA 5CQ5A 4O7CA 4WHWA 4O70A 4QR5A 5E9KA 5EI4A 5F1HA 4QY4A 4QC1A 5A83A 4IR3A 5BT5A 4YY6A 5IGNA 2DVQA 5H1TA 4TT4A 5FE5A 5C85A 4A9EA 3S91A 5C87A 5IGLA 5DW1A 4XY8A 5EPSA 2GRCA 3JVMA 4O78A 5E9VA 5FG4A 4E96A 2DATA 5A7CA 4QEWA 5C89A 2YEMA 4KCXA 4HXNA 4MR3A 5CUGA 3O34A 4IR4A 3GG3A 4YATA 3U5KA 4Z1QA 2R10A 4QR4A 5FH7A 2FSAA 4LZSA 4YBMA 5D3LA 5AMEA 5L96A 3AQAA 4KV1A 4YH3A 5A5QA 4OUFA 2RI7A 4UYHA 2YELA 4TS8A 3QZVA 5DKDA 1WUMA 5J0DA 5H85A 5A5SA 2I7KA 5F61A 5I83A 3MXFA 4UIVA 5F60A 1X0JA 4WIVA 5D24A 3G0JA 3LXJA 5I89A 3QZTA 5ENCA 5H1VA 3UVYA 4CFLA 3HMHA 4QBMA 5EISA 2G4AA 4NR7A 5AMFA 3O36A 4QUUA 1WUGA 5ENGA 4O7AA 4YABA 4A9NA 5EV9A 4BW1A 5I29A 5BT4A 2RFJA 4HBYA 4YADA 4N4HA 5E9MA 5I1QA 4QSRA 2YEKA 4Y03A 4KV4A 4AKNA 5HEMA 4TQNA 4A9JA 4YBTA 5F3AA 2F6NA 5KTXA 5ACYA 5I7YA 4C67A 3P1FA 5E3GA 5DW2A 4HXOA 2DVVA 5DX4A 5HQ7A 2YQDA 5ENBA 5I86A 5HLSA 2L85A 4N3WA 5F1LA 5EQ1A 2I8NA 4NR4A 4YYGA 5A85A 5ENEA 5E0RA 2E3KA 4F3IA 4NUCA 4TU6A 5AD3A 4YBSA 5ENIA 4NS5A 5ENFA 5FE0A 5E73A 2KTBB 1E6IA 2RS9B 4LR6A 5LJ1A 2N9GA 3LQIA 5FE1A 4YC9A 3Q2EA 4YYNA 5L99A 5EICA 5L98A 3RCWA 5EWHA 4QUTA 4MEPA 4TZ8A 4Z6HA 4CL9A 1JSPB 4O71A 3MUKA 2F6JA 5IGMA 3I3JA 5EA1A 4QZSA 5CS8A 2NXBA 3DAIA 4OGIA 4CLBA 5LUUA 2YW5A 3MQMA 3AADA 2RNWA 5CU8A 3MB4A 5HENA 4QR3A 5TCMA 3HMFA 4J3IA 5D7XA 5I88A 5DLZA 5II1A 4ALHA 5CQTA 5CUDA 4Z6IA 5E3DA 4HBVA 3U5MA 5D26A 5II2A 3UV2A 5E9YA 5L8UA 5TB6A 4QYLA 4MR4A 4J0SA 5IGKA 5LJ0A 4O74A 5HFRA 5HM0A 2E7NA 2DWWA 2R0VA 4YH4A 5DBMA 5DLXA 5CQAA 5HRVA 5CUAA 2DVRA 4PS5A 4OGJA 2LSPB 2R0YA 4UIZA 5EWCA 5EWVA 3SVHA 4YYHA 4ZC9A 4NRCA 5LVQA 4QNSA 3IU6A 2L5EA 2RNXA 5G4SA 3FKMX 5ETDA 4UITA 2E7OA 4PTBA 4LRGA 4N4IA 5EVAA 4BW2A 4MENA 4CUUA 3DWYA 5K29A 1ZS5A 3U5JA 4NRBA 4YYMA 3Q2FA 4NRAA 2WP2A 5CUEA 3UVXA 4O7FA 4HXKA 3P1CA 5ETBA 5DYXA 4QB3A 3MULA 5DKHA 3JVLA 4BJXA 4YYJA 4N4GA 4TU4A 5D3NA 5EWDA 5FE9A 3UVDA 4HXRA 4HXMA 4A9MA 4CUSA 4NR5A 5EPBA 3S92A 5E9IA 3P1EA 2YYNA 5FE6A 4BW4A 3QZSA 4O76A 4IOQA 5D3HA 4C66A 3UVWA 4UYDA 4XYAA 2R0SA 4UIWA 4ZW1A 4WHUA 4J0RA 5CGPA 5FE7A 5CQ6A 5DYAA 4IR5A 5D0CA 4A9LA 5C7NA 4YY4A 4MEQA 5FH8A 5CY9A 4QYDA 5FB0A 4CUPA 4YK0A 5A5PA 4XUBA 5I40A 5HQ6A 5KHMA 5LKTA 3HMEA 4UYFA 2OSSA 2DKWA 2WP1A 5JI8A 2L84A 5F5ZA 5EU1A 5FG6A 5I80A 5A5RA 4A9OA 4XUAA 4HBWA 5HELA 4QSWA 1F68A 5JWMA 5LKUA 4UIUA 5CQ8A 3O37A 4O7BA 5D3TA 5KO4A 4NUDA 2OO1A 3LQJA 3TLPA 3U5OA 5E7DA 5DKCA 4Q0NA 4LYWA 4QEVA 5DFBA 5HFQA 3U5LA 3G0LA 4NYVA 4ALGA 4HXSA 2YDWA 4QEUA 2RNYA 5EGUA 5FE3A 3UV5A 5FE8A 5LKZA 4TZ2A 4PY6A 4PKLA 5KU3A 3JVKA 5FE2A 4QSVA 4Z1SA 5DFCA 4RVRA 5CQ4A 4QC3A 4XY9A 3P5OA 5CQ7A 5C8GA 5F63A 5HRWA 4QSSA 5KTWA 4UIYA 5CRZA
chains in the Genus database with same CATH superfamily
5BT3A 3O35A 4NR8A 4BW3A 4MEOA 5ENHA 4FLPA 4Z93A 5FG5A 3IU5A 5CPEA 4TT2A 5E9LA 4NUEA 5DYUA 4LYSA 4PCIA 5H1UA 3K2JA 3JVJA 4A9KA 5EWWA 4IORA 3MB3A 4NQMA 4NXJA 4UYGA 1JM4B 2OUOA 5D3SA 5HRXA 5E74A 3NXBA 4UYEA 5D3PA 4AKGA 5A5OA 5G4RA 5D25A 5I7XA 4A9FA 4YYIA 4CURA 5C4QA 5DFDA 4YYDA 5D3RA 3ONIA 3UV4A 4LYIA 5CRMA 4LC2A 1ZKRA 5A5NA 5CFWA 5FE4A 2EJNA 4O77A 4QSPA 5FFYA 4QSTA 4MR6A 3SVFA 3D7CA 4TYLA 4O75A 5CQ3A 4YAXA 4QSQA 2DVSA 4NYWA 5AD2A 5IIDA 3SVGA 5D3JA 5L8TA 4LZ2A 4IR6A 4CUTA 5KTUA 5CP5A 5FH6A 4N4FA 4AKIA 2RO1A 5DYCA 5CTLA 4GPJA 5CUBA 3ZYUA 4J1PA 4PCEA 2D9EA 4LDFA 5EP7A 3LJWA 4A9IA 2D82A 4QSUA 4X2IA 4NR9A 4O7EA 5F36A 5FDZA 