4MR6A

Crystal structure of the second bromodomain of human brd2 in complex with a quinazolinone ligand (rvx-208)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title RVX-208, an inhibitor of BET transcriptional regulators with selectivity for the second bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4mr6A00
5D7XA 3LQHA 3Q2FA 5I89A 3UVWA 4LYSA 3AADA 2D82A 3U5JA 4UIZA 4Z6HA 4MENA 4QEVA 4NXJA 5A7CA 5I83A 5I80A 4CUSA 5I88A 2DVSA 4A9FA 4J1PA 5AMFA 4ALHA 5DW2A 4QSRA 4O71A 2YW5A 4XYAA 4QR3A 4QSVA 5CZGA 5COIA 3U5KA 3QZSA 5C8GA 4F3IA 1X0JA 5DKCA 5FE5A 5CUCA 5DLXA 2I8NA 4KV1A 4Z1QA 3MB3A 5CS8A 4O75A 5I86A 4O7AA 4ALGA 5FE2A 3LQIA 4QB3A 4IORA 5FFYA 3SVHA 4GPJA 4UYFB 5ENHA 5LKXA 5E3DA 3SVGA 5LKZA 4IR5A 3MQMA 5H1UA 1WUGA 5HFQA 5TB6A 5I29A 5DYAA 5LJ0A 4QSPA 5HQ7A 5LVRA 4UIXA 4MR3A 4NR7A 3UV4A 4J3IA 4XY9A 4IOOA 4BW1A 5D3TA 4NR9A 5FBXA 4NYWA 4LYIA 4HXSA 4O70A 4CUUA 4QUTA 5C7NA 3O33A 4CUTA 5CPEA 2E3KA 3U5NA 4TU6A 4HXOA 4QSXA 4HXKA 4N4IA 3S92A 5EGUA 2DKWA 5CQ3A 5EP7A 5BT3A 2F6NA 5IGMA 5FE6A 5C89A 5D3HA 5IGLA 5D3JA 5H1VA 5F5ZA 3AQAA 4FLPA 2I7KA 5D25A 4LC2A 3P1FA 5L98A 4DONA 4TYLA 5AMEA 5DYUA 3HMEA 4Q0OA 5LKUA 4NR6A 5H1TA 5I40A 2YEMA 2OO1A 5JWMA 1JM4B 5HENA 5F3AA 4NS5A 5DYCA 5IG6A 5F1LA 5L96A 5EI4A 5F2PA 1ZS5A 5CQ4A 5EWWA 5EV9A 5A5RA 3O36A 5KTXA 2R0VA 5CQ7A 5EWCA 4J0RA 4PCIA 4XY8A 5F61A 3JVKA 5CUEA 4IR4A 4NR4A 5ETBA 3LJWA 4BW3A 4QBMA 2OSSA 5IBNA 5A5PA 5C85A 4UYDA 4ZC9A 2RI7A 4N4GA 5CUAA 4RVRA 5AD2A 4HXRA 5FE0A 4YAXA 4YYIA 5L97A 5IGKA 5HJCA 4NUEA 5EK9A 5EM3A 3HMHA 3NXBA 4UIYA 5G4RA 3Q2EA 4UYFA 5IIDA 3O37A 3JVJA 5D26A 5LJ2A 4YY4A 4QR5A 3DWYA 5DYXA 2H60A 4Z6IA 4O7BA 5HQ6A 4PKLA 4MEPA 3G0JA 4A9NA 4A9LA 5DFCA 4Z93A 3UV2A 4OGIA 1WUMA 1JSPB 2RFJA 4QYLA 5D3PA 4A9JA 4N4FA 3MULA 5L8TA 5FG5A 4IR3A 4YK0A 2WP1A 5HFRA 4TU4A 3D7CA 4A9EA 2RNYA 4NRCA 4BW2A 5A5OA 4OGJA 5DX4A 5BT4A 5C4QA 4LRGA 5E9VA 3UVXA 2YQDA 3U5PA 5LJ1A 4BHWA 5A83A 3U5MA 2N9GA 4A9HA 4YYDA 5EPRA 3MXFA 5CGPA 5CU8A 4J0SA 4UITA 5KTWA 4QYDA 5FB0A 5EU1A 5EICA 5HELA 5E9MA 2WP2A 4HXPA 5FE1A 5HCLA 3O34A 5HRWA 5F63A 2YEKA 2YDWA 4NYXA 4BJXA 3DAIA 4A9OA 2L5EA 5FE4A 4LZSA 1EQFA 4KV4A 4TT4A 4YYMA 5CTLA 4O76A 5CRMA 4YYJA 4YADA 4TT2A 2MJVB 5CUGA 4O7CA 2L84A 4QSQA 2DATA 4NQMA 4KCXA 5DKHA 4LZRA 5ENGA 5D3SA 5I7XA 5CFWA 5A5QA 4WHUA 4WIVA 5HRVA 4YBSA 5DBMA 4QSUA 4LYWA 4LR6A 4N4HA 4NRAA 4Z1SA 4MR5A 2F6JA 5DFDA 5ETDA 5EVAA 5EWVA 5II1A 4OUFA 5A82A 2RO1A 4QY4A 5FH8A 5I7YA 5F1HA 2RNXA 4XUBA 5KTUA 5HRXA 2RNWA 5EQ1A 4CFKA 4TS8A 2E7NA 5E9LA 5A5SA 5A5NA 3UVYA 4YH3A 5DFBA 4HXMA 3U5LA 2NXBA 4YYNA 5DW1A 4NUCA 2YELA 3MB4A 4PTBA 4O7EA 5EISA 5ENCA 5F36A 3P1DA 5D3RA 4YYKA 4E96A 5E74A 5TCMA 2DVQA 3K2JA 4MR4A 2E7OA 3JVMA 4NRBA 4NR5A 4QC1A 3GG3A 5FFVA 4QUUA 5FE3A 5DLZA 2DVVA 2DWWA 4UYHA 4O78A 5D24A 5G4SA 5HM0A 5H85A 5CUBA 4Y03A 5LKTA 4QZSA 4QC3A 5E3GA 4HBVA 5KHMA 3HMFA 3RCWA 5J0DA 4YATA 3G0LA 5CP5A 5IGNA 4HXNA 3LXJA 5F60A 5F62A 5EPSA 5KO4A 5EA1A 3LQJA 5BT5A 2OUOA 4C66A 5HQ5A 4A9KA 4UIUA 1E6IA 5CUDA 4ZW1A 4YYHA 3ZYUA 2LSPB 4C67A 5DY7A 4UYEA 