4TU6A

Crystal structure of apo atad2a bromodomain with n1064 alternate conformation
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 54
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tu6A00
5HENA 5IGLA 4UIXA 5G4RA 4LZSA 2I7KA 4ALGA 4Z1SA 4QSUA 4UYHA 5CUEA 4ZQLA 2F6NA 5CFWA 4A9NA 4YYHA 2WP1A 5LJ2A 3U5PA 4YYMA 4LYIA 5H1TA 3UVDA 4QR3A 5ENJA 5ENHA 4QEWA 5FE6A 5C7NA 3HMEA 2RI7A 5FBXA 5D3SA 5HQ5A 5II1A 4CUUA 4OGIA 4DONA 5JI8A 4IOQA 5COIA 5DYAA 4HXLA 2YW5A 4NR7A 4QSQA 5EICA 2G4AA 4TS8A 5DFBA 4YY6A 4LC2A 3G0LA 3U5MA 4YC9A 5F62A 5F1HA 5D3HA 3S92A 4QYLA 5LKTA 4QSTA 5DX4A 5ENFA 5I80A 1E6IA 5CU8A 5FE7A 4TT4A 2L85A 4MEPA 5CUGA 5BT3A 3LQIA 2I8NA 5EISA 5CP5A 4OUFA 5TB6A 5DKCA 5DYXA 4LRGA 2RO1A 1X0JA 5DFCA 5EGUA 5I83A 5IGMA 4YYGA 2F6JA 5A5QA 3LJWA 5F3AA 5FB1A 1EQFA 5TCMA 4A9KA 4YYNA 5I7YA 4YK0A 4J3IA 2D9EA 4O7EA 5LVQA 4UIVA 5EVAA 4UYEA 4TZ8A 4QY4A 4UIZA 3TLPA 4CUPA 3O37A 3G0JA 4NS5A 4NUCA 2L84A 4QZSA 5CUBA 2N9GA 5A7CA 5H1UA 4QBMA 4QEVA 5A81A 4ZW1A 4WHUA 4Z1QA 4IR4A 5E9IA 3UV2A 2DVSA 4N3WA 4PKLA 4LZRA 5D0CA 5CQ4A 5L97A 4KCXA 4QNSA 4HXOA 2FSAA 4PTBA 4YBMA 5LUUA 5DFDA 5FDZA 2DWWA 5ENCA 4QR4A 4BHWA 2WP2A 5FFYA 4UIYA 5E9YA 3UV5A 4A9HA 4N4HA 5H85A 5ETBA 4CUQA 5D26A 4CURA 4UIWA 5I88A 4NRAA 3IU5A 4IOOA 5HELA 3MULA 4YAXA 4C66A 5EPSA 3JVLA 5IGNA 4YYIA 5HFQA 2L5EA 5A5NA 3MXFA 3O33A 4CLBA 5A5PA 5D3PA 4BJXA 4HXSA 4QYDA 5FE8A 3D7CA 4X2IA 4MR6A 5F63A 5F1LA 4TYLA 4Z6IA 2RNYA 4TZ2A 4XUAA 4UIUA 2RNWA 4YBSA 5HJCA 3P1DA 5EWVA 4MENA 4CFKA 5KTWA 2KTBB 2YDWA 4NRCA 3U5OA 4MEQA 2DVQA 5G4SA 4YYJA 3RCWA 5EK9A 5IIDA 4KV1A 2R10A 5E9LA 2LSPB 4HBVA 5KTUA 4QSXA 5ENGA 5CQ6A 5AMFA 4O77A 4NUEA 4A9LA 4O76A 5E9MA 5E74A 5K29A 4OGJA 5A85A 2YELA 2YEMA 5KO4A 4NR5A 5KTXA 5JWMA 4LYWA 4O75A 2NXBA 4IR3A 4UITA 5DW2A 5CTLA 5CS8A 3SVGA 5AD2A 3ZYUA 4HXRA 5LKZA 2YQDA 3O35A 4J1PA 5ACYA 5CQ7A 1F68A 5A5SA 4YADA 3NXBA 4O72A 5DY7A 5ETDA 4J0RA 3I3JA 3LQHA 4A9FA 5LJ0A 4QC3A 4LDFA 4QSWA 4N4GA 5F36A 2OUOA 3U5JA 1ZS5A 5D3NA 5J0DA 5E73A 4NQNA 5L96A 4ALHA 3DAIA 5E9VA 4UYFB 3QZSA 5I1QA 2RFJA 3LXJA 4O7CA 2RS9B 4HXPA 4WHWA 5DBMA 4Q0OA 5DYUA 5D24A 4PCEA 2GRCA 4HXMA 5EPRA 4Z93A 5HRWA 4TQNA 5CRMA 4XYAA 4UYGA 5E3GA 4WIVA 3UVWA 5C87A 5F61A 4YY4A 5CPEA 2YEKA 4KV4A 5A5OA 5EWDA 4HXKA 3O36A 5BT5A 5HQ7A 5F5ZA 4NUDA 5II2A 5I40A 3S91A 3K2JA 3JVMA 5I89A 4LR6A 4QUUA 5E0RA 5LKXA 4NXJA 4LYSA 4UYDA 5HRXA 5AD3A 5D3LA 5EPBA 4A9MA 2R0VA 5FG4A 5F2PA 4TT6A 4NYXA 5FB0A 5EQ1A 4GPJA 3Q2EA 5EU1A 1JM4B 4NYVA 4MR3A 5DW1A 3MB4A 4A9OA 5HM0A 2DATA 4CUTA 5L98A 4J0SA 5EI4A 5A82A 3QZTA 5A83A 5EV9A 5FE3A 4YBTA 2E7OA 3U5NA 2R0SA 4O7BA 4O78A 3QZVA 5CQAA 5FH8A 5CRZA 5ENEA 3JVJA 4O74A 5CY9A 5FE9A 4XY9A 5CQ3A 4A9IA 5HCLA 5DLZA 5EP7A 4F3IA 5CZGA 4UYFA 5KU3A 5ENBA 2MJVB 5C85A 5L8TA 5DYCA 4RVRA 4TTEA 4QC1A 5HEMA 5EA1A 5C89A 5CUCA 5I86A 1JSPB 4XUBA 4FLPA 3P1CA 4PCIA 4MEOA 3UVYA 5L8UA 5I7XA 5IG6A 4QSVA 4BW4A 3AQAA 5D3RA 5DLXA 4QSPA 5DKHA 3SVHA 4BW1A 5EWHA 5AMEA 3SVFA 2YYNA 5FH7A 5CQ8A 4A9JA 5EWWA 2OSSA 4HBWA 4A9EA 4TU4A 5A5RA 2E3KA 4NRBA 4E96A 5I29A 1N72A 4MR5A 4TU6A 4YYKA 3U5LA 2DKWA 4QB3A 4IR5A 3HMHA 1WUGA 5FE0A 3MQMA 2RNXA 5DKDA 4Z6HA 5FE5A 5LKUA 4ZC9A 4CL9A 3U5KA 5FFVA 4QUTA 4PS5A 5FG6A 3JVKA 5KHMA 4NR6A 5FE2A 4YH3A 4O70A 5E9KA 5F60A 3FKMX 4AKNA 4N4IA 3UV4A 5D3JA 4NR4A 5F25A 3LQJA 4NR8A 5E7DA 2D82A 5ENIA 4Y03A 2DVVA 4XY8A 5LJ1A 3HMFA 4CUSA 5EM3A 4CFLA 5IBNA 4NYWA 4QEUA 4YATA 4PY6A 5HRVA 5CUAA 5H1VA 4N4FA 4YYDA 5HQ6A 5D25A 5FFWA 4NR9A 5FG5A 4IORA 4NQMA 5BT4A 4YH4A 2H60A 2DVRA 5CUDA 5E3DA 5C8GA 5HFRA 3ONIA 5IGKA 3MUKA 4O7FA 5CGPA 3P1EA 2E7NA 3DWYA 3MB3A 4BW3A 3P5OA 5LVRA 3O34A 3IU6A 5FE4A 4C67A 5FE1A 4O71A 5CQTA 3Q2FA 3UW9A 5EWCA 5CQ5A 1WUMA 5D7XA 4HBYA 4LZ2A 4QSSA 5L99A 4Q0NA 4IR6A 4MR4A 4YABA 4BW2A 3GG3A 4TT2A 5HLSA 4HBXA 4QR5A 4QSRA 5D3TA 5C4QA 3UVXA 3AADA 4HXNA 5FH6A 2OO1A 4O7AA 2R0YA 3P1FA