3UW9A 5F2PA 4AI6A 4DONA 5F25A 5A81A 4NR6A 5ENJA 4MR5A 5COIA 4YYKA 3LQHA 5FFVA 4HXLA 5LJ2A 4TT6A 3U5PA 4ZQLA 4TTEA 4UIXA 5EM3A 3U5NA 5F62A 5FFWA 4Q0OA 4QSXA 4IOOA 4A9HA 4HBXA 1N72A 3P1DA 4CUQA 2MJVB 4BHWA 5FBXA 5L97A 3O33A 5CZGA 4O72A 5IG6A 2H60A 4UYFB 4HXPA 5HCLA 5FB1A 5A82A 1EQFA 5LVRA 5HQ5A 5HJCA 4CFKA 4NQNA 4LZRA 4NYXA 5CUCA 5DY7A 5EPRA 5LKXA 5EK9A 5IBNA 5CQ5A 4O7CA 4WHWA 4O70A 4QR5A 5E9KA 5EI4A 5F1HA 4QY4A 4QC1A 5A83A 4IR3A 5BT5A 4YY6A 3VKGA 5IGNA 2DVQA 5H1TA 4TT4A 5FE5A 5C85A 4A9EA 3S91A 5C87A 5IGLA 5DW1A 4XY8A 5EPSA 2GRCA 3JVMA 4O78A 5E9VA 5FG4A 4E96A 2DATA 5A7CA 4QEWA 5C89A 2YEMA 4KCXA 4HXNA 4MR3A 5CUGA 3O34A 4IR4A 3GG3A 4YATA 3U5KA 4Z1QA 2R10A 4QR4A 5FH7A 2FSAA 4LZSA 4YBMA 5D3LA 5AMEA 5L96A 3AQAA 4KV1A 4YH3A 5A5QA 4OUFA 2RI7A 4UYHA 2YELA 4TS8A 3QZVA 5DKDA 1WUMA 5J0DA 5H85A 5A5SA 4AKHA 2I7KA 5F61A 5I83A 3ERRA 3MXFA 4UIVA 5F60A 1X0JA 4WIVA 5D24A 3G0JA 3LXJA 5I89A 3QZTA 5ENCA 5H1VA 3UVYA 4CFLA 3HMHA 4QBMA 5EISA 2G4AA 4NR7A 5AMFA 3O36A 4QUUA 1WUGA 5ENGA 4O7AA 4YABA 4A9NA 5EV9A 4BW1A 5I29A 5BT4A 2RFJA 4HBYA 4YADA 4N4HA 5E9MA 5I1QA 4QSRA 2YEKA 4Y03A 4KV4A 4AKNA 5HEMA 4TQNA 4A9JA 4YBTA 5F3AA 2F6NA 5KTXA 5ACYA 5I7YA 4C67A 3P1FA 5E3GA 5DW2A 4HXOA 2DVVA 5DX4A 5HQ7A 2YQDA 5ENBA 5I86A 5HLSA 2L85A 4N3WA 5F1LA 5EQ1A 1PUOA 2I8NA 4NR4A 4YYGA 5A85A 5ENEA 5E0RA 2E3KA 4F3IA 4NUCA 4TU6A 5AD3A 4YBSA 5ENIA 4NS5A 5ENFA 5FE0A 5E73A 2KTBB 1E6IA 2RS9B 4LR6A 5LJ1A 2N9GA 3LQIA 5FE1A 4YC9A 3Q2EA 4YYNA 5L99A 5EICA 5L98A 3RCWA 5EWHA 4QUTA 4MEPA 4TZ8A 4Z6HA 4CL9A 1JSPB 4O71A 3MUKA 2F6JA 5IGMA 3I3JA 5EA1A 4QZSA 5CS8A 2NXBA 3DAIA 4OGIA 4CLBA 5LUUA 2YW5A 3MQMA 3AADA 2RNWA 5CU8A 3MB4A 5HENA 4QR3A 5TCMA 3HMFA 4J3IA 5D7XA 5I88A 5DLZA 5II1A 4ALHA 5CQTA 5CUDA 4Z6IA 5E3DA 4HBVA 3U5MA 5D26A 5II2A 3UV2A 5E9YA 5L8UA 5TB6A 4QYLA 4MR4A 4J0SA 5IGKA 3D1DA 5LJ0A 4O74A 5HFRA 5HM0A 2E7NA 2DWWA 2R0VA 4YH4A 5DBMA 5DLXA 5CQAA 5HRVA 5CUAA 2DVRA 4PS5A 4OGJA 2LSPB 2R0YA 4UIZA 5EWCA 5EWVA 3SVHA 4YYHA 4ZC9A 4NRCA 5LVQA 4QNSA 3IU6A 2L5EA 2RNXA 5G4SA 3FKMX 5ETDA 4UITA 2E7OA 4PTBA 4LRGA 4N4IA 5EVAA 4BW2A 4MENA 4CUUA 3DWYA 5K29A 1ZS5A 3U5JA 4NRBA 4YYMA 3Q2FA 4NRAA 2WP2A 5CUEA 3UVXA 4O7FA 4HXKA 3P1CA 5ETBA 5DYXA 4QB3A 3MULA 5DKHA 3JVLA 4BJXA 4YYJA 4N4GA 4TU4A 5D3NA 5EWDA 5FE9A 3UVDA 4HXRA 4HXMA 4A9MA 4CUSA 4NR5A 5EPBA 3S92A 5E9IA 3P1EA 2YYNA 5FE6A 4BW4A 3QZSA 4O76A 4IOQA 5D3HA 4C66A 3UVWA 4UYDA 4XYAA 2R0SA 4UIWA 4ZW1A 3D1BA 4WHUA 4J0RA 3VKHA 5CGPA 5FE7A 5CQ6A 5DYAA 4IR5A 5D0CA 4A9LA 5C7NA 4YY4A 4MEQA 5FH8A 5CY9A 4QYDA 5FB0A 4CUPA 4YK0A 5A5PA 4XUBA 5I40A 5HQ6A 5KHMA 5LKTA 3HMEA 4UYFA 2OSSA 2DKWA 2WP1A 5JI8A 2L84A 5F5ZA 5EU1A 5FG6A 5I80A 5A5RA 4A9OA 4XUAA 4HBWA 5HELA 4QSWA 1F68A 5JWMA 5LKUA 4UIUA 5CQ8A 3O37A 4O7BA 5D3TA 5KO4A 4NUDA 2OO1A 3LQJA 3TLPA 3U5OA 5E7DA 5DKCA 4Q0NA 4LYWA 4QEVA 5DFBA 5HFQA 3U5LA 3G0LA 4NYVA 4ALGA 4HXSA 2YDWA 4QEUA 2RNYA 5EGUA 5FE3A 3UV5A 5FE8A 5LKZA 4TZ2A 4PY6A 4PKLA 5KU3A 3JVKA 5FE2A 4QSVA 4Z1SA 5DFCA 4RVRA 5CQ4A 4QC3A 4XY9A 3P5OA 5CQ7A 5C8GA 5F63A 5HRWA 4QSSA 5KTWA 4UIYA 5CRZA
chains in the Genus database with same CATH topology