5EWHA 4YYGA 3IU5A 4TTEA 5FE7A 4QEWA 5FH7A 4LDFA 5L8UA 5DKDA 3U5OA 5CQ6A 4UYGA 4MR6A 5ENJA 4TT6A 4CL9A 5HLSA 5D3LA 5CQAA 4PS5A 3P1EA 5FE9A 3UVDA 5ENBA 5D0CA 4HXLA 5ENIA 5F25A 2R0YA 5FDZA 4O77A 5A85A 2DVRA 4CURA 5FB1A 1N72A 5FG6A 5L99A 4A9MA 4YBTA 3UW9A 4HBYA 4O74A 3QZVA 3JVLA 4CFLA 2YYNA 5CQ8A 4X2IA 4MEQA 4A9IA 5FH6A 4NQNA 4YY6A 2GRCA 4YC9A 4QSTA 5AD3A 4O7FA 4CUPA 2R0SA 4TZ2A 5E0RA 5FFWA 5C87A 4PY6A 3P1CA 3SVFA 4YBMA 5LUUA 4HBXA 3P5OA 2KTBB 5I1QA 1F68A 3IU6A 3QZTA 2FSAA 3ONIA 4TQNA 3TLPA 5E9KA 4NR8A 5CY9A 4QSWA 4HBWA 4YH4A 4TZ8A 5E9YA 4O72A 4AKNA 5ENEA 3FKMX 2G4AA 5KU3A 4UIWA 4QSSA 5FE8A 2RS9B 4IOQA 2R10A 4QEUA 4CUQA 5EPBA 4Q0NA 5HEMA 3MUKA 4CLBA 4QNSA 4YABA 4PCEA 2L85A 5CQ5A 4NYVA 5JI8A 5E7DA 5FG4A 4UIVA 4BW4A 5E73A 5E9IA 5LVQA 2D9EA 4XUAA 3O35A 4WHWA 5EWDA 4N3WA 5ACYA 5CQTA 5D3NA 5CRZA 5K29A 5A81A 3S91A 4NUDA 3UV5A 5II2A 4LZ2A 4IR6A 4ZQLA 3I3JA 4QR4A 4MEOA 5ENFA
chains in the Genus database with same CATH superfamily
3D1DA 3LQHA 5D7XA 3Q2FA 5I89A 3UVWA 4LYSA 3AADA 2D82A 3U5JA 4UIZA 4Z6HA 4MENA 4QEVA 4NXJA 5A7CA 5I83A 5I80A 4CUSA 5I88A 2DVSA 4A9FA 4J1PA 5AMFA 4ALHA 5DW2A 4QSRA 4O71A 2YW5A 4XYAA 4QR3A 4QSVA 5CZGA 5COIA 3U5KA 3QZSA 5C8GA 4F3IA 1X0JA 5DKCA 5FE5A 5CUCA 5DLXA 2I8NA 3ERRA 4KV1A 4Z1QA 3MB3A 5CS8A 4O75A 5I86A 4O7AA 4ALGA 5FE2A 3LQIA 4QB3A 4IORA 5FFYA 3SVHA 4GPJA 4UYFB 5ENHA 5LKXA 5E3DA 3SVGA 5LKZA 4IR5A 3MQMA 5H1UA 1WUGA 5HFQA 5TB6A 5I29A 5DYAA 5LJ0A 4QSPA 5HQ7A 5LVRA 4UIXA 4MR3A 4NR7A 3UV4A 4J3IA 4XY9A 4IOOA 4BW1A 5D3TA 4NR9A 5FBXA 4NYWA 4LYIA 4AKGA 4HXSA 4O70A 4CUUA 4QUTA 5C7NA 3O33A 4CUTA 5CPEA 2E3KA 3U5NA 4TU6A 4HXOA 4QSXA 4HXKA 4N4IA 3S92A 5EGUA 2DKWA 5CQ3A 5EP7A 5BT3A 3D1BA 2F6NA 5IGMA 5FE6A 5C89A 5D3HA 5IGLA 5D3JA 5H1VA 5F5ZA 3AQAA 4FLPA 2I7KA 5D25A 4LC2A 3P1FA 5L98A 4DONA 4TYLA 5AMEA 5DYUA 3HMEA 4Q0OA 5LKUA 4NR6A 5H1TA 5I40A 2YEMA 2OO1A 5JWMA 1JM4B 5HENA 5F3AA 4NS5A 5DYCA 5IG6A 5F1LA 5L96A 5EI4A 5F2PA 1ZS5A 5CQ4A 5EWWA 5EV9A 5A5RA 3O36A 5KTXA 2R0VA 5CQ7A 5EWCA 4J0RA 4PCIA 4XY8A 5F61A 3JVKA 5CUEA 4IR4A 4NR4A 5ETBA 3LJWA 4BW3A 4QBMA 2OSSA 5IBNA 5A5PA 5C85A 4UYDA 4ZC9A 2RI7A 4N4GA 5CUAA 4RVRA 5AD2A 4HXRA 5FE0A 4YAXA 4YYIA 5L97A 5IGKA 5HJCA 4NUEA 5EK9A 5EM3A 3HMHA 3NXBA 4UIYA 5G4RA 3Q2EA 4UYFA 5IIDA 3O37A 3JVJA 5D26A 5LJ2A 4YY4A 4QR5A 3DWYA 5DYXA 2H60A 4Z6IA 4O7BA 5HQ6A 4PKLA 4MEPA 3G0JA 4A9NA 4A9LA 5DFCA 4Z93A 3UV2A 4OGIA 1WUMA 1JSPB 2RFJA 4QYLA 5D3PA 4A9JA 4N4FA 3MULA 5L8TA 5FG5A 4IR3A 4YK0A 2WP1A 5HFRA 4TU4A 3D7CA 4A9EA 2RNYA 4NRCA 4BW2A 5A5OA 4OGJA 5DX4A 5BT4A 5C4QA 4LRGA 5E9VA 3UVXA 2YQDA 3U5PA 5LJ1A 4BHWA 5A83A 3U5MA 2N9GA 4A9HA 4YYDA 5EPRA 3MXFA 5CGPA 5CU8A 4J0SA 4UITA 5KTWA 4QYDA 5FB0A 5EU1A 5EICA 5HELA 5E9MA 2WP2A 4HXPA 5FE1A 5HCLA 3O34A 5HRWA 5F63A 2YEKA 2YDWA 4NYXA 4BJXA 3DAIA 4A9OA 2L5EA 5FE4A 4LZSA 1EQFA 4KV4A 4TT4A 4YYMA 5CTLA 1PUOA 4O76A 5CRMA 4YYJA 3VKGA 4YADA 4TT2A 2MJVB 5CUGA 4O7CA 2L84A 4QSQA 2DATA 4NQMA 4KCXA 5DKHA 4LZRA 5ENGA 5D3SA 5I7XA 5CFWA 5A5QA 4WHUA 4AKIA 4WIVA 5HRVA 4YBSA 5DBMA 4QSUA 4LYWA 4LR6A 4N4HA 