chains in the Genus database with same CATH superfamily
5HENA 5IGLA 4UIXA 5G4RA 4LZSA 2I7KA 4ALGA 4Z1SA 4QSUA 4UYHA 5CUEA 4ZQLA 2F6NA 5CFWA 4A9NA 4YYHA 2WP1A 5LJ2A 3U5PA 4YYMA 4LYIA 5H1TA 3UVDA 4QR3A 3D1DA 5ENJA 4AKHA 5ENHA 4QEWA 5FE6A 5C7NA 3HMEA 2RI7A 5FBXA 5D3SA 5HQ5A 5II1A 3ERRA 4CUUA 4OGIA 4DONA 5JI8A 4IOQA 5COIA 5DYAA 4HXLA 2YW5A 4NR7A 4QSQA 5EICA 2G4AA 4TS8A 5DFBA 4YY6A 4LC2A 3G0LA 3U5MA 4YC9A 5F62A 5F1HA 5D3HA 3S92A 4QYLA 5LKTA 4QSTA 5DX4A 5ENFA 5I80A 1E6IA 5CU8A 5FE7A 4TT4A 2L85A 4MEPA 5CUGA 5BT3A 3LQIA 2I8NA 5EISA 5CP5A 4OUFA 5TB6A 5DKCA 5DYXA 4LRGA 2RO1A 1X0JA 5DFCA 5EGUA 5I83A 5IGMA 4YYGA 2F6JA 5A5QA 3LJWA 5F3AA 5FB1A 1EQFA 5TCMA 4A9KA 4YYNA 5I7YA 4YK0A 4J3IA 2D9EA 4O7EA 5LVQA 4UIVA 5EVAA 4UYEA 4TZ8A 4QY4A 4UIZA 3TLPA 4CUPA 3O37A 3G0JA 4NS5A 4NUCA 2L84A 4QZSA 5CUBA 2N9GA 5A7CA 5H1UA 4QBMA 4QEVA 5A81A 3D1BA 4ZW1A 4WHUA 4Z1QA 4IR4A 5E9IA 3UV2A 2DVSA 4N3WA 4PKLA 4LZRA 5D0CA 5CQ4A 5L97A 4KCXA 4QNSA 4HXOA 2FSAA 4PTBA 4YBMA 5LUUA 5DFDA 5FDZA 2DWWA 5ENCA 4QR4A 4BHWA 2WP2A 5FFYA 4UIYA 5E9YA 3UV5A 4A9HA 4N4HA 5H85A 5ETBA 4CUQA 5D26A 4CURA 4AKIA 4UIWA 5I88A 4NRAA 3IU5A 4IOOA 5HELA 3MULA 4YAXA 4C66A 5EPSA 3JVLA 5IGNA 4YYIA 5HFQA 2L5EA 5A5NA 3MXFA 3O33A 4CLBA 5A5PA 5D3PA 4BJXA 1PUOA 4HXSA 4QYDA 5FE8A 3D7CA 4X2IA 4MR6A 5F63A 5F1LA 4TYLA 4Z6IA 2RNYA 4TZ2A 4XUAA 4UIUA 2RNWA 4YBSA 5HJCA 3P1DA 5EWVA 4MENA 4CFKA 5KTWA 2KTBB 2YDWA 4AI6A 4NRCA 3U5OA 4MEQA 2DVQA 5G4SA 4YYJA 3RCWA 5EK9A 5IIDA 4KV1A 2R10A 5E9LA 1ZKRA 2LSPB 4HBVA 5KTUA 4QSXA 5ENGA 5CQ6A 5AMFA 4O77A 4NUEA 4A9LA 4O76A 5E9MA 5E74A 5K29A 4OGJA 5A85A 2YELA 2YEMA 5KO4A 4NR5A 5KTXA 5JWMA 4LYWA 4O75A 2NXBA 4IR3A 4UITA 5DW2A 5CTLA 5CS8A 3SVGA 5AD2A 3ZYUA 4HXRA 5LKZA 2YQDA 3O35A 4J1PA 5ACYA 5CQ7A 1F68A 5A5SA 4YADA 3NXBA 4O72A 5DY7A 5ETDA 4J0RA 3I3JA 3LQHA 4A9FA 5LJ0A 4QC3A 4LDFA 4QSWA 3VKGA 4N4GA 5F36A 2OUOA 3U5JA 1ZS5A 5D3NA 5J0DA 5E73A 4NQNA 5L96A 4ALHA 3DAIA 5E9VA 4UYFB 3QZSA 5I1QA 2RFJA 3LXJA 4O7CA 2RS9B 4HXPA 4WHWA 5DBMA 4Q0OA 5DYUA 5D24A 4PCEA 2GRCA 4HXMA 5EPRA 4Z93A 5HRWA 4TQNA 5CRMA 4XYAA 4UYGA 5E3GA 4WIVA 3UVWA 5C87A 5F61A 4YY4A 5CPEA 2YEKA 4KV4A 5A5OA 5EWDA 4HXKA 3O36A 5BT5A 5HQ7A 5F5ZA 4NUDA 5II2A 5I40A 3S91A 3K2JA 3JVMA 5I89A 4LR6A 4QUUA 5E0RA 5LKXA 4NXJA 4LYSA 4UYDA 5HRXA 5AD3A 5D3LA 5EPBA 4A9MA 2R0VA 5FG4A 5F2PA 4TT6A 4NYXA 5FB0A 5EQ1A 4GPJA 3Q2EA 5EU1A 1JM4B 4NYVA 4MR3A 5DW1A 3MB4A 4A9OA 5HM0A 2DATA 4CUTA 5L98A 4J0SA 3VKHA 5EI4A 5A82A 3QZTA 5A83A 5EV9A 5FE3A 4YBTA 2E7OA 3U5NA 2R0SA 4O7BA 4O78A 3QZVA 5CQAA 5FH8A 5CRZA 5ENEA 3JVJA 4O74A 5CY9A 5FE9A 4AKGA 4XY9A 5CQ3A 4A9IA 5HCLA 5DLZA 5EP7A 4F3IA 5CZGA 4UYFA 5KU3A 5ENBA 2MJVB 5C85A 5L8TA 5DYCA 4RVRA 4TTEA 4QC1A 5HEMA 5EA1A 5C89A 5CUCA 5I86A 1JSPB 4XUBA 4FLPA 3P1CA 4PCIA 4MEOA 3UVYA 5L8UA 5I7XA 5IG6A 4QSVA 4BW4A 3AQAA 5D3RA 5DLXA 4QSPA 5DKHA 3SVHA 4BW1A 5EWHA 5AMEA 3SVFA 2YYNA 5FH7A 5CQ8A 4A9JA 5EWWA 2OSSA 4HBWA 4A9EA 4TU4A 5A5RA 2E3KA 4NRBA 4E96A 5I29A 1N72A 4MR5A 4TU6A 4YYKA 3U5LA 2DKWA 4QB3A 4IR5A 3HMHA 1WUGA 5FE0A 3MQMA 2RNXA 5DKDA 4Z6HA 5FE5A 5LKUA 4ZC9A 4CL9A 3U5KA 5FFVA 4QUTA 4PS5A 5FG6A 3JVKA 5KHMA 4NR6A 5FE2A 4YH3A 4O70A 