5BT3A 3O35A 4NR8A 4BW3A 4MEOA 5ENHA 4FLPA 4Z93A 5FG5A 3IU5A 5CPEA 4TT2A 5E9LA 4NUEA 5DYUA 4LYSA 4PCIA 5H1UA 3K2JA 3JVJA 4A9KA 5EWWA 4IORA 3MB3A 4NQMA 4NXJA 4UYGA 1JM4B 2OUOA 5D3SA 5HRXA 5E74A 3NXBA 4UYEA 5D3PA 5A5OA 5G4RA 5D25A 5I7XA 4A9FA 4YYIA 4CURA 5C4QA 5DFDA 4YYDA 5D3RA 3ONIA 3UV4A 4LYIA 5CRMA 4LC2A 5A5NA 5CFWA 5FE4A 4O77A 4QSPA 5FFYA 4QSTA 4MR6A 3SVFA 3D7CA 4TYLA 4O75A 5CQ3A 4YAXA 4QSQA 2DVSA 4NYWA 5AD2A 5IIDA 3SVGA 5D3JA 5L8TA 4LZ2A 4IR6A 4CUTA 5KTUA 5CP5A 5FH6A 4N4FA 2RO1A 5DYCA 5CTLA 4GPJA 5CUBA 3ZYUA 4J1PA 4PCEA 2D9EA 4LDFA 5EP7A 3LJWA 4A9IA 2D82A 4QSUA 4X2IA 4NR9A 4O7EA 5F36A 5FDZA 3UW9A 5F2PA 4DONA 5F25A 5A81A 4NR6A 5ENJA 4MR5A 5COIA 4YYKA 3LQHA 5FFVA 4HXLA 5LJ2A 4TT6A 3U5PA 4ZQLA 4TTEA 4UIXA 5EM3A 3U5NA 5F62A 5FFWA 4Q0OA 4QSXA 4IOOA 4A9HA 4HBXA 1N72A 3P1DA 4CUQA 2MJVB 4BHWA 5FBXA 5L97A 3O33A 5CZGA 4O72A 5IG6A 2H60A 4UYFB 4HXPA 5HCLA 5FB1A 5A82A 1EQFA 5LVRA 5HQ5A 5HJCA 4CFKA 4NQNA 4LZRA 4NYXA 5CUCA 5DY7A 5EPRA 5LKXA 5EK9A 5IBNA 5CQ5A 4O7CA 4WHWA 4O70A 4QR5A 5E9KA 5EI4A 5F1HA 4QY4A 4QC1A 5A83A 4IR3A 5BT5A 4YY6A 5IGNA 2DVQA 5H1TA 4TT4A 5FE5A 5C85A 4A9EA 3S91A 5C87A 5IGLA 5DW1A 4XY8A 5EPSA 2GRCA 3JVMA 4O78A 5E9VA 5FG4A 4E96A 2DATA 5A7CA 4QEWA 5C89A 2YEMA 4KCXA 4HXNA 4MR3A 5CUGA 3O34A 4IR4A 3GG3A 4YATA 3U5KA 4Z1QA 2R10A 4QR4A 5FH7A 2FSAA 4LZSA 4YBMA 5D3LA 5AMEA 5L96A 3AQAA 4KV1A 4YH3A 5A5QA 4OUFA 2RI7A 4UYHA 2YELA 4TS8A 3QZVA 5DKDA 1WUMA 5J0DA 5H85A 5A5SA 2I7KA 5F61A 5I83A 3MXFA 4UIVA 5F60A 1X0JA 4WIVA 5D24A 3G0JA 3LXJA 5I89A 3QZTA 5ENCA 5H1VA 3UVYA 4CFLA 3HMHA 4QBMA 5EISA 2G4AA 4NR7A 5AMFA 3O36A 4QUUA 1WUGA 5ENGA 4O7AA 4YABA 4A9NA 5EV9A 4BW1A 5I29A 5BT4A 2RFJA 4HBYA 4YADA 4N4HA 5E9MA 5I1QA 4QSRA 2YEKA 4Y03A 4KV4A 4AKNA 5HEMA 4TQNA 4A9JA 4YBTA 5F3AA 2F6NA 5KTXA 5ACYA 5I7YA 4C67A 3P1FA 5E3GA 5DW2A 4HXOA 2DVVA 5DX4A 5HQ7A 2YQDA 5ENBA 5I86A 5HLSA 2L85A 4N3WA 5F1LA 5EQ1A 2I8NA 4NR4A 4YYGA 5A85A 5ENEA 5E0RA 2E3KA 4F3IA 4NUCA 4TU6A 5AD3A 4YBSA 5ENIA 4NS5A 5ENFA 5FE0A 5E73A 2KTBB 1E6IA 2RS9B 4LR6A 5LJ1A 2N9GA 3LQIA 5FE1A 4YC9A 3Q2EA 4YYNA 5L99A 5EICA 5L98A 3RCWA 5EWHA 4QUTA 4MEPA 4TZ8A 4Z6HA 4CL9A 1JSPB 4O71A 3MUKA 2F6JA 5IGMA 3I3JA 5EA1A 4QZSA 5CS8A 2NXBA 3DAIA 4OGIA 4CLBA 5LUUA 2YW5A 3MQMA 3AADA 2RNWA 5CU8A 3MB4A 5HENA 4QR3A 5TCMA 3HMFA 4J3IA 5D7XA 5I88A 5DLZA 5II1A 4ALHA 5CQTA 5CUDA 4Z6IA 5E3DA 4HBVA 3U5MA 5D26A 5II2A 3UV2A 5E9YA 5L8UA 5TB6A 4QYLA 4MR4A 4J0SA 5IGKA 5LJ0A 4O74A 5HFRA 5HM0A 2E7NA 2DWWA 2R0VA 4YH4A 5DBMA 5DLXA 5CQAA 5HRVA 5CUAA 2DVRA 4PS5A 4OGJA 2LSPB 2R0YA 4UIZA 5EWCA 5EWVA 3SVHA 4YYHA 4ZC9A 4NRCA 5LVQA 4QNSA 3IU6A 2L5EA 2RNXA 5G4SA 3FKMX 5ETDA 4UITA 2E7OA 4PTBA 4LRGA 4N4IA 5EVAA 4BW2A 4MENA 4CUUA 3DWYA 5K29A 1ZS5A 3U5JA 4NRBA 4YYMA 3Q2FA 4NRAA 2WP2A 5CUEA 3UVXA 4O7FA 4HXKA 3P1CA 5ETBA 5DYXA 4QB3A 3MULA 5DKHA 3JVLA 4BJXA 4YYJA 4N4GA 4TU4A 5D3NA 5EWDA 5FE9A 3UVDA 4HXRA 4HXMA 4A9MA 4CUSA 4NR5A 5EPBA 3S92A 5E9IA 3P1EA 2YYNA 5FE6A 4BW4A 3QZSA 4O76A 4IOQA 5D3HA 4C66A 3UVWA 4UYDA 4XYAA 2R0SA 4UIWA 4ZW1A 4WHUA 4J0RA 5CGPA 5FE7A 5CQ6A 5DYAA 4IR5A 5D0CA 4A9LA 5C7NA 4YY4A 4MEQA 5FH8A 5CY9A 4QYDA 5FB0A 4CUPA 4YK0A 5A5PA 4XUBA 5I40A 5HQ6A 5KHMA 5LKTA 3HMEA 4UYFA 2OSSA 2DKWA 2WP1A 5JI8A 2L84A 5F5ZA 5EU1A 5FG6A 5I80A 5A5RA 4A9OA 4XUAA 4HBWA 5HELA 4QSWA 1F68A 5JWMA 5LKUA 4UIUA 5CQ8A 3O37A 4O7BA 5D3TA 5KO4A 4NUDA 2OO1A 3LQJA 3TLPA 3U5OA 5E7DA 5DKCA 4Q0NA 4LYWA 4QEVA 5DFBA 5HFQA 3U5LA 3G0LA 4NYVA 4ALGA 4HXSA 2YDWA 4QEUA 2RNYA 5EGUA 5FE3A 3UV5A 5FE8A 5LKZA 4TZ2A 4PY6A 4PKLA 5KU3A 3JVKA 5FE2A 4QSVA 4Z1SA 5DFCA 4RVRA 5CQ4A 4QC3A 4XY9A 3P5OA 