4NRAA 4Z1SA 4MR5A 2F6JA 5DFDA 5ETDA 5EVAA 5EWVA 5II1A 4OUFA 5A82A 2RO1A 4QY4A 5FH8A 5I7YA 5F1HA 2RNXA 4XUBA 5KTUA 5HRXA 2RNWA 5EQ1A 4CFKA 4TS8A 2E7NA 5E9LA 5A5SA 5A5NA 3UVYA 4YH3A 5DFBA 4HXMA 3U5LA 2NXBA 4YYNA 5DW1A 4NUCA 2YELA 3MB4A 4PTBA 4O7EA 5EISA 5ENCA 5F36A 3P1DA 5D3RA 4YYKA 4E96A 5E74A 5TCMA 2DVQA 3K2JA 4MR4A 2E7OA 3JVMA 4NRBA 4NR5A 4QC1A 3GG3A 5FFVA 4QUUA 5FE3A 1ZKRA 5DLZA 2DVVA 2DWWA 4UYHA 4O78A 5D24A 5G4SA 5HM0A 5H85A 4AKHA 5CUBA 4Y03A 5LKTA 4QZSA 4QC3A 5E3GA 2EJNA 4HBVA 5KHMA 3HMFA 3RCWA 5J0DA 3VKHA 4YATA 3G0LA 5CP5A 5IGNA 4HXNA 3LXJA 5F60A 5F62A 5EPSA 5KO4A 5EA1A 3LQJA 5BT5A 2OUOA 4C66A 5HQ5A 4A9KA 4UIUA 1E6IA 5CUDA 4ZW1A 4YYHA 3ZYUA 2LSPB 4C67A 5DY7A 4UYEA 5EWHA 4YYGA 3IU5A 4TTEA 5FE7A 4QEWA 5FH7A 4LDFA 5L8UA 5DKDA 3U5OA 5CQ6A 4UYGA 4MR6A 5ENJA 4TT6A 4CL9A 5HLSA 5D3LA 5CQAA 4PS5A 3P1EA 5FE9A 3UVDA 5ENBA 5D0CA 4HXLA 5ENIA 5F25A 2R0YA 5FDZA 4O77A 5A85A 2DVRA 4CURA 5FB1A 4AI6A 1N72A 5FG6A 5L99A 4A9MA 4YBTA 3UW9A 4HBYA 4O74A 3QZVA 3JVLA 4CFLA 2YYNA 5CQ8A 4X2IA 4MEQA 4A9IA 5FH6A 4NQNA 4YY6A 2GRCA 4YC9A 4QSTA 5AD3A 4O7FA 4CUPA 2R0SA 4TZ2A 5E0RA 5FFWA 5C87A 4PY6A 3P1CA 3SVFA 4YBMA 5LUUA 4HBXA 3P5OA 2KTBB 5I1QA 1F68A 3IU6A 3QZTA 2FSAA 3ONIA 4TQNA 3TLPA 5E9KA 4NR8A 5CY9A 4QSWA 4HBWA 4YH4A 4TZ8A 5E9YA 4O72A 4AKNA 5ENEA 3FKMX 2G4AA 5KU3A 4UIWA 4QSSA 5FE8A 2RS9B 4IOQA 2R10A 4QEUA 4CUQA 5EPBA 4Q0NA 5HEMA 3MUKA 4CLBA 4QNSA 4YABA 4PCEA 2L85A 5CQ5A 4NYVA 5JI8A 5E7DA 5FG4A 4UIVA 4BW4A 5E73A 5E9IA 5LVQA 2D9EA 4XUAA 3O35A 4WHWA 5EWDA 4N3WA 5ACYA 5CQTA 5D3NA 5CRZA 5K29A 5A81A 3S91A 4NUDA 3UV5A 5II2A 4LZ2A 4IR6A 4ZQLA 3I3JA 4QR4A 4MEOA 5ENFA
chains in the Genus database with same CATH topology
5D7XA 3LQHA 3Q2FA 5I89A 3UVWA 4LYSA 3AADA 2D82A 3U5JA 4UIZA 4Z6HA 4MENA 4QEVA 4NXJA 5A7CA 5I83A 5I80A 4CUSA 5I88A 2DVSA 4A9FA 4J1PA 5AMFA 4ALHA 5DW2A 4QSRA 4O71A 2YW5A 4XYAA 4QR3A 4QSVA 5CZGA 5COIA 3U5KA 3QZSA 5C8GA 4F3IA 1X0JA 5DKCA 5FE5A 5CUCA 5DLXA 2I8NA 4KV1A 4Z1QA 3MB3A 5CS8A 4O75A 5I86A 4O7AA 4ALGA 5FE2A 3LQIA 4QB3A 4IORA 5FFYA 3SVHA 4GPJA 4UYFB 5ENHA 5LKXA 5E3DA 3SVGA 5LKZA 4IR5A 3MQMA 5H1UA 1WUGA 5HFQA 5TB6A 5I29A 5DYAA 5LJ0A 4QSPA 5HQ7A 5LVRA 4UIXA 4MR3A 4NR7A 3UV4A 4J3IA 4XY9A 4IOOA 4BW1A 5D3TA 4NR9A 5FBXA 4NYWA 4LYIA 4HXSA 4O70A 4CUUA 4QUTA 5C7NA 3O33A 4CUTA 5CPEA 2E3KA 3U5NA 4TU6A 4HXOA 4QSXA 4HXKA 4N4IA 3S92A 5EGUA 2DKWA 5CQ3A 5EP7A 5BT3A 2F6NA 5IGMA 5FE6A 5C89A 5D3HA 5IGLA 5D3JA 5H1VA 5F5ZA 3AQAA 4FLPA 2I7KA 5D25A 4LC2A 3P1FA 5L98A 4DONA 4TYLA 5AMEA 5DYUA 3HMEA 4Q0OA 5LKUA 4NR6A 5H1TA 5I40A 2YEMA 2OO1A 5JWMA 1JM4B 5HENA 5F3AA 4NS5A 5DYCA 5IG6A 5F1LA 5L96A 5EI4A 5F2PA 1ZS5A 5CQ4A 5EWWA 5EV9A 5A5RA 3O36A 5KTXA 2R0VA 5CQ7A 5EWCA 4J0RA 4PCIA 4XY8A 5F61A 3JVKA 5CUEA 4IR4A 4NR4A 5ETBA 3LJWA 4BW3A 4QBMA 2OSSA 5IBNA 5A5PA 5C85A 4UYDA 4ZC9A 2RI7A 4N4GA 5CUAA 4RVRA 5AD2A 4HXRA 5FE0A 4YAXA 4YYIA 5L97A 5IGKA 5HJCA 4NUEA 5EK9A 5EM3A 3HMHA 3NXBA 4UIYA 5G4RA 3Q2EA 4UYFA 5IIDA 3O37A 3JVJA 5D26A 5LJ2A 4YY4A 4QR5A 3DWYA 5DYXA 2H60A 4Z6IA 4O7BA 5HQ6A 4PKLA 4MEPA 