5E9KA 5F60A 3FKMX 4AKNA 4N4IA 3UV4A 5D3JA 4NR4A 5F25A 3LQJA 4NR8A 5E7DA 2D82A 5ENIA 4Y03A 2DVVA 4XY8A 5LJ1A 3HMFA 4CUSA 5EM3A 4CFLA 5IBNA 4NYWA 4QEUA 4YATA 2EJNA 4PY6A 5HRVA 5CUAA 5H1VA 4N4FA 4YYDA 5HQ6A 5D25A 5FFWA 4NR9A 5FG5A 4IORA 4NQMA 5BT4A 4YH4A 2H60A 2DVRA 5CUDA 5E3DA 5C8GA 5HFRA 3ONIA 5IGKA 3MUKA 4O7FA 5CGPA 3P1EA 2E7NA 3DWYA 3MB3A 4BW3A 3P5OA 5LVRA 3O34A 3IU6A 5FE4A 4C67A 5FE1A 4O71A 5CQTA 3Q2FA 3UW9A 5EWCA 5CQ5A 1WUMA 4HBYA 5D7XA 4LZ2A 4QSSA 5L99A 4Q0NA 4IR6A 4MR4A 4YABA 4BW2A 3GG3A 4TT2A 5HLSA 4HBXA 4QR5A 4QSRA 5D3TA 5C4QA 3UVXA 3AADA 4HXNA 5FH6A 2OO1A 4O7AA 2R0YA 3P1FA
chains in the Genus database with same CATH topology
5HENA 5IGLA 4UIXA 5G4RA 4LZSA 2I7KA 4ALGA 4Z1SA 4QSUA 4UYHA 5CUEA 4ZQLA 2F6NA 5CFWA 4A9NA 4YYHA 2WP1A 5LJ2A 3U5PA 4YYMA 4LYIA 5H1TA 3UVDA 4QR3A 5ENJA 5ENHA 4QEWA 5FE6A 5C7NA 3HMEA 2RI7A 5FBXA 5D3SA 5HQ5A 5II1A 4CUUA 4OGIA 4DONA 5JI8A 4IOQA 5COIA 5DYAA 4HXLA 2YW5A 4NR7A 4QSQA 5EICA 2G4AA 4TS8A 5DFBA 4YY6A 4LC2A 3G0LA 3U5MA 4YC9A 5F62A 5F1HA 5D3HA 3S92A 4QYLA 5LKTA 4QSTA 5DX4A 5ENFA 5I80A 1E6IA 5CU8A 5FE7A 4TT4A 2L85A 4MEPA 5CUGA 5BT3A 3LQIA 2I8NA 5EISA 5CP5A 4OUFA 5TB6A 5DKCA 5DYXA 4LRGA 2RO1A 1X0JA 5DFCA 5EGUA 5I83A 5IGMA 4YYGA 2F6JA 5A5QA 3LJWA 5F3AA 5FB1A 1EQFA 5TCMA 4A9KA 4YYNA 5I7YA 4YK0A 4J3IA 2D9EA 4O7EA 5LVQA 4UIVA 5EVAA 4UYEA 4TZ8A 4QY4A 4UIZA 3TLPA 4CUPA 3O37A 3G0JA 4NS5A 4NUCA 2L84A 4QZSA 5CUBA 2N9GA 5A7CA 5H1UA 4QBMA 4QEVA 5A81A 4ZW1A 4WHUA 4Z1QA 4IR4A 5E9IA 3UV2A 2DVSA 4N3WA 4PKLA 4LZRA 5D0CA 5CQ4A 5L97A 4KCXA 4QNSA 4HXOA 2FSAA 4PTBA 4YBMA 5LUUA 5DFDA 5FDZA 2DWWA 5ENCA 4QR4A 4BHWA 2WP2A 5FFYA 4UIYA 5E9YA 3UV5A 4A9HA 4N4HA 5H85A 5ETBA 4CUQA 5D26A 4CURA 4UIWA 5I88A 4NRAA 3IU5A 4IOOA 5HELA 3MULA 4YAXA 4C66A 5EPSA 3JVLA 5IGNA 4YYIA 5HFQA 2L5EA 5A5NA 3MXFA 3O33A 4CLBA 5A5PA 5D3PA 4BJXA 4HXSA 4QYDA 5FE8A 3D7CA 4X2IA 4MR6A 5F63A 5F1LA 4TYLA 4Z6IA 2RNYA 4TZ2A 4XUAA 4UIUA 2RNWA 4YBSA 5HJCA 3P1DA 5EWVA 4MENA 4CFKA 5KTWA 2KTBB 2YDWA 4NRCA 3U5OA 4MEQA 2DVQA 5G4SA 4YYJA 3RCWA 5EK9A 5IIDA 4KV1A 2R10A 5E9LA 2LSPB 4HBVA 5KTUA 4QSXA 5ENGA 5CQ6A 5AMFA 4O77A 4NUEA 4A9LA 4O76A 5E9MA 5E74A 5K29A 4OGJA 5A85A 2YELA 2YEMA 5KO4A 4NR5A 5KTXA 5JWMA 4LYWA 4O75A 2NXBA 4IR3A 4UITA 5DW2A 5CTLA 5CS8A 3SVGA 5AD2A 3ZYUA 4HXRA 5LKZA 2YQDA 3O35A 4J1PA 5ACYA 5CQ7A 1F68A 5A5SA 4YADA 3NXBA 4O72A 5DY7A 5ETDA 4J0RA 3I3JA 3LQHA 4A9FA 5LJ0A 4QC3A 4LDFA 4QSWA 4N4GA 5F36A 2OUOA 3U5JA 1ZS5A 5D3NA 5J0DA 5E73A 4NQNA 5L96A 4ALHA 3DAIA 5E9VA 4UYFB 3QZSA 5I1QA 2RFJA 3LXJA 4O7CA 2RS9B 4HXPA 4WHWA 5DBMA 4Q0OA 5DYUA 5D24A 4PCEA 2GRCA 4HXMA 5EPRA 4Z93A 5HRWA 4TQNA 5CRMA 4XYAA 4UYGA 5E3GA 4WIVA 3UVWA 5C87A 5F61A 4YY4A 5CPEA 2YEKA 4KV4A 5A5OA 5EWDA 4HXKA 3O36A 5BT5A 5HQ7A 5F5ZA 4NUDA 5II2A 5I40A 3S91A 3K2JA 3JVMA 5I89A 4LR6A 4QUUA 5E0RA 5LKXA 4NXJA 4LYSA 4UYDA 5HRXA 5AD3A 5D3LA 5EPBA 4A9MA 2R0VA 5FG4A 5F2PA 4TT6A 4NYXA 5FB0A 5EQ1A 4GPJA 3Q2EA 5EU1A 1JM4B 4NYVA 4MR3A 5DW1A 3MB4A 4A9OA 5HM0A 2DATA 4CUTA 5L98A 4J0SA 5EI4A 5A82A 3QZTA 5A83A 5EV9A 5FE3A 4YBTA 2E7OA 3U5NA 2R0SA 4O7BA 4O78A 3QZVA 5CQAA 5FH8A 5CRZA 5ENEA 3JVJA 4O74A 5CY9A 5FE9A 4XY9A 5CQ3A 4A9IA 5HCLA 5DLZA 5EP7A 4F3IA 5CZGA 4UYFA 5KU3A 5ENBA 2MJVB 5C85A 5L8TA 5DYCA 4RVRA 4TTEA 4QC1A 5HEMA 5EA1A 5C89A 5CUCA 5I86A 1JSPB 4XUBA 4FLPA 3P1CA 4PCIA 4MEOA 3UVYA 5L8UA 5I7XA 5IG6A 4QSVA 4BW4A 3AQAA 5D3RA 5DLXA 4QSPA 5DKHA 3SVHA 4BW1A 5EWHA 5AMEA 3SVFA 2YYNA 5FH7A 5CQ8A 4A9JA 5EWWA 2OSSA 4HBWA 4A9EA 4TU4A 5A5RA 2E3KA 4NRBA 4E96A 