5CQ7A 5C8GA 5F63A 5HRWA 4QSSA 5KTWA 4UIYA 5CRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT3 A;  3O35 A;  4NR8 A;  4BW3 A;  4MEO A;  5ENH A;  4FLP A;  4Z93 A;  5FG5 A;  3IU5 A;  5CPE A;  4TT2 A;  5E9L A;  4NUE A;  5DYU A;  4LYS A;  4PCI A;  5H1U A;  3K2J A;  3JVJ A;  4A9K A;  5EWW A;  4IOR A;  3MB3 A;  4NQM A;  4NXJ A;  4UYG A;  1JM4 B;  2OUO A;  5D3S A;  5HRX A;  5E74 A;  3NXB A;  4UYE A;  5D3P A;  5A5O A;  5G4R A;  5D25 A;  5I7X A;  4A9F A;  4YYI A;  4CUR A;  5C4Q A;  5DFD A;  4YYD A;  5D3R A;  3ONI A;  3UV4 A;  4LYI A;  5CRM A;  4LC2 A;  5A5N A;  5CFW A;  5FE4 A;  4O77 A;  4QSP A;  5FFY A;  4QST A;  4MR6 A;  3SVF A;  3D7C A;  4TYL A;  4O75 A;  5CQ3 A;  4YAX A;  4QSQ A;  2DVS A;  4NYW A;  5AD2 A;  5IID A;  3SVG A;  5D3J A;  5L8T A;  4LZ2 A;  4IR6 A;  4CUT A;  5KTU A;  5CP5 A;  5FH6 A;  4N4F A;  2RO1 A;  5DYC A;  5CTL A;  4GPJ A;  5CUB A;  3ZYU A;  4J1P A;  4PCE A;  2D9E A;  4LDF A;  5EP7 A;  3LJW A;  4A9I A;  2D82 A;  4QSU A;  4X2I A;  4NR9 A;  4O7E A;  5F36 A;  5FDZ A;  3UW9 A;  5F2P A;  4DON A;  5F25 A;  5A81 A;  4NR6 A;  5ENJ A;  4MR5 A;  5COI A;  4YYK A;  3LQH A;  5FFV A;  4HXL A;  5LJ2 A;  4TT6 A;  3U5P A;  4ZQL A;  4TTE A;  4UIX A;  5EM3 A;  3U5N A;  5F62 A;  5FFW A;  4Q0O A;  4QSX A;  4IOO A;  4A9H A;  4HBX A;  1N72 A;  3P1D A;  4CUQ A;  2MJV B;  4BHW A;  5FBX A;  5L97 A;  3O33 A;  5CZG A;  4O72 A;  5IG6 A;  2H60 A;  4UYF B;  4HXP A;  5HCL A;  5FB1 A;  5A82 A;  1EQF A;  5LVR A;  5HQ5 A;  5HJC A;  4CFK A;  4NQN A;  4LZR A;  4NYX A;  5CUC A;  5DY7 A;  5EPR A;  5LKX A;  5EK9 A;  5IBN A;  5CQ5 A;  4O7C A;  4WHW A;  4O70 A;  4QR5 A;  5E9K A;  5EI4 A;  5F1H A;  4QY4 A;  4QC1 A;  5A83 A;  4IR3 A;  5BT5 A;  4YY6 A;  5IGN A;  2DVQ A;  5H1T A;  4TT4 A;  5FE5 A;  5C85 A;  4A9E A;  3S91 A;  5C87 A;  5IGL A;  5DW1 A;  4XY8 A;  5EPS A;  2GRC A;  3JVM A;  4O78 A;  5E9V A;  5FG4 A;  4E96 A;  2DAT A;  5A7C A;  4QEW A;  5C89 A;  2YEM A;  4KCX A;  4HXN A;  4MR3 A;  5CUG A;  3O34 A;  4IR4 A;  3GG3 A;  4YAT A;  3U5K A;  4Z1Q A;  2R10 A;  4QR4 A;  5FH7 A;  2FSA A;  4LZS A;  4YBM A;  5D3L A;  5AME A;  5L96 A;  3AQA A;  4KV1 A;  4YH3 A;  5A5Q A;  4OUF A;  2RI7 A;  4UYH A;  2YEL A;  4TS8 A;  3QZV A;  5DKD A;  1WUM A;  5J0D A;  5H85 A;  5A5S A;  2I7K A;  5F61 A;  5I83 A;  3MXF A;  4UIV A;  5F60 A;  1X0J A;  4WIV A;  5D24 A;  3G0J A;  3LXJ A;  5I89 A;  3QZT A;  5ENC A;  5H1V A;  3UVY A;  4CFL A;  3HMH A;  4QBM A;  5EIS A;  2G4A A;  4NR7 A;  5AMF A;  3O36 A;  4QUU A;  1WUG A;  5ENG A;  4O7A A;  4YAB A;  4A9N A;  5EV9 A;  4BW1 A;  5I29 A;  5BT4 A;  2RFJ A;  4HBY A;  4YAD A;  4N4H A;  5E9M A;  5I1Q A;  4QSR A;  2YEK A;  4Y03 A;  4KV4 A;  4AKN A;  5HEM A;  4TQN A;  4A9J A;  4YBT A;  5F3A A;  2F6N A;  5KTX A;  5ACY A;  5I7Y A;  4C67 A;  3P1F A;  5E3G A;  5DW2 A;  4HXO A;  2DVV A;  5DX4 A;  5HQ7 A;  2YQD A;  5ENB A;  5I86 A;  5HLS A;  2L85 A;  4N3W A;  5F1L A;  5EQ1 A;  2I8N A;  4NR4 A;  4YYG A;  5A85 A;  5ENE A;  5E0R A;  2E3K A;  4F3I A;  4NUC A;  4TU6 A;  5AD3 A;  4YBS A;  5ENI A;  4NS5 A;  5ENF A;  5FE0 A;  5E73 A;  2KTB B;  1E6I A;  2RS9 B;  4LR6 A;  5LJ1 A;  2N9G A;  3LQI A;  5FE1 A;  4YC9 A;  3Q2E A;  4YYN A;  5L99 A;  5EIC A;  5L98 A;  3RCW A;  5EWH A;  4QUT A;  4MEP A;  4TZ8 A;  4Z6H A;  4CL9 A;  1JSP B;  4O71 A;  3MUK A;  2F6J