3G0JA 4A9NA 4A9LA 5DFCA 4Z93A 3UV2A 4OGIA 1WUMA 1JSPB 2RFJA 4QYLA 5D3PA 4A9JA 4N4FA 3MULA 5L8TA 5FG5A 4IR3A 4YK0A 2WP1A 5HFRA 4TU4A 3D7CA 4A9EA 2RNYA 4NRCA 4BW2A 5A5OA 4OGJA 5DX4A 5BT4A 5C4QA 4LRGA 5E9VA 3UVXA 2YQDA 3U5PA 5LJ1A 4BHWA 5A83A 3U5MA 2N9GA 4A9HA 4YYDA 5EPRA 3MXFA 5CGPA 5CU8A 4J0SA 4UITA 5KTWA 4QYDA 5FB0A 5EU1A 5EICA 5HELA 5E9MA 2WP2A 4HXPA 5FE1A 5HCLA 3O34A 5HRWA 5F63A 2YEKA 2YDWA 4NYXA 4BJXA 3DAIA 4A9OA 2L5EA 5FE4A 4LZSA 1EQFA 4KV4A 4TT4A 4YYMA 5CTLA 4O76A 5CRMA 4YYJA 4YADA 4TT2A 2MJVB 5CUGA 4O7CA 2L84A 4QSQA 2DATA 4NQMA 4KCXA 5DKHA 4LZRA 5ENGA 5D3SA 5I7XA 5CFWA 5A5QA 4WHUA 4WIVA 5HRVA 4YBSA 5DBMA 4QSUA 4LYWA 4LR6A 4N4HA 4NRAA 4Z1SA 4MR5A 2F6JA 5DFDA 5ETDA 5EVAA 5EWVA 5II1A 4OUFA 5A82A 2RO1A 4QY4A 5FH8A 5I7YA 5F1HA 2RNXA 4XUBA 5KTUA 5HRXA 2RNWA 5EQ1A 4CFKA 4TS8A 2E7NA 5E9LA 5A5SA 5A5NA 3UVYA 4YH3A 5DFBA 4HXMA 3U5LA 2NXBA 4YYNA 5DW1A 4NUCA 2YELA 3MB4A 4PTBA 4O7EA 5EISA 5ENCA 5F36A 3P1DA 5D3RA 4YYKA 4E96A 5E74A 5TCMA 2DVQA 3K2JA 4MR4A 2E7OA 3JVMA 4NRBA 4NR5A 4QC1A 3GG3A 5FFVA 4QUUA 5FE3A 5DLZA 2DVVA 2DWWA 4UYHA 4O78A 5D24A 5G4SA 5HM0A 5H85A 5CUBA 4Y03A 5LKTA 4QZSA 4QC3A 5E3GA 4HBVA 5KHMA 3HMFA 3RCWA 5J0DA 4YATA 3G0LA 5CP5A 5IGNA 4HXNA 3LXJA 5F60A 5F62A 5EPSA 5KO4A 5EA1A 3LQJA 5BT5A 2OUOA 4C66A 5HQ5A 4A9KA 4UIUA 1E6IA 5CUDA 4ZW1A 4YYHA 3ZYUA 2LSPB 4C67A 5DY7A 4UYEA 5EWHA 4YYGA 3IU5A 4TTEA 5FE7A 4QEWA 5FH7A 4LDFA 5L8UA 5DKDA 3U5OA 5CQ6A 4UYGA 4MR6A 5ENJA 4TT6A 4CL9A 5HLSA 5D3LA 5CQAA 4PS5A 3P1EA 5FE9A 3UVDA 5ENBA 5D0CA 4HXLA 5ENIA 5F25A 2R0YA 5FDZA 4O77A 5A85A 2DVRA 4CURA 5FB1A 1N72A 5FG6A 5L99A 4A9MA 4YBTA 3UW9A 4HBYA 4O74A 3QZVA 3JVLA 4CFLA 2YYNA 5CQ8A 4X2IA 4MEQA 4A9IA 5FH6A 4NQNA 4YY6A 2GRCA 4YC9A 4QSTA 5AD3A 4O7FA 4CUPA 2R0SA 4TZ2A 5E0RA 5FFWA 5C87A 4PY6A 3P1CA 3SVFA 4YBMA 5LUUA 4HBXA 3P5OA 2KTBB 5I1QA 1F68A 3IU6A 3QZTA 2FSAA 3ONIA 4TQNA 3TLPA 5E9KA 4NR8A 5CY9A 4QSWA 4HBWA 4YH4A 4TZ8A 5E9YA 4O72A 4AKNA 5ENEA 3FKMX 2G4AA 5KU3A 4UIWA 4QSSA 5FE8A 2RS9B 4IOQA 2R10A 4QEUA 4CUQA 5EPBA 4Q0NA 5HEMA 3MUKA 4CLBA 4QNSA 4YABA 4PCEA 2L85A 5CQ5A 4NYVA 5JI8A 5E7DA 5FG4A 4UIVA 4BW4A 5E73A 5E9IA 5LVQA 2D9EA 4XUAA 3O35A 4WHWA 5EWDA 4N3WA 5ACYA 5CQTA 5D3NA 5CRZA 5K29A 5A81A 3S91A 4NUDA 3UV5A 5II2A 4LZ2A 4IR6A 4ZQLA 3I3JA 4QR4A 4MEOA 5ENFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7X A;  3LQH A;  3Q2F A;  5I89 A;  3UVW A;  4LYS A;  3AAD A;  2D82 A;  3U5J A;  4UIZ A;  4Z6H A;  4MEN A;  4QEV A;  4NXJ A;  5A7C A;  5I83 A;  5I80 A;  4CUS A;  5I88 A;  2DVS A;  4A9F A;  4J1P A;  5AMF A;  4ALH A;  5DW2 A;  4QSR A;  4O71 A;  2YW5 A;  4XYA A;  4QR3 A;  4QSV A;  5CZG A;  5COI A;  3U5K A;  3QZS A;  5C8G A;  4F3I A;  1X0J A;  5DKC A;  5FE5 A;  5CUC A;  5DLX A;  2I8N A;  4KV1 A;  4Z1Q A;  3MB3 A;  5CS8 A;  4O75 A;  5I86 A;  4O7A A;  4ALG A;  5FE2 A;  3LQI A;  4QB3 A;  4IOR A;  5FFY A;  3SVH A;  4GPJ A;  4UYF B;  5ENH A;  5LKX A;  5E3D A;  3SVG A;  5LKZ A;  4IR5 A;  3MQM A;  5H1U A;  1WUG A;  5HFQ A;  5TB6 A;  5I29 A;  5DYA A;  5LJ0 A;  4QSP A;  5HQ7 A;  