5I29A 1N72A 4MR5A 4TU6A 4YYKA 3U5LA 2DKWA 4QB3A 4IR5A 3HMHA 1WUGA 5FE0A 3MQMA 2RNXA 5DKDA 4Z6HA 5FE5A 5LKUA 4ZC9A 4CL9A 3U5KA 5FFVA 4QUTA 4PS5A 5FG6A 3JVKA 5KHMA 4NR6A 5FE2A 4YH3A 4O70A 5E9KA 5F60A 3FKMX 4AKNA 4N4IA 3UV4A 5D3JA 4NR4A 5F25A 3LQJA 4NR8A 5E7DA 2D82A 5ENIA 4Y03A 2DVVA 4XY8A 5LJ1A 3HMFA 4CUSA 5EM3A 4CFLA 5IBNA 4NYWA 4QEUA 4YATA 4PY6A 5HRVA 5CUAA 5H1VA 4N4FA 4YYDA 5HQ6A 5D25A 5FFWA 4NR9A 5FG5A 4IORA 4NQMA 5BT4A 4YH4A 2H60A 2DVRA 5CUDA 5E3DA 5C8GA 5HFRA 3ONIA 5IGKA 3MUKA 4O7FA 5CGPA 3P1EA 2E7NA 3DWYA 3MB3A 4BW3A 3P5OA 5LVRA 3O34A 3IU6A 5FE4A 4C67A 5FE1A 4O71A 5CQTA 3Q2FA 3UW9A 5EWCA 5CQ5A 1WUMA 5D7XA 4HBYA 4LZ2A 4QSSA 5L99A 4Q0NA 4IR6A 4MR4A 4YABA 4BW2A 3GG3A 4TT2A 5HLSA 4HBXA 4QR5A 4QSRA 5D3TA 5C4QA 3UVXA 3AADA 4HXNA 5FH6A 2OO1A 4O7AA 2R0YA 3P1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEN A;  5IGL A;  4UIX A;  5G4R A;  4LZS A;  2I7K A;  4ALG A;  4Z1S A;  4QSU A;  4UYH A;  5CUE A;  4ZQL A;  2F6N A;  5CFW A;  4A9N A;  4YYH A;  2WP1 A;  5LJ2 A;  3U5P A;  4YYM A;  4LYI A;  5H1T A;  3UVD A;  4QR3 A;  5ENJ A;  5ENH A;  4QEW A;  5FE6 A;  5C7N A;  3HME A;  2RI7 A;  5FBX A;  5D3S A;  5HQ5 A;  5II1 A;  4CUU A;  4OGI A;  4DON A;  5JI8 A;  4IOQ A;  5COI A;  5DYA A;  4HXL A;  2YW5 A;  4NR7 A;  4QSQ A;  5EIC A;  2G4A A;  4TS8 A;  5DFB A;  4YY6 A;  4LC2 A;  3G0L A;  3U5M A;  4YC9 A;  5F62 A;  5F1H A;  5D3H A;  3S92 A;  4QYL A;  5LKT A;  4QST A;  5DX4 A;  5ENF A;  5I80 A;  1E6I A;  5CU8 A;  5FE7 A;  4TT4 A;  2L85 A;  4MEP A;  5CUG A;  5BT3 A;  3LQI A;  2I8N A;  5EIS A;  5CP5 A;  4OUF A;  5TB6 A;  5DKC A;  5DYX A;  4LRG A;  2RO1 A;  1X0J A;  5DFC A;  5EGU A;  5I83 A;  5IGM A;  4YYG A;  2F6J A;  5A5Q A;  3LJW A;  5F3A A;  5FB1 A;  1EQF A;  5TCM A;  4A9K A;  4YYN A;  5I7Y A;  4YK0 A;  4J3I A;  2D9E A;  4O7E A;  5LVQ A;  4UIV A;  5EVA A;  4UYE A;  4TZ8 A;  4QY4 A;  4UIZ A;  3TLP A;  4CUP A;  3O37 A;  3G0J A;  4NS5 A;  4NUC A;  2L84 A;  4QZS A;  5CUB A;  2N9G A;  5A7C A;  5H1U A;  4QBM A;  4QEV A;  5A81 A;  4ZW1 A;  4WHU A;  4Z1Q A;  4IR4 A;  5E9I A;  3UV2 A;  2DVS A;  4N3W A;  4PKL A;  4LZR A;  5D0C A;  5CQ4 A;  5L97 A;  4KCX A;  4QNS A;  4HXO A;  2FSA A;  4PTB A;  4YBM A;  5LUU A;  5DFD A;  5FDZ A;  2DWW A;  5ENC A;  4QR4 A;  4BHW A;  2WP2 A;  5FFY A;  4UIY A;  5E9Y A;  3UV5 A;  4A9H A;  4N4H A;  5H85 A;  5ETB A;  4CUQ A;  5D26 A;  4CUR A;  4UIW A;  5I88 A;  4NRA A;  3IU5 A;  4IOO A;  5HEL A;  3MUL A;  4YAX A;  4C66 A;  5EPS A;  3JVL A;  5IGN A;  4YYI A;  5HFQ A;  2L5E A;  5A5N A;  3MXF A;  3O33 A;  4CLB A;  5A5P A;  5D3P A;  4BJX A;  4HXS A;  4QYD A;  5FE8 A;  3D7C A;  4X2I A;  4MR6 A;  5F63 A;  5F1L A;  4TYL A;  4Z6I A;  2RNY A;  4TZ2 A;  4XUA A;  4UIU A;  2RNW A;  4YBS A;  5HJC A;  3P1D A;  5EWV A;  4MEN A;  4CFK A;  5KTW A;  2KTB B;  2YDW A;  4NRC A;  3U5O A;  4MEQ A;  2DVQ A;  5G4S A;  4YYJ A;  3RCW A;  5EK9 A;  5IID A;  4KV1 A;  2R10 A;  5E9L A;  2LSP B;  4HBV A;  5KTU A;  4QSX A;  5ENG A;  5CQ6 A;  5AMF A;  4O77 A;  4NUE A;  4A9L A;  4O76 A;  5E9M A;  5E74 A;  5K29 A;  4OGJ A;  5A85 A;  2YEL A;  2YEM A;  5KO4 A;  4NR5 A;  5KTX A;  5JWM A;  4LYW A;  4O75 A;  2NXB A;  4IR3 A;  4UIT A;  5DW2 A;  5CTL A;  5CS8 A;  3SVG A;  5AD2 A;  3ZYU A;  4HXR A;  5LKZ A;  2YQD A;  3O35 A;  4J1P A;  5ACY A;  5CQ7 A;  1F68 A;  5A5S A;  4YAD A;  3NXB A;  4O72 A;  5DY7 A;  5ETD A;  4J0R A;  3I3J A;  3LQH A;  4A9F A;  5LJ0 A;  4QC3 A;  4LDF A;  4QSW A;  4N4G A;  5F36 A;  2OUO