A;  5IGM A;  3I3J A;  5EA1 A;  4QZS A;  5CS8 A;  2NXB A;  3DAI A;  4OGI A;  4CLB A;  5LUU A;  2YW5 A;  3MQM A;  3AAD A;  2RNW A;  5CU8 A;  3MB4 A;  5HEN A;  4QR3 A;  5TCM A;  3HMF A;  4J3I A;  5D7X A;  5I88 A;  5DLZ A;  5II1 A;  4ALH A;  5CQT A;  5CUD A;  4Z6I A;  5E3D A;  4HBV A;  3U5M A;  5D26 A;  5II2 A;  3UV2 A;  5E9Y A;  5L8U A;  5TB6 A;  4QYL A;  4MR4 A;  4J0S A;  5IGK A;  5LJ0 A;  4O74 A;  5HFR A;  5HM0 A;  2E7N A;  2DWW A;  2R0V A;  4YH4 A;  5DBM A;  5DLX A;  5CQA A;  5HRV A;  5CUA A;  2DVR A;  4PS5 A;  4OGJ A;  2LSP B;  2R0Y A;  4UIZ A;  5EWC A;  5EWV A;  3SVH A;  4YYH A;  4ZC9 A;  4NRC A;  5LVQ A;  4QNS A;  3IU6 A;  2L5E A;  2RNX A;  5G4S A;  3FKM X;  5ETD A;  4UIT A;  2E7O A;  4PTB A;  4LRG A;  4N4I A;  5EVA A;  4BW2 A;  4MEN A;  4CUU A;  3DWY A;  5K29 A;  1ZS5 A;  3U5J A;  4NRB A;  4YYM A;  3Q2F A;  4NRA A;  2WP2 A;  5CUE A;  3UVX A;  4O7F A;  4HXK A;  3P1C A;  5ETB A;  5DYX A;  4QB3 A;  3MUL A;  5DKH A;  3JVL A;  4BJX A;  4YYJ A;  4N4G A;  4TU4 A;  5D3N A;  5EWD A;  5FE9 A;  3UVD A;  4HXR A;  4HXM A;  4A9M A;  4CUS A;  4NR5 A;  5EPB A;  3S92 A;  5E9I A;  3P1E A;  2YYN A;  5FE6 A;  4BW4 A;  3QZS A;  4O76 A;  4IOQ A;  5D3H A;  4C66 A;  3UVW A;  4UYD A;  4XYA A;  2R0S A;  4UIW A;  4ZW1 A;  4WHU A;  4J0R A;  5CGP A;  5FE7 A;  5CQ6 A;  5DYA A;  4IR5 A;  5D0C A;  4A9L A;  5C7N A;  4YY4 A;  4MEQ A;  5FH8 A;  5CY9 A;  4QYD A;  5FB0 A;  4CUP A;  4YK0 A;  5A5P A;  4XUB A;  5I40 A;  5HQ6 A;  5KHM A;  5LKT A;  3HME A;  4UYF A;  2OSS A;  2DKW A;  2WP1 A;  5JI8 A;  2L84 A;  5F5Z A;  5EU1 A;  5FG6 A;  5I80 A;  5A5R A;  4A9O A;  4XUA A;  4HBW A;  5HEL A;  4QSW A;  1F68 A;  5JWM A;  5LKU A;  4UIU A;  5CQ8 A;  3O37 A;  4O7B A;  5D3T A;  5KO4 A;  4NUD A;  2OO1 A;  3LQJ A;  3TLP A;  3U5O A;  5E7D A;  5DKC A;  4Q0N A;  4LYW A;  4QEV A;  5DFB A;  5HFQ A;  3U5L A;  3G0L A;  4NYV A;  4ALG A;  4HXS A;  2YDW A;  4QEU A;  2RNY A;  5EGU A;  5FE3 A;  3UV5 A;  5FE8 A;  5LKZ A;  4TZ2 A;  4PY6 A;  4PKL A;  5KU3 A;  3JVK A;  5FE2 A;  4QSV A;  4Z1S A;  5DFC A;  4RVR A;  5CQ4 A;  4QC3 A;  4XY9 A;  3P5O A;  5CQ7 A;  5C8G A;  5F63 A;  5HRW A;  4QSS A;  5KTW A;  4UIY A;  5CRZ A; 
#chains in the Genus database with same CATH topology
 5BT3 A;  3O35 A;  4NR8 A;  4BW3 A;  4MEO A;  5ENH A;  4FLP A;  4Z93 A;  5FG5 A;  3IU5 A;  5CPE A;  4TT2 A;  5E9L A;  4NUE A;  5DYU A;  4LYS A;  4PCI A;  5H1U A;  3K2J A;  3JVJ A;  4A9K A;  5EWW A;  4IOR A;  3MB3 A;  4NQM A;  4NXJ A;  4UYG A;  1JM4 B;  2OUO A;  5D3S A;  5HRX A;  5E74 A;  3NXB A;  4UYE A;  5D3P A;  4AKG A;  5A5O A;  5G4R A;  5D25 A;  5I7X A;  4A9F A;  4YYI A;  4CUR A;  5C4Q A;  5DFD A;  4YYD A;  5D3R A;  3ONI A;  3UV4 A;  4LYI A;  5CRM A;  4LC2 A;  1ZKR A;  5A5N A;  5CFW A;  5FE4 A;  2EJN A;  4O77 A;  4QSP A;  5FFY A;  4QST A;  4MR6 A;  3SVF A;  3D7C A;  4TYL A;  4O75 A;  5CQ3 A;  4YAX A;  4QSQ A;  2DVS A;  4NYW A;  5AD2 A;  5IID A;  3SVG A;  5D3J A;  5L8T A;  4LZ2 A;  4IR6 A;  4CUT A;  5KTU A;  5CP5 A;  5FH6 A;  4N4F A;  4AKI A;  2RO1 A;  5DYC A;  5CTL A;  4GPJ A;  5CUB A;  3ZYU A;  4J1P A;  4PCE A;  2D9E A;  4LDF A;  5EP7 A;  3LJW A;  4A9I A;  2D82 A;  4QSU A;  4X2I A;  4NR9 A;  4O7E A;  5F36 A;  5FDZ A;  3UW9 A;  5F2P A;  4AI6 A;  4DON A;  5F25 A;  5A81 A;  4NR6 A;  5ENJ A;  4MR5 A;  5COI A;  4YYK