5LVR A;  4UIX A;  4MR3 A;  4NR7 A;  3UV4 A;  4J3I A;  4XY9 A;  4IOO A;  4BW1 A;  5D3T A;  4NR9 A;  5FBX A;  4NYW A;  4LYI A;  4HXS A;  4O70 A;  4CUU A;  4QUT A;  5C7N A;  3O33 A;  4CUT A;  5CPE A;  2E3K A;  3U5N A;  4TU6 A;  4HXO A;  4QSX A;  4HXK A;  4N4I A;  3S92 A;  5EGU A;  2DKW A;  5CQ3 A;  5EP7 A;  5BT3 A;  2F6N A;  5IGM A;  5FE6 A;  5C89 A;  5D3H A;  5IGL A;  5D3J A;  5H1V A;  5F5Z A;  3AQA A;  4FLP A;  2I7K A;  5D25 A;  4LC2 A;  3P1F A;  5L98 A;  4DON A;  4TYL A;  5AME A;  5DYU A;  3HME A;  4Q0O A;  5LKU A;  4NR6 A;  5H1T A;  5I40 A;  2YEM A;  2OO1 A;  5JWM A;  1JM4 B;  5HEN A;  5F3A A;  4NS5 A;  5DYC A;  5IG6 A;  5F1L A;  5L96 A;  5EI4 A;  5F2P A;  1ZS5 A;  5CQ4 A;  5EWW A;  5EV9 A;  5A5R A;  3O36 A;  5KTX A;  2R0V A;  5CQ7 A;  5EWC A;  4J0R A;  4PCI A;  4XY8 A;  5F61 A;  3JVK A;  5CUE A;  4IR4 A;  4NR4 A;  5ETB A;  3LJW A;  4BW3 A;  4QBM A;  2OSS A;  5IBN A;  5A5P A;  5C85 A;  4UYD A;  4ZC9 A;  2RI7 A;  4N4G A;  5CUA A;  4RVR A;  5AD2 A;  4HXR A;  5FE0 A;  4YAX A;  4YYI A;  5L97 A;  5IGK A;  5HJC A;  4NUE A;  5EK9 A;  5EM3 A;  3HMH A;  3NXB A;  4UIY A;  5G4R A;  3Q2E A;  4UYF A;  5IID A;  3O37 A;  3JVJ A;  5D26 A;  5LJ2 A;  4YY4 A;  4QR5 A;  3DWY A;  5DYX A;  2H60 A;  4Z6I A;  4O7B A;  5HQ6 A;  4PKL A;  4MEP A;  3G0J A;  4A9N A;  4A9L A;  5DFC A;  4Z93 A;  3UV2 A;  4OGI A;  1WUM A;  1JSP B;  2RFJ A;  4QYL A;  5D3P A;  4A9J A;  4N4F A;  3MUL A;  5L8T A;  5FG5 A;  4IR3 A;  4YK0 A;  2WP1 A;  5HFR A;  4TU4 A;  3D7C A;  4A9E A;  2RNY A;  4NRC A;  4BW2 A;  5A5O A;  4OGJ A;  5DX4 A;  5BT4 A;  5C4Q A;  4LRG A;  5E9V A;  3UVX A;  2YQD A;  3U5P A;  5LJ1 A;  4BHW A;  5A83 A;  3U5M A;  2N9G A;  4A9H A;  4YYD A;  5EPR A;  3MXF A;  5CGP A;  5CU8 A;  4J0S A;  4UIT A;  5KTW A;  4QYD A;  5FB0 A;  5EU1 A;  5EIC A;  5HEL A;  5E9M A;  2WP2 A;  4HXP A;  5FE1 A;  5HCL A;  3O34 A;  5HRW A;  5F63 A;  2YEK A;  2YDW A;  4NYX A;  4BJX A;  3DAI A;  4A9O A;  2L5E A;  5FE4 A;  4LZS A;  1EQF A;  4KV4 A;  4TT4 A;  4YYM A;  5CTL A;  4O76 A;  5CRM A;  4YYJ A;  4YAD A;  4TT2 A;  2MJV B;  5CUG A;  4O7C A;  2L84 A;  4QSQ A;  2DAT A;  4NQM A;  4KCX A;  5DKH A;  4LZR A;  5ENG A;  5D3S A;  5I7X A;  5CFW A;  5A5Q A;  4WHU A;  4WIV A;  5HRV A;  4YBS A;  5DBM A;  4QSU A;  4LYW A;  4LR6 A;  4N4H A;  4NRA A;  4Z1S A;  4MR5 A;  2F6J A;  5DFD A;  5ETD A;  5EVA A;  5EWV A;  5II1 A;  4OUF A;  5A82 A;  2RO1 A;  4QY4 A;  5FH8 A;  5I7Y A;  5F1H A;  2RNX A;  4XUB A;  5KTU A;  5HRX A;  2RNW A;  5EQ1 A;  4CFK A;  4TS8 A;  2E7N A;  5E9L A;  5A5S A;  5A5N A;  3UVY A;  4YH3 A;  5DFB A;  4HXM A;  3U5L A;  2NXB A;  4YYN A;  5DW1 A;  4NUC A;  2YEL A;  3MB4 A;  4PTB A;  4O7E A;  5EIS A;  5ENC A;  5F36 A;  3P1D A;  5D3R A;  4YYK A;  4E96 A;  5E74 A;  5TCM A;  2DVQ A;  3K2J A;  4MR4 A;  2E7O A;  3JVM A;  4NRB A;  4NR5 A;  4QC1 A;  3GG3 A;  5FFV A;  4QUU A;  5FE3 A;  5DLZ A;  2DVV A;  2DWW A;  4UYH A;  4O78 A;  5D24 A;  5G4S A;  5HM0 A;  5H85 A;  5CUB A;  4Y03 A;  5LKT A;  4QZS A;  4QC3 A;  5E3G