A;  3U5J A;  1ZS5 A;  5D3N A;  5J0D A;  5E73 A;  4NQN A;  5L96 A;  4ALH A;  3DAI A;  5E9V A;  4UYF B;  3QZS A;  5I1Q A;  2RFJ A;  3LXJ A;  4O7C A;  2RS9 B;  4HXP A;  4WHW A;  5DBM A;  4Q0O A;  5DYU A;  5D24 A;  4PCE A;  2GRC A;  4HXM A;  5EPR A;  4Z93 A;  5HRW A;  4TQN A;  5CRM A;  4XYA A;  4UYG A;  5E3G A;  4WIV A;  3UVW A;  5C87 A;  5F61 A;  4YY4 A;  5CPE A;  2YEK A;  4KV4 A;  5A5O A;  5EWD A;  4HXK A;  3O36 A;  5BT5 A;  5HQ7 A;  5F5Z A;  4NUD A;  5II2 A;  5I40 A;  3S91 A;  3K2J A;  3JVM A;  5I89 A;  4LR6 A;  4QUU A;  5E0R A;  5LKX A;  4NXJ A;  4LYS A;  4UYD A;  5HRX A;  5AD3 A;  5D3L A;  5EPB A;  4A9M A;  2R0V A;  5FG4 A;  5F2P A;  4TT6 A;  4NYX A;  5FB0 A;  5EQ1 A;  4GPJ A;  3Q2E A;  5EU1 A;  1JM4 B;  4NYV A;  4MR3 A;  5DW1 A;  3MB4 A;  4A9O A;  5HM0 A;  2DAT A;  4CUT A;  5L98 A;  4J0S A;  5EI4 A;  5A82 A;  3QZT A;  5A83 A;  5EV9 A;  5FE3 A;  4YBT A;  2E7O A;  3U5N A;  2R0S A;  4O7B A;  4O78 A;  3QZV A;  5CQA A;  5FH8 A;  5CRZ A;  5ENE A;  3JVJ A;  4O74 A;  5CY9 A;  5FE9 A;  4XY9 A;  5CQ3 A;  4A9I A;  5HCL A;  5DLZ A;  5EP7 A;  4F3I A;  5CZG A;  4UYF A;  5KU3 A;  5ENB A;  2MJV B;  5C85 A;  5L8T A;  5DYC A;  4RVR A;  4TTE A;  4QC1 A;  5HEM A;  5EA1 A;  5C89 A;  5CUC A;  5I86 A;  1JSP B;  4XUB A;  4FLP A;  3P1C A;  4PCI A;  4MEO A;  3UVY A;  5L8U A;  5I7X A;  5IG6 A;  4QSV A;  4BW4 A;  3AQA A;  5D3R A;  5DLX A;  4QSP A;  5DKH A;  3SVH A;  4BW1 A;  5EWH A;  5AME A;  3SVF A;  2YYN A;  5FH7 A;  5CQ8 A;  4A9J A;  5EWW A;  2OSS A;  4HBW A;  4A9E A;  4TU4 A;  5A5R A;  2E3K A;  4NRB A;  4E96 A;  5I29 A;  1N72 A;  4MR5 A;  4TU6 A;  4YYK A;  3U5L A;  2DKW A;  4QB3 A;  4IR5 A;  3HMH A;  1WUG A;  5FE0 A;  3MQM A;  2RNX A;  5DKD A;  4Z6H A;  5FE5 A;  5LKU A;  4ZC9 A;  4CL9 A;  3U5K A;  5FFV A;  4QUT A;  4PS5 A;  5FG6 A;  3JVK A;  5KHM A;  4NR6 A;  5FE2 A;  4YH3 A;  4O70 A;  5E9K A;  5F60 A;  3FKM X;  4AKN A;  4N4I A;  3UV4 A;  5D3J A;  4NR4 A;  5F25 A;  3LQJ A;  4NR8 A;  5E7D A;  2D82 A;  5ENI A;  4Y03 A;  2DVV A;  4XY8 A;  5LJ1 A;  3HMF A;  4CUS A;  5EM3 A;  4CFL A;  5IBN A;  4NYW A;  4QEU A;  4YAT A;  4PY6 A;  5HRV A;  5CUA A;  5H1V A;  4N4F A;  4YYD A;  5HQ6 A;  5D25 A;  5FFW A;  4NR9 A;  5FG5 A;  4IOR A;  4NQM A;  5BT4 A;  4YH4 A;  2H60 A;  2DVR A;  5CUD A;  5E3D A;  5C8G A;  5HFR A;  3ONI A;  5IGK A;  3MUK A;  4O7F A;  5CGP A;  3P1E A;  2E7N A;  3DWY A;  3MB3 A;  4BW3 A;  3P5O A;  5LVR A;  3O34 A;  3IU6 A;  5FE4 A;  4C67 A;  5FE1 A;  4O71 A;  5CQT A;  3Q2F A;  3UW9 A;  5EWC A;  5CQ5 A;  1WUM A;  5D7X A;  4HBY A;  4LZ2 A;  4QSS A;  5L99 A;  4Q0N A;  4IR6 A;  4MR4 A;  4YAB A;  4BW2 A;  3GG3 A;  4TT2 A;  5HLS A;  4HBX A;  4QR5 A;  4QSR A;  5D3T A;  5C4Q A;  3UVX A;  3AAD A;  4HXN A;  5FH6 A;  2OO1 A;  4O7A A;  2R0Y A;  3P1F A; 
#chains in the Genus database with same CATH topology
 5HEN A;  5IGL A;  4UIX A;  5G4R A;  4LZS A;  2I7K A;  4ALG A;  4Z1S A;  4QSU A;  4UYH A;  5CUE A;  4ZQL A;  2F6N A;  5CFW A;  4A9N A;  4YYH A;  2WP1 A;  5LJ2 A;  3U5P A;  4YYM A;  4LYI A;  5H1T A;  3UVD A;  4QR3 A;  3D1D A;  5ENJ A;  4AKH A;  5ENH A;  4QEW A;  5FE6 A;  5C7N A;  3HME A;  2RI7 A;  5FBX A;  5D3S A;  5HQ5 A;  5II1 A;  3ERR A;  4CUU A;  4OGI A;  4DON A;  5JI8 A;  4IOQ A;  5COI A;  5DYA A;  4HXL A;  2YW5 A;  4NR7 A;  4QSQ A;  5EIC A;  2G4A A;  4TS8 A;  5DFB A;  4YY6 A;  4LC2 A;  3G0L A;  3U5M A;  4YC9 A;  5F62 A;  5F1H A;  5D3H A;  3S92 A;  4QYL A;  5LKT A;  4QST A;  5DX4 A;  5ENF