A;  3LQH A;  5FFV A;  4HXL A;  5LJ2 A;  4TT6 A;  3U5P A;  4ZQL A;  4TTE A;  4UIX A;  5EM3 A;  3U5N A;  5F62 A;  5FFW A;  4Q0O A;  4QSX A;  4IOO A;  4A9H A;  4HBX A;  1N72 A;  3P1D A;  4CUQ A;  2MJV B;  4BHW A;  5FBX A;  5L97 A;  3O33 A;  5CZG A;  4O72 A;  5IG6 A;  2H60 A;  4UYF B;  4HXP A;  5HCL A;  5FB1 A;  5A82 A;  1EQF A;  5LVR A;  5HQ5 A;  5HJC A;  4CFK A;  4NQN A;  4LZR A;  4NYX A;  5CUC A;  5DY7 A;  5EPR A;  5LKX A;  5EK9 A;  5IBN A;  5CQ5 A;  4O7C A;  4WHW A;  4O70 A;  4QR5 A;  5E9K A;  5EI4 A;  5F1H A;  4QY4 A;  4QC1 A;  5A83 A;  4IR3 A;  5BT5 A;  4YY6 A;  3VKG A;  5IGN A;  2DVQ A;  5H1T A;  4TT4 A;  5FE5 A;  5C85 A;  4A9E A;  3S91 A;  5C87 A;  5IGL A;  5DW1 A;  4XY8 A;  5EPS A;  2GRC A;  3JVM A;  4O78 A;  5E9V A;  5FG4 A;  4E96 A;  2DAT A;  5A7C A;  4QEW A;  5C89 A;  2YEM A;  4KCX A;  4HXN A;  4MR3 A;  5CUG A;  3O34 A;  4IR4 A;  3GG3 A;  4YAT A;  3U5K A;  4Z1Q A;  2R10 A;  4QR4 A;  5FH7 A;  2FSA A;  4LZS A;  4YBM A;  5D3L A;  5AME A;  5L96 A;  3AQA A;  4KV1 A;  4YH3 A;  5A5Q A;  4OUF A;  2RI7 A;  4UYH A;  2YEL A;  4TS8 A;  3QZV A;  5DKD A;  1WUM A;  5J0D A;  5H85 A;  5A5S A;  4AKH A;  2I7K A;  5F61 A;  5I83 A;  3ERR A;  3MXF A;  4UIV A;  5F60 A;  1X0J A;  4WIV A;  5D24 A;  3G0J A;  3LXJ A;  5I89 A;  3QZT A;  5ENC A;  5H1V A;  3UVY A;  4CFL A;  3HMH A;  4QBM A;  5EIS A;  2G4A A;  4NR7 A;  5AMF A;  3O36 A;  4QUU A;  1WUG A;  5ENG A;  4O7A A;  4YAB A;  4A9N A;  5EV9 A;  4BW1 A;  5I29 A;  5BT4 A;  2RFJ A;  4HBY A;  4YAD A;  4N4H A;  5E9M A;  5I1Q A;  4QSR A;  2YEK A;  4Y03 A;  4KV4 A;  4AKN A;  5HEM A;  4TQN A;  4A9J A;  4YBT A;  5F3A A;  2F6N A;  5KTX A;  5ACY A;  5I7Y A;  4C67 A;  3P1F A;  5E3G A;  5DW2 A;  4HXO A;  2DVV A;  5DX4 A;  5HQ7 A;  2YQD A;  5ENB A;  5I86 A;  5HLS A;  2L85 A;  4N3W A;  5F1L A;  5EQ1 A;  1PUO A;  2I8N A;  4NR4 A;  4YYG A;  5A85 A;  5ENE A;  5E0R A;  2E3K A;  4F3I A;  4NUC A;  4TU6 A;  5AD3 A;  4YBS A;  5ENI A;  4NS5 A;  5ENF A;  5FE0 A;  5E73 A;  2KTB B;  1E6I A;  2RS9 B;  4LR6 A;  5LJ1 A;  2N9G A;  3LQI A;  5FE1 A;  4YC9 A;  3Q2E A;  4YYN A;  5L99 A;  5EIC A;  5L98 A;  3RCW A;  5EWH A;  4QUT A;  4MEP A;  4TZ8 A;  4Z6H A;  4CL9 A;  1JSP B;  4O71 A;  3MUK A;  2F6J A;  5IGM A;  3I3J A;  5EA1 A;  4QZS A;  5CS8 A;  2NXB A;  3DAI A;  4OGI A;  4CLB A;  5LUU A;  2YW5 A;  3MQM A;  3AAD A;  2RNW A;  5CU8 A;  3MB4 A;  5HEN A;  4QR3 A;  5TCM A;  3HMF A;  4J3I A;  5D7X A;  5I88 A;  5DLZ A;  5II1 A;  4ALH A;  5CQT A;  5CUD A;  4Z6I A;  5E3D A;  4HBV A;  3U5M A;  5D26 A;  5II2 A;  3UV2 A;  5E9Y A;  5L8U A;  5TB6 A;  4QYL A;  4MR4 A;  4J0S A;  5IGK A;  3D1D A;  5LJ0 A;  4O74 A;  5HFR A;  5HM0 A;  2E7N A;  2DWW A;  2R0V A;  4YH4 A;  5DBM A;  5DLX A;  5CQA A;  5HRV A;  5CUA A;  2DVR A;  4PS5 A;  4OGJ A;  2LSP B;  2R0Y A;  4UIZ A;  5EWC A;  5EWV A;  3SVH A;  4YYH A;  4ZC9 A;  4NRC A;  5LVQ A;  4QNS A;  3IU6 A;  2L5E A;  2RNX A;  5G4S A;  3FKM X;  5ETD A;  4UIT A;  2E7O A;  4PTB A;  4LRG A;  4N4I A;  5EVA A;  4BW2 A;  4MEN A;  4CUU A;  3DWY A;  5K29 A;  1ZS5 A;  3U5J A;  4NRB A;  4YYM A;  3Q2F A;  4NRA A;  2WP2 A;  5CUE A;  3UVX A;  4O7F A;  4HXK A;  3P1C A;  5ETB A;  5DYX A;  4QB3 A;  3MUL A;  5DKH A;  3JVL A;  4BJX A;  4YYJ A;  4N4G A;  4TU4 A;  5D3N A;  5EWD A;  5FE9 A;  3UVD A;  4HXR A;  4HXM A;  4A9M