A;  4HBV A;  5KHM A;  3HMF A;  3RCW A;  5J0D A;  4YAT A;  3G0L A;  5CP5 A;  5IGN A;  4HXN A;  3LXJ A;  5F60 A;  5F62 A;  5EPS A;  5KO4 A;  5EA1 A;  3LQJ A;  5BT5 A;  2OUO A;  4C66 A;  5HQ5 A;  4A9K A;  4UIU A;  1E6I A;  5CUD A;  4ZW1 A;  4YYH A;  3ZYU A;  2LSP B;  4C67 A;  5DY7 A;  4UYE A;  5EWH A;  4YYG A;  3IU5 A;  4TTE A;  5FE7 A;  4QEW A;  5FH7 A;  4LDF A;  5L8U A;  5DKD A;  3U5O A;  5CQ6 A;  4UYG A;  4MR6 A;  5ENJ A;  4TT6 A;  4CL9 A;  5HLS A;  5D3L A;  5CQA A;  4PS5 A;  3P1E A;  5FE9 A;  3UVD A;  5ENB A;  5D0C A;  4HXL A;  5ENI A;  5F25 A;  2R0Y A;  5FDZ A;  4O77 A;  5A85 A;  2DVR A;  4CUR A;  5FB1 A;  1N72 A;  5FG6 A;  5L99 A;  4A9M A;  4YBT A;  3UW9 A;  4HBY A;  4O74 A;  3QZV A;  3JVL A;  4CFL A;  2YYN A;  5CQ8 A;  4X2I A;  4MEQ A;  4A9I A;  5FH6 A;  4NQN A;  4YY6 A;  2GRC A;  4YC9 A;  4QST A;  5AD3 A;  4O7F A;  4CUP A;  2R0S A;  4TZ2 A;  5E0R A;  5FFW A;  5C87 A;  4PY6 A;  3P1C A;  3SVF A;  4YBM A;  5LUU A;  4HBX A;  3P5O A;  2KTB B;  5I1Q A;  1F68 A;  3IU6 A;  3QZT A;  2FSA A;  3ONI A;  4TQN A;  3TLP A;  5E9K A;  4NR8 A;  5CY9 A;  4QSW A;  4HBW A;  4YH4 A;  4TZ8 A;  5E9Y A;  4O72 A;  4AKN A;  5ENE A;  3FKM X;  2G4A A;  5KU3 A;  4UIW A;  4QSS A;  5FE8 A;  2RS9 B;  4IOQ A;  2R10 A;  4QEU A;  4CUQ A;  5EPB A;  4Q0N A;  5HEM A;  3MUK A;  4CLB A;  4QNS A;  4YAB A;  4PCE A;  2L85 A;  5CQ5 A;  4NYV A;  5JI8 A;  5E7D A;  5FG4 A;  4UIV A;  4BW4 A;  5E73 A;  5E9I A;  5LVQ A;  2D9E A;  4XUA A;  3O35 A;  4WHW A;  5EWD A;  4N3W A;  5ACY A;  5CQT A;  5D3N A;  5CRZ A;  5K29 A;  5A81 A;  3S91 A;  4NUD A;  3UV5 A;  5II2 A;  4LZ2 A;  4IR6 A;  4ZQL A;  3I3J A;  4QR4 A;  4MEO A;  5ENF A; 
#chains in the Genus database with same CATH topology
 3D1D A;  3LQH A;  5D7X A;  3Q2F A;  5I89 A;  3UVW A;  4LYS A;  3AAD A;  2D82 A;  3U5J A;  4UIZ A;  4Z6H A;  4MEN A;  4QEV A;  4NXJ A;  5A7C A;  5I83 A;  5I80 A;  4CUS A;  5I88 A;  2DVS A;  4A9F A;  4J1P A;  5AMF A;  4ALH A;  5DW2 A;  4QSR A;  4O71 A;  2YW5 A;  4XYA A;  4QR3 A;  4QSV A;  5CZG A;  5COI A;  3U5K A;  3QZS A;  5C8G A;  4F3I A;  1X0J A;  5DKC A;  5FE5 A;  5CUC A;  5DLX A;  2I8N A;  3ERR A;  4KV1 A;  4Z1Q A;  3MB3 A;  5CS8 A;  4O75 A;  5I86 A;  4O7A A;  4ALG A;  5FE2 A;  3LQI A;  4QB3 A;  4IOR A;  5FFY A;  3SVH A;  4GPJ A;  4UYF B;  5ENH A;  5LKX A;  5E3D A;  3SVG A;  5LKZ A;  4IR5 A;  3MQM A;  5H1U A;  1WUG A;  5HFQ A;  5TB6 A;  5I29 A;  5DYA A;  5LJ0 A;  4QSP A;  5HQ7 A;  5LVR A;  4UIX A;  4MR3 A;  4NR7 A;  3UV4 A;  4J3I A;  4XY9 A;  4IOO A;  4BW1 A;  5D3T A;  4NR9 A;  5FBX A;  4NYW A;  4LYI A;  4AKG A;  4HXS A;  4O70 A;  4CUU A;  4QUT A;  5C7N A;  3O33 A;  4CUT A;  5CPE A;  2E3K A;  3U5N A;  4TU6 A;  4HXO A;  4QSX A;  4HXK A;  4N4I A;  3S92 A;  5EGU A;  2DKW A;  5CQ3 A;  5EP7 A;  5BT3 A;  3D1B A;  2F6N A;  5IGM A;  5FE6 A;  5C89 A;  5D3H A;  5IGL A;  5D3J A;  5H1V A;  5F5Z A;  3AQA A;  4FLP A;  2I7K A;  5D25 A;  4LC2 A;  3P1F A;  5L98 A;  4DON A;  4TYL A;  5AME A;  5DYU A;  3HME A;  4Q0O A;  5LKU A;  4NR6 A;  5H1T A;  5I40 A;  2YEM A;  2OO1 A;  5JWM A;  1JM4 B;  5HEN A;  5F3A A;  4NS5 A;  5DYC A;  5IG6 A;  5F1L A;  5L96 A;  5EI4 A;  5F2P A;  1ZS5 A;  5CQ4 A;  5EWW A;  5EV9 A;  5A5R A;  3O36 A;  5KTX A;  2R0V A;  5CQ7 A;  5EWC A;  4J0R A;  4PCI A;  4XY8 A;  5F61 A;  3JVK A;  5CUE A;  4IR4 A;  4NR4 A;  5ETB A;  3LJW A;  4BW3 A;  4QBM A;  2OSS A;  5IBN A;  5A5P A;  5C85 A;  4UYD A;  4ZC9 A;  2RI7 A;  4N4G A;  5CUA A;  4RVR A;  5AD2 A;  4HXR A;  5FE0 A;  4YAX A;  4YYI A;  5L97 A;  5IGK A;  5HJC A;  4NUE A;  5EK9 A;  5EM3 A;  3HMH A;  3NXB A;  4UIY A;  5G4R A;  3Q2E A;  4UYF A;  5IID A;  3O37 A;  3JVJ A;  5D26 A;  5LJ2 A;  4YY4 A;  4QR5 A;  3DWY A;  5DYX A;  2H60 A;  4Z6I A;  4O7B A;  5HQ6 A;  4PKL A;  4MEP A;  3G0J A;  4A9N A;  4A9L A;  5DFC A;  4Z93 A;  3UV2 A;  4OGI A;  1WUM A;  1JSP B;  2RFJ A;  4QYL A;  5D3P A;  4A9J A;  4N4F A;  3MUL A;  5L8T A;  5FG5 A;  4IR3 A;  4YK0 A;  2WP1 A;  5HFR A;  4TU4 A;  3D7C A;  4A9E A;  2RNY A;  4NRC A;  4BW2 A;  5A5O A;  4OGJ A;  5DX4 A;  5BT4 A;  5C4Q A;  4LRG A;  5E9V A;  3UVX A;  2YQD A;  3U5P A;  5LJ1 A;  4BHW A;  5A83 A;  3U5M A;  2N9G A;  4A9H A;  4YYD A;  5EPR A;  3MXF A;  5CGP A;  5CU8 A;  4J0S A;  4UIT A;  5KTW A;  4QYD A;  5FB0 A;  5EU1 A;  5EIC A;  5HEL A;  5E9M A;  2WP2 A;  4HXP A;  5FE1 A;  5HCL A;  3O34 A;  5HRW A;  5F63 A;  2YEK A;  2YDW A;  4NYX A;  4BJX A;  3DAI A;  4A9O A;  2L5E A;  5FE4 A;  4LZS A;  1EQF A;  4KV4 A;  4TT4 A;  4YYM A;  5CTL A;  1PUO A;  4O76 A;  5CRM A;  4YYJ A;  3VKG A;  4YAD A;  4TT2 A;  2MJV B;  5CUG A;  4O7C A;  2L84 A;  4QSQ A;  2DAT A;  4NQM A;  4KCX A;  5DKH A;  4LZR A;  5ENG A;  5D3S A;  5I7X A;  5CFW A;  5A5Q A;  4WHU A;  4AKI A;  4WIV A;  5HRV A;  4YBS A;  5DBM A;  4QSU A;  4LYW A;  4LR6 A;  4N4H A;  4NRA A;  4Z1S A;  4MR5 A;  2F6J A;  5DFD A;  5ETD A;  5EVA A;  5EWV A;  5II1 A;  4OUF A;  5A82 A;  2RO1 A;  4QY4 A;  5FH8 A;  5I7Y A;  5F1H A;  2RNX A;  4XUB A;  5KTU A;  5HRX A;  2RNW A;  5EQ1 A;  4CFK A;  4TS8 A;  2E7N A;  5E9L A;  5A5S A;  5A5N A;  3UVY A;  4YH3 A;  5DFB A;  4HXM A;  3U5L A;  2NXB A;  4YYN A;  5DW1 A;  4NUC A;  2YEL A;  3MB4 A;  4PTB A;  4O7E A;  5EIS A;  5ENC A;  5F36 A;  3P1D A;  5D3R A;  4YYK A;  4E96 A;  5E74 A;  5TCM A;  2DVQ A;  3K2J A;  4MR4 A;  2E7O A;  3JVM A;  4NRB A;  4NR5 A;  4QC1 A;  3GG3 A;  5FFV A;  4QUU A;  5FE3 A;  1ZKR A;  5DLZ A;  2DVV A;  2DWW A;  4UYH A;  4O78 A;  5D24 A;  5G4S A;  5HM0 A;  5H85 A;  4AKH A;  5CUB A;  4Y03 A;  5LKT A;  4QZS A;  4QC3 A;  5E3G A;  2EJN A;  4HBV A;  5KHM A;  3HMF A;  3RCW A;  5J0D A;  3VKH A;  4YAT A;  3G0L A;  5CP5 A;  5IGN A;  4HXN A;  3LXJ A;  5F60 A;  5F62 A;  5EPS A;  5KO4 A;  5EA1 A;  3LQJ A;  5BT5 A;  2OUO A;  4C66 A;  5HQ5 A;  4A9K A;  4UIU A;  1E6I A;  5CUD A;  4ZW1 A;  4YYH A;  3ZYU A;  2LSP B;  4C67 A;  5DY7 A;  4UYE A;  5EWH A;  4YYG A;  3IU5 A;  4TTE A;  5FE7 A;  4QEW A;  5FH7 A;  4LDF A;  5L8U A;  5DKD A;  3U5O A;  5CQ6 A;  4UYG A;  4MR6 A;  5ENJ A;  4TT6 A;  4CL9 A;  5HLS A;  5D3L