A;  5I80 A;  1E6I A;  5CU8 A;  5FE7 A;  4TT4 A;  2L85 A;  4MEP A;  5CUG A;  5BT3 A;  3LQI A;  2I8N A;  5EIS A;  5CP5 A;  4OUF A;  5TB6 A;  5DKC A;  5DYX A;  4LRG A;  2RO1 A;  1X0J A;  5DFC A;  5EGU A;  5I83 A;  5IGM A;  4YYG A;  2F6J A;  5A5Q A;  3LJW A;  5F3A A;  5FB1 A;  1EQF A;  5TCM A;  4A9K A;  4YYN A;  5I7Y A;  4YK0 A;  4J3I A;  2D9E A;  4O7E A;  5LVQ A;  4UIV A;  5EVA A;  4UYE A;  4TZ8 A;  4QY4 A;  4UIZ A;  3TLP A;  4CUP A;  3O37 A;  3G0J A;  4NS5 A;  4NUC A;  2L84 A;  4QZS A;  5CUB A;  2N9G A;  5A7C A;  5H1U A;  4QBM A;  4QEV A;  5A81 A;  3D1B A;  4ZW1 A;  4WHU A;  4Z1Q A;  4IR4 A;  5E9I A;  3UV2 A;  2DVS A;  4N3W A;  4PKL A;  4LZR A;  5D0C A;  5CQ4 A;  5L97 A;  4KCX A;  4QNS A;  4HXO A;  2FSA A;  4PTB A;  4YBM A;  5LUU A;  5DFD A;  5FDZ A;  2DWW A;  5ENC A;  4QR4 A;  4BHW A;  2WP2 A;  5FFY A;  4UIY A;  5E9Y A;  3UV5 A;  4A9H A;  4N4H A;  5H85 A;  5ETB A;  4CUQ A;  5D26 A;  4CUR A;  4AKI A;  4UIW A;  5I88 A;  4NRA A;  3IU5 A;  4IOO A;  5HEL A;  3MUL A;  4YAX A;  4C66 A;  5EPS A;  3JVL A;  5IGN A;  4YYI A;  5HFQ A;  2L5E A;  5A5N A;  3MXF A;  3O33 A;  4CLB A;  5A5P A;  5D3P A;  4BJX A;  1PUO A;  4HXS A;  4QYD A;  5FE8 A;  3D7C A;  4X2I A;  4MR6 A;  5F63 A;  5F1L A;  4TYL A;  4Z6I A;  2RNY A;  4TZ2 A;  4XUA A;  4UIU A;  2RNW A;  4YBS A;  5HJC A;  3P1D A;  5EWV A;  4MEN A;  4CFK A;  5KTW A;  2KTB B;  2YDW A;  4AI6 A;  4NRC A;  3U5O A;  4MEQ A;  2DVQ A;  5G4S A;  4YYJ A;  3RCW A;  5EK9 A;  5IID A;  4KV1 A;  2R10 A;  5E9L A;  1ZKR A;  2LSP B;  4HBV A;  5KTU A;  4QSX A;  5ENG A;  5CQ6 A;  5AMF A;  4O77 A;  4NUE A;  4A9L A;  4O76 A;  5E9M A;  5E74 A;  5K29 A;  4OGJ A;  5A85 A;  2YEL A;  2YEM A;  5KO4 A;  4NR5 A;  5KTX A;  5JWM A;  4LYW A;  4O75 A;  2NXB A;  4IR3 A;  4UIT A;  5DW2 A;  5CTL A;  5CS8 A;  3SVG A;  5AD2 A;  3ZYU A;  4HXR A;  5LKZ A;  2YQD A;  3O35 A;  4J1P A;  5ACY A;  5CQ7 A;  1F68 A;  5A5S A;  4YAD A;  3NXB A;  4O72 A;  5DY7 A;  5ETD A;  4J0R A;  3I3J A;  3LQH A;  4A9F A;  5LJ0 A;  4QC3 A;  4LDF A;  4QSW A;  3VKG A;  4N4G A;  5F36 A;  2OUO A;  3U5J A;  1ZS5 A;  5D3N A;  5J0D A;  5E73 A;  4NQN A;  5L96 A;  4ALH A;  3DAI A;  5E9V A;  4UYF B;  3QZS A;  5I1Q A;  2RFJ A;  3LXJ A;  4O7C A;  2RS9 B;  4HXP A;  4WHW A;  5DBM A;  4Q0O A;  5DYU A;  5D24 A;  4PCE A;  2GRC A;  4HXM A;  5EPR A;  4Z93 A;  5HRW A;  4TQN A;  5CRM A;  4XYA A;  4UYG A;  5E3G A;  4WIV A;  3UVW A;  5C87 A;  5F61 A;  4YY4 A;  5CPE A;  2YEK A;  4KV4 A;  5A5O A;  5EWD A;  4HXK A;  3O36 A;  5BT5 A;  5HQ7 A;  5F5Z A;  4NUD A;  5II2 A;  5I40 A;  3S91 A;  3K2J A;  3JVM A;  5I89 A;  4LR6 A;  4QUU A;  5E0R A;  5LKX A;  4NXJ A;  4LYS A;  4UYD A;  5HRX A;  5AD3 A;  5D3L A;  5EPB A;  4A9M A;  2R0V A;  5FG4 A;  5F2P A;  4TT6 A;  4NYX A;  5FB0 A;  5EQ1 A;  4GPJ A;  3Q2E A;  5EU1 A;  1JM4 B;  4NYV A;  4MR3 A;  5DW1 A;  3MB4 A;  4A9O A;  5HM0 A;  2DAT A;  4CUT A;  5L98 A;  4J0S A;  3VKH A;  5EI4 A;  5A82 A;  3QZT A;  5A83 A;  5EV9 A;  5FE3 A;  4YBT A;  2E7O A;  3U5N A;  2R0S A;  4O7B A;  4O78 A;  3QZV A;  5CQA A;  5FH8 A;  5CRZ A;  5ENE A;  3JVJ A;  4O74 A;  5CY9 A;  5FE9 A;  4AKG A;  4XY9 A;  5CQ3 A;  4A9I A;  5HCL A;  5DLZ A;  5EP7 A;  4F3I A;  5CZG A;  4UYF A;  5KU3 A;  5ENB A;  2MJV B;  5C85 A;  5L8T A;  5DYC A;  4RVR A;  4TTE A;  4QC1 A;  5HEM A;  5EA1 A;  5C89 A;  5CUC A;  5I86 A;  1JSP B;  4XUB A;  4FLP A;  3P1C A;  4PCI A;  4MEO A;  3UVY A;  5L8U A;  5I7X A;  5IG6 A;  4QSV A;  4BW4 A;  3AQA