A;  4CUS A;  4NR5 A;  5EPB A;  3S92 A;  5E9I A;  3P1E A;  2YYN A;  5FE6 A;  4BW4 A;  3QZS A;  4O76 A;  4IOQ A;  5D3H A;  4C66 A;  3UVW A;  4UYD A;  4XYA A;  2R0S A;  4UIW A;  4ZW1 A;  3D1B A;  4WHU A;  4J0R A;  3VKH A;  5CGP A;  5FE7 A;  5CQ6 A;  5DYA A;  4IR5 A;  5D0C A;  4A9L A;  5C7N A;  4YY4 A;  4MEQ A;  5FH8 A;  5CY9 A;  4QYD A;  5FB0 A;  4CUP A;  4YK0 A;  5A5P A;  4XUB A;  5I40 A;  5HQ6 A;  5KHM A;  5LKT A;  3HME A;  4UYF A;  2OSS A;  2DKW A;  2WP1 A;  5JI8 A;  2L84 A;  5F5Z A;  5EU1 A;  5FG6 A;  5I80 A;  5A5R A;  4A9O A;  4XUA A;  4HBW A;  5HEL A;  4QSW A;  1F68 A;  5JWM A;  5LKU A;  4UIU A;  5CQ8 A;  3O37 A;  4O7B A;  5D3T A;  5KO4 A;  4NUD A;  2OO1 A;  3LQJ A;  3TLP A;  3U5O A;  5E7D A;  5DKC A;  4Q0N A;  4LYW A;  4QEV A;  5DFB A;  5HFQ A;  3U5L A;  3G0L A;  4NYV A;  4ALG A;  4HXS A;  2YDW A;  4QEU A;  2RNY A;  5EGU A;  5FE3 A;  3UV5 A;  5FE8 A;  5LKZ A;  4TZ2 A;  4PY6 A;  4PKL A;  5KU3 A;  3JVK A;  5FE2 A;  4QSV A;  4Z1S A;  5DFC A;  4RVR A;  5CQ4 A;  4QC3 A;  4XY9 A;  3P5O A;  5CQ7 A;  5C8G A;  5F63 A;  5HRW A;  4QSS A;  5KTW A;  4UIY A;  5CRZ A; 
#chains in the Genus database with same CATH homology
 5BT3 A;  3O35 A;  4NR8 A;  4BW3 A;  4MEO A;  5ENH A;  4FLP A;  4Z93 A;  5FG5 A;  3IU5 A;  5CPE A;  4TT2 A;  5E9L A;  4NUE A;  5DYU A;  4LYS A;  4PCI A;  5H1U A;  3K2J A;  3JVJ A;  4A9K A;  5EWW A;  4IOR A;  3MB3 A;  4NQM A;  4NXJ A;  4UYG A;  1JM4 B;  2OUO A;  5D3S A;  5HRX A;  5E74 A;  3NXB A;  4UYE A;  5D3P A;  5A5O A;  5G4R A;  5D25 A;  5I7X A;  4A9F A;  4YYI A;  4CUR A;  5C4Q A;  5DFD A;  4YYD A;  5D3R A;  3ONI A;  3UV4 A;  4LYI A;  5CRM A;  4LC2 A;  5A5N A;  5CFW A;  5FE4 A;  4O77 A;  4QSP A;  5FFY A;  4QST A;  4MR6 A;  3SVF A;  3D7C A;  4TYL A;  4O75 A;  5CQ3 A;  4YAX A;  4QSQ A;  2DVS A;  4NYW A;  5AD2 A;  5IID A;  3SVG A;  5D3J A;  5L8T A;  4LZ2 A;  4IR6 A;  4CUT A;  5KTU A;  5CP5 A;  5FH6 A;  4N4F A;  2RO1 A;  5DYC A;  5CTL A;  4GPJ A;  5CUB A;  3ZYU A;  4J1P A;  4PCE A;  2D9E A;  4LDF A;  5EP7 A;  3LJW A;  4A9I A;  2D82 A;  4QSU A;  4X2I A;  4NR9 A;  4O7E A;  5F36 A;  5FDZ A;  3UW9 A;  5F2P A;  4DON A;  5F25 A;  5A81 A;  4NR6 A;  5ENJ A;  4MR5 A;  5COI A;  4YYK A;  3LQH A;  5FFV A;  4HXL A;  5LJ2 A;  4TT6 A;  3U5P A;  4ZQL A;  4TTE A;  4UIX A;  5EM3 A;  3U5N A;  5F62 A;  5FFW A;  4Q0O A;  4QSX A;  4IOO A;  4A9H A;  4HBX A;  1N72 A;  3P1D A;  4CUQ A;  2MJV B;  4BHW A;  5FBX A;  5L97 A;  3O33 A;  5CZG A;  4O72 A;  5IG6 A;  2H60 A;  4UYF B;  4HXP A;  5HCL A;  5FB1 A;  5A82 A;  1EQF A;  5LVR A;  5HQ5 A;  5HJC A;  4CFK A;  4NQN A;  4LZR A;  4NYX A;  5CUC A;  5DY7 A;  5EPR A;  5LKX A;  5EK9 A;  5IBN A;  5CQ5 A;  4O7C A;  4WHW A;  4O70 A;  4QR5 A;  5E9K A;  5EI4 A;  5F1H A;  4QY4 A;  4QC1 A;  5A83 A;  4IR3 A;  5BT5 A;  4YY6 A;  5IGN A;  2DVQ A;  5H1T A;  4TT4 A;  5FE5 A;  5C85 A;  4A9E A;  3S91 A;  5C87 A;  5IGL A;  5DW1 A;  4XY8 A;  5EPS A;  2GRC A;  3JVM A;  4O78 A;  5E9V A;  5FG4 A;  4E96 A;  2DAT A;  5A7C A;  4QEW A;  5C89 A;  2YEM A;  4KCX A;  4HXN A;  4MR3 A;  5CUG A;  3O34 A;  4IR4 A;  3GG3 A;  4YAT A;  3U5K A;  4Z1Q A;  2R10 A;  4QR4 A;  5FH7 A;  2FSA A;  4LZS A;  4YBM A;  5D3L A;  5AME A;  5L96 A;  3AQA A;  4KV1 A;  4YH3 A;  5A5Q A;  4OUF A;  2RI7 A;  4UYH A;  2YEL A;  4TS8 A;  3QZV A;  5DKD A;  1WUM A;  5J0D A;  5H85 A;  5A5S A;  2I7K A;  5F61 A;  5I83 A;  3MXF A;  4UIV A;  5F60 A;  1X0J A;  4WIV A;  5D24 A;  3G0J A;  3LXJ A;  5I89 A;  3QZT A;  5ENC A;  5H1V A;  3UVY A;  4CFL A;  3HMH A;  4QBM A;  5EIS A;  2G4A A;  4NR7 A;  5AMF A;  3O36 A;  4QUU A;  1WUG A;  5ENG A;  4O7A A;  4YAB A;  4A9N A;  5EV9 A;  4BW1 A;  5I29 A;  5BT4 A;  2RFJ A;  4HBY A;  4YAD A;  4N4H A;  5E9M A;  5I1Q A;  4QSR A;  2YEK A;  4Y03 A;  4KV4 A;  4AKN A;  5HEM A;  4TQN A;  4A9J A;  4YBT A;  5F3A A;  2F6N A;  5KTX A;  5ACY A;  5I7Y A;  4C67 A;  3P1F A;  5E3G A;  5DW2 A;  4HXO A;  2DVV A;  5DX4 A;  5HQ7 A;  2YQD A;  5ENB A;  5I86 A;  5HLS A;  2L85 A;  4N3W A;  5F1L A;  5EQ1 A;  2I8N A;  4NR4 A;  4YYG A;  5A85 A;  5ENE A;  5E0R A;  2E3K A;  4F3I A;  4NUC A;  4TU6 A;  5AD3 A;  4YBS A;  5ENI A;  4NS5 A;  5ENF A;  5FE0 A;  5E73 A;  2KTB B;  1E6I A;  2RS9 B;  4LR6 A;  5LJ1 A;  2N9G A;  3LQI A;  5FE1 A;  4YC9 A;  3Q2E A;  4YYN A;  5L99 A;  5EIC A;  5L98 A;  3RCW A;  5EWH A;  4QUT A;  4MEP A;  4TZ8 A;  4Z6H A;  4CL9 A;  1JSP B;  4O71 A;  3MUK A;  2F6J A;  5IGM A;  3I3J A;  5EA1 A;  4QZS A;  5CS8 A;  2NXB A;  3DAI A;  4OGI A;  4CLB A;  5LUU A;  2YW5 A;  3MQM A;  3AAD A;  2RNW A;  5CU8 A;  3MB4 A;  5HEN A;  4QR3 A;  5TCM A;  3HMF A;  4J3I A;  5D7X A;  5I88 A;  5DLZ A;  5II1 A;  4ALH A;  5CQT A;  5CUD A;  4Z6I A;  5E3D A;  4HBV A;  3U5M A;  5D26 A;  5II2 A;  3UV2 A;  5E9Y A;  5L8U A;  5TB6 A;  4QYL A;  4MR4 A;  4J0S A;  5IGK A;  5LJ0 A;  4O74 A;  5HFR A;  5HM0 A;  2E7N A;  2DWW A;  2R0V A;  4YH4 A;  5DBM A;  5DLX A;  5CQA A;  5HRV A;  5CUA A;  2DVR A;  4PS5 A;  4OGJ A;  2LSP B;  2R0Y A;  4UIZ A;  5EWC A;  5EWV A;  3SVH A;  4YYH A;  4ZC9 A;  4NRC A;  5LVQ A;  4QNS A;  3IU6 A;  2L5E A;  2RNX A;  5G4S A;  3FKM X;  5ETD A;  4UIT A;  2E7O A;  4PTB A;  4LRG A;  4N4I A;  5EVA A;  4BW2 A;  4MEN A;  4CUU A;  3DWY A;  5K29 A;  1ZS5 A;  3U5J A;  4NRB A;  4YYM A;  3Q2F A;  4NRA A;  2WP2 A;  5CUE A;  3UVX A;  4O7F A;  4HXK A;  3P1C A;  5ETB A;  5DYX A;  4QB3 A;  3MUL A;  5DKH A;  3JVL A;  4BJX A;  4YYJ A;  4N4G A;  4TU4 A;  5D3N A;  5EWD A;  5FE9 A;  3UVD A;  4HXR A;  4HXM A;  4A9M A;  4CUS A;  4NR5 A;  5EPB A;  3S92 A;  5E9I A;  3P1E A;  2YYN A;  5FE6 A;  4BW4 A;  3QZS A;  4O76 A;  4IOQ A;  5D3H A;  4C66 A;  3UVW A;  4UYD A;  4XYA A;  2R0S A;  4UIW A;  4ZW1 A;  4WHU A;  4J0R A;  5CGP A;  5FE7 A;  5CQ6 A;  5DYA A;  4IR5 A;  5D0C A;  4A9L A;  5C7N A;  4YY4 A;  4MEQ A;  5FH8 A;  5CY9 A;  4QYD A;  5FB0 A;  4CUP A;  4YK0 A;  5A5P A;  4XUB A;  5I40 A;  5HQ6 A;  5KHM A;  5LKT A;  3HME A;  4UYF A;  2OSS A;  2DKW A;  2WP1 A;  5JI8 A;  2L84 A;  5F5Z A;  5EU1 A;  5FG6 A;  5I80 A;  5A5R A;  4A9O A;  4XUA A;  4HBW A;  5HEL A;  4QSW A;  1F68 A;  5JWM A;  5LKU A;  4UIU A;  5CQ8 A;  3O37 A;  4O7B A;  5D3T A;  5KO4 A;  4NUD A;  2OO1 A;  3LQJ A;  3TLP A;  3U5O A;  5E7D A;  5DKC A;  4Q0N A;  4LYW A;  4QEV A;  5DFB A;  5HFQ A;  3U5L A;  3G0L A;  4NYV A;  4ALG A;  4HXS A;  2YDW A;  4QEU A;  2RNY A;  5EGU A;  5FE3 A;  3UV5 A;  5FE8 A;  5LKZ A;  4TZ2 A;  4PY6 A;  4PKL A;  5KU3 A;  3JVK A;  5FE2 A;  4QSV A;  4Z1S A;  5DFC A;  4RVR A;  5CQ4 A;  4QC3 A;  4XY9 A;  3P5O A;  5CQ7 A;  5C8G A;  5F63 A;  5HRW A;  4QSS A;  5KTW A;  4UIY A;  5CRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...