A;  5D3R A;  5DLX A;  4QSP A;  5DKH A;  3SVH A;  4BW1 A;  5EWH A;  5AME A;  3SVF A;  2YYN A;  5FH7 A;  5CQ8 A;  4A9J A;  5EWW A;  2OSS A;  4HBW A;  4A9E A;  4TU4 A;  5A5R A;  2E3K A;  4NRB A;  4E96 A;  5I29 A;  1N72 A;  4MR5 A;  4TU6 A;  4YYK A;  3U5L A;  2DKW A;  4QB3 A;  4IR5 A;  3HMH A;  1WUG A;  5FE0 A;  3MQM A;  2RNX A;  5DKD A;  4Z6H A;  5FE5 A;  5LKU A;  4ZC9 A;  4CL9 A;  3U5K A;  5FFV A;  4QUT A;  4PS5 A;  5FG6 A;  3JVK A;  5KHM A;  4NR6 A;  5FE2 A;  4YH3 A;  4O70 A;  5E9K A;  5F60 A;  3FKM X;  4AKN A;  4N4I A;  3UV4 A;  5D3J A;  4NR4 A;  5F25 A;  3LQJ A;  4NR8 A;  5E7D A;  2D82 A;  5ENI A;  4Y03 A;  2DVV A;  4XY8 A;  5LJ1 A;  3HMF A;  4CUS A;  5EM3 A;  4CFL A;  5IBN A;  4NYW A;  4QEU A;  4YAT A;  2EJN A;  4PY6 A;  5HRV A;  5CUA A;  5H1V A;  4N4F A;  4YYD A;  5HQ6 A;  5D25 A;  5FFW A;  4NR9 A;  5FG5 A;  4IOR A;  4NQM A;  5BT4 A;  4YH4 A;  2H60 A;  2DVR A;  5CUD A;  5E3D A;  5C8G A;  5HFR A;  3ONI A;  5IGK A;  3MUK A;  4O7F A;  5CGP A;  3P1E A;  2E7N A;  3DWY A;  3MB3 A;  4BW3 A;  3P5O A;  5LVR A;  3O34 A;  3IU6 A;  5FE4 A;  4C67 A;  5FE1 A;  4O71 A;  5CQT A;  3Q2F A;  3UW9 A;  5EWC A;  5CQ5 A;  1WUM A;  4HBY A;  5D7X A;  4LZ2 A;  4QSS A;  5L99 A;  4Q0N A;  4IR6 A;  4MR4 A;  4YAB A;  4BW2 A;  3GG3 A;  4TT2 A;  5HLS A;  4HBX A;  4QR5 A;  4QSR A;  5D3T A;  5C4Q A;  3UVX A;  3AAD A;  4HXN A;  5FH6 A;  2OO1 A;  4O7A A;  2R0Y A;  3P1F A; 
#chains in the Genus database with same CATH homology
 5HEN A;  5IGL A;  4UIX A;  5G4R A;  4LZS A;  2I7K A;  4ALG A;  4Z1S A;  4QSU A;  4UYH A;  5CUE A;  4ZQL A;  2F6N A;  5CFW A;  4A9N A;  4YYH A;  2WP1 A;  5LJ2 A;  3U5P A;  4YYM A;  4LYI A;  5H1T A;  3UVD A;  4QR3 A;  5ENJ A;  5ENH A;  4QEW A;  5FE6 A;  5C7N A;  3HME A;  2RI7 A;  5FBX A;  5D3S A;  5HQ5 A;  5II1 A;  4CUU A;  4OGI A;  4DON A;  5JI8 A;  4IOQ A;  5COI A;  5DYA A;  4HXL A;  2YW5 A;  4NR7 A;  4QSQ A;  5EIC A;  2G4A A;  4TS8 A;  5DFB A;  4YY6 A;  4LC2 A;  3G0L A;  3U5M A;  4YC9 A;  5F62 A;  5F1H A;  5D3H A;  3S92 A;  4QYL A;  5LKT A;  4QST A;  5DX4 A;  5ENF A;  5I80 A;  1E6I A;  5CU8 A;  5FE7 A;  4TT4 A;  2L85 A;  4MEP A;  5CUG A;  5BT3 A;  3LQI A;  2I8N A;  5EIS A;  5CP5 A;  4OUF A;  5TB6 A;  5DKC A;  5DYX A;  4LRG A;  2RO1 A;  1X0J A;  5DFC A;  5EGU A;  5I83 A;  5IGM A;  4YYG A;  2F6J A;  5A5Q A;  3LJW A;  5F3A A;  5FB1 A;  1EQF A;  5TCM A;  4A9K A;  4YYN A;  5I7Y A;  4YK0 A;  4J3I A;  2D9E A;  4O7E A;  5LVQ A;  4UIV A;  5EVA A;  4UYE A;  4TZ8 A;  4QY4 A;  4UIZ A;  3TLP A;  4CUP A;  3O37 A;  3G0J A;  4NS5 A;  4NUC A;  2L84 A;  4QZS A;  5CUB A;  2N9G A;  5A7C A;  5H1U A;  4QBM A;  4QEV A;  5A81 A;  4ZW1 A;  4WHU A;  4Z1Q A;  4IR4 A;  5E9I A;  3UV2 A;  2DVS A;  4N3W A;  4PKL A;  4LZR A;  5D0C A;  5CQ4 A;  5L97 A;  4KCX A;  4QNS A;  4HXO A;  2FSA A;  4PTB A;  4YBM A;  5LUU A;  5DFD A;  5FDZ A;  2DWW A;  5ENC A;  4QR4 A;  4BHW A;  2WP2 A;  5FFY A;  4UIY A;  5E9Y A;  3UV5 A;  4A9H A;  4N4H A;  5H85 A;  5ETB A;  4CUQ A;  5D26 A;  4CUR A;  4UIW A;  5I88 A;  4NRA A;  3IU5 A;  4IOO A;  5HEL A;  3MUL A;  4YAX A;  4C66 A;  5EPS A;  3JVL A;  5IGN A;  4YYI A;  5HFQ A;  2L5E A;  5A5N A;  3MXF A;  3O33 A;  4CLB A;  5A5P A;  5D3P A;  4BJX A;  4HXS A;  4QYD A;  5FE8 A;  3D7C A;  4X2I A;  4MR6 A;  5F63 A;  5F1L A;  4TYL A;  4Z6I A;  2RNY A;  4TZ2 A;  4XUA A;  4UIU A;  2RNW A;  4YBS A;  5HJC A;  3P1D A;  5EWV A;  4MEN A;  4CFK A;  5KTW A;  2KTB B;  2YDW A;  4NRC A;  3U5O A;  4MEQ A;  2DVQ A;  5G4S A;  4YYJ A;  3RCW A;  5EK9 A;  5IID A;  4KV1 A;  2R10 A;  5E9L A;  2LSP B;  4HBV A;  5KTU A;  4QSX A;  5ENG A;  5CQ6 A;  5AMF A;  4O77 A;  4NUE A;  4A9L A;  4O76 A;  5E9M A;  5E74 A;  5K29 A;  4OGJ A;  5A85 A;  2YEL A;  2YEM A;  5KO4 A;  4NR5 A;  5KTX A;  5JWM A;  4LYW A;  4O75 A;  2NXB A;  4IR3 A;  4UIT A;  5DW2 A;  5CTL A;  5CS8 A;  3SVG A;  5AD2 A;  3ZYU A;  4HXR A;  5LKZ A;  2YQD A;  3O35 A;  4J1P A;  5ACY A;  5CQ7 A;  1F68 A;  5A5S A;  4YAD A;  3NXB A;  4O72 A;  5DY7 A;  5ETD A;  4J0R A;  3I3J A;  3LQH A;  4A9F A;  5LJ0 A;  4QC3 A;  4LDF A;  4QSW A;  4N4G A;  5F36 A;  2OUO A;  3U5J A;  1ZS5 A;  5D3N A;  5J0D A;  5E73 A;  4NQN A;  5L96 A;  4ALH A;  3DAI A;  5E9V A;  4UYF B;  3QZS A;  5I1Q A;  2RFJ A;  3LXJ A;  4O7C A;  2RS9 B;  4HXP A;  4WHW A;  5DBM A;  4Q0O A;  5DYU A;  5D24 A;  4PCE A;  2GRC A;  4HXM A;  5EPR A;  4Z93 A;  5HRW A;  4TQN A;  5CRM A;  4XYA A;  4UYG A;  5E3G A;  4WIV A;  3UVW A;  5C87 A;  5F61 A;  4YY4 A;  5CPE A;  2YEK A;  4KV4 A;  5A5O A;  5EWD A;  4HXK A;  3O36 A;  5BT5 A;  5HQ7 A;  5F5Z A;  4NUD A;  5II2 A;  5I40 A;  3S91 A;  3K2J A;  3JVM A;  5I89 A;  4LR6 A;  4QUU A;  5E0R A;  5LKX A;  4NXJ A;  4LYS A;  4UYD A;  5HRX A;  5AD3 A;  5D3L A;  5EPB A;  4A9M A;  2R0V A;  5FG4 A;  5F2P A;  4TT6 A;  4NYX A;  5FB0 A;  5EQ1 A;  4GPJ A;  3Q2E A;  5EU1 A;  1JM4 B;  4NYV A;  4MR3 A;  5DW1 A;  3MB4 A;  4A9O A;  5HM0 A;  2DAT A;  4CUT A;  5L98 A;  4J0S A;  5EI4 A;  5A82 A;  3QZT A;  5A83 A;  5EV9 A;  5FE3 A;  4YBT A;  2E7O A;  3U5N A;  2R0S A;  4O7B A;  4O78 A;  3QZV A;  5CQA A;  5FH8 A;  5CRZ A;  5ENE A;  3JVJ A;  4O74 A;  5CY9 A;  5FE9 A;  4XY9 A;  5CQ3 A;  4A9I A;  5HCL A;  5DLZ A;  5EP7 A;  4F3I A;  5CZG A;  4UYF A;  5KU3 A;  5ENB A;  2MJV B;  5C85 A;  5L8T A;  5DYC A;  4RVR A;  4TTE A;  4QC1 A;  5HEM A;  5EA1 A;  5C89 A;  5CUC A;  5I86 A;  1JSP B;  4XUB A;  4FLP A;  3P1C A;  4PCI A;  4MEO A;  3UVY A;  5L8U A;  5I7X A;  5IG6 A;  4QSV A;  4BW4 A;  3AQA A;  5D3R A;  5DLX A;  4QSP A;  5DKH A;  3SVH A;  4BW1 A;  5EWH A;  5AME A;  3SVF A;  2YYN A;  5FH7 A;  5CQ8 A;  4A9J A;  5EWW A;  2OSS A;  4HBW A;  4A9E A;  4TU4 A;  5A5R A;  2E3K A;  4NRB A;  4E96 A;  5I29 A;  1N72 A;  4MR5 A;  4TU6 A;  4YYK A;  3U5L A;  2DKW A;  4QB3 A;  4IR5 A;  3HMH A;  1WUG A;  5FE0 A;  3MQM A;  2RNX A;  5DKD A;  4Z6H A;  5FE5 A;  5LKU A;  4ZC9 A;  4CL9 A;  3U5K A;  5FFV A;  4QUT A;  4PS5 A;  5FG6 A;  3JVK A;  5KHM A;  4NR6 A;  5FE2 A;  4YH3 A;  4O70 A;  5E9K A;  5F60 A;  3FKM X;  4AKN A;  4N4I A;  3UV4 A;  5D3J A;  4NR4 A;  5F25 A;  3LQJ A;  4NR8 A;  5E7D A;  2D82 A;  5ENI A;  4Y03 A;  2DVV A;  4XY8 A;  5LJ1 A;  3HMF A;  4CUS A;  5EM3 A;  4CFL A;  5IBN A;  4NYW A;  4QEU A;  4YAT A;  4PY6 A;  5HRV A;  5CUA A;  5H1V A;  4N4F A;  4YYD A;  5HQ6 A;  5D25 A;  5FFW A;  4NR9 A;  5FG5 A;  4IOR A;  4NQM A;  5BT4 A;  4YH4 A;  2H60 A;  2DVR A;  5CUD A;  5E3D A;  5C8G A;  5HFR A;  3ONI A;  5IGK A;  3MUK A;  4O7F A;  5CGP A;  3P1E A;  2E7N A;  3DWY A;  3MB3 A;  4BW3 A;  3P5O A;  5LVR A;  3O34 A;  3IU6 A;  5FE4 A;  4C67 A;  5FE1 A;  4O71 A;  5CQT A;  3Q2F A;  3UW9 A;  5EWC A;  5CQ5 A;  1WUM A;  5D7X A;  4HBY A;  4LZ2 A;  4QSS A;  5L99 A;  4Q0N A;  4IR6 A;  4MR4 A;  4YAB A;  4BW2 A;  3GG3 A;  4TT2 A;  5HLS A;  4HBX A;  4QR5 A;  4QSR A;  5D3T A;  5C4Q A;  3UVX A;  3AAD A;  4HXN A;  5FH6 A;  2OO1 A;  4O7A A;  2R0Y A;  3P1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...