A;  5CQA A;  4PS5 A;  3P1E A;  5FE9 A;  3UVD A;  5ENB A;  5D0C A;  4HXL A;  5ENI A;  5F25 A;  2R0Y A;  5FDZ A;  4O77 A;  5A85 A;  2DVR A;  4CUR A;  5FB1 A;  4AI6 A;  1N72 A;  5FG6 A;  5L99 A;  4A9M A;  4YBT A;  3UW9 A;  4HBY A;  4O74 A;  3QZV A;  3JVL A;  4CFL A;  2YYN A;  5CQ8 A;  4X2I A;  4MEQ A;  4A9I A;  5FH6 A;  4NQN A;  4YY6 A;  2GRC A;  4YC9 A;  4QST A;  5AD3 A;  4O7F A;  4CUP A;  2R0S A;  4TZ2 A;  5E0R A;  5FFW A;  5C87 A;  4PY6 A;  3P1C A;  3SVF A;  4YBM A;  5LUU A;  4HBX A;  3P5O A;  2KTB B;  5I1Q A;  1F68 A;  3IU6 A;  3QZT A;  2FSA A;  3ONI A;  4TQN A;  3TLP A;  5E9K A;  4NR8 A;  5CY9 A;  4QSW A;  4HBW A;  4YH4 A;  4TZ8 A;  5E9Y A;  4O72 A;  4AKN A;  5ENE A;  3FKM X;  2G4A A;  5KU3 A;  4UIW A;  4QSS A;  5FE8 A;  2RS9 B;  4IOQ A;  2R10 A;  4QEU A;  4CUQ A;  5EPB A;  4Q0N A;  5HEM A;  3MUK A;  4CLB A;  4QNS A;  4YAB A;  4PCE A;  2L85 A;  5CQ5 A;  4NYV A;  5JI8 A;  5E7D A;  5FG4 A;  4UIV A;  4BW4 A;  5E73 A;  5E9I A;  5LVQ A;  2D9E A;  4XUA A;  3O35 A;  4WHW A;  5EWD A;  4N3W A;  5ACY A;  5CQT A;  5D3N A;  5CRZ A;  5K29 A;  5A81 A;  3S91 A;  4NUD A;  3UV5 A;  5II2 A;  4LZ2 A;  4IR6 A;  4ZQL A;  3I3J A;  4QR4 A;  4MEO A;  5ENF A; 
#chains in the Genus database with same CATH homology
 5D7X A;  3LQH A;  3Q2F A;  5I89 A;  3UVW A;  4LYS A;  3AAD A;  2D82 A;  3U5J A;  4UIZ A;  4Z6H A;  4MEN A;  4QEV A;  4NXJ A;  5A7C A;  5I83 A;  5I80 A;  4CUS A;  5I88 A;  2DVS A;  4A9F A;  4J1P A;  5AMF A;  4ALH A;  5DW2 A;  4QSR A;  4O71 A;  2YW5 A;  4XYA A;  4QR3 A;  4QSV A;  5CZG A;  5COI A;  3U5K A;  3QZS A;  5C8G A;  4F3I A;  1X0J A;  5DKC A;  5FE5 A;  5CUC A;  5DLX A;  2I8N A;  4KV1 A;  4Z1Q A;  3MB3 A;  5CS8 A;  4O75 A;  5I86 A;  4O7A A;  4ALG A;  5FE2 A;  3LQI A;  4QB3 A;  4IOR A;  5FFY A;  3SVH A;  4GPJ A;  4UYF B;  5ENH A;  5LKX A;  5E3D A;  3SVG A;  5LKZ A;  4IR5 A;  3MQM A;  5H1U A;  1WUG A;  5HFQ A;  5TB6 A;  5I29 A;  5DYA A;  5LJ0 A;  4QSP A;  5HQ7 A;  5LVR A;  4UIX A;  4MR3 A;  4NR7 A;  3UV4 A;  4J3I A;  4XY9 A;  4IOO A;  4BW1 A;  5D3T A;  4NR9 A;  5FBX A;  4NYW A;  4LYI A;  4HXS A;  4O70 A;  4CUU A;  4QUT A;  5C7N A;  3O33 A;  4CUT A;  5CPE A;  2E3K A;  3U5N A;  4TU6 A;  4HXO A;  4QSX A;  4HXK A;  4N4I A;  3S92 A;  5EGU A;  2DKW A;  5CQ3 A;  5EP7 A;  5BT3 A;  2F6N A;  5IGM A;  5FE6 A;  5C89 A;  5D3H A;  5IGL A;  5D3J A;  5H1V A;  5F5Z A;  3AQA A;  4FLP A;  2I7K A;  5D25 A;  4LC2 A;  3P1F A;  5L98 A;  4DON A;  4TYL A;  5AME A;  5DYU A;  3HME A;  4Q0O A;  5LKU A;  4NR6 A;  5H1T A;  5I40 A;  2YEM A;  2OO1 A;  5JWM A;  1JM4 B;  5HEN A;  5F3A A;  4NS5 A;  5DYC A;  5IG6 A;  5F1L A;  5L96 A;  5EI4 A;  5F2P A;  1ZS5 A;  5CQ4 A;  5EWW A;  5EV9 A;  5A5R A;  3O36 A;  5KTX A;  2R0V A;  5CQ7 A;  5EWC A;  4J0R A;  4PCI A;  4XY8 A;  5F61 A;  3JVK A;  5CUE A;  4IR4 A;  4NR4 A;  5ETB A;  3LJW A;  4BW3 A;  4QBM A;  2OSS A;  5IBN A;  5A5P A;  5C85 A;  4UYD A;  4ZC9 A;  2RI7 A;  4N4G A;  5CUA A;  4RVR A;  5AD2 A;  4HXR A;  5FE0 A;  4YAX A;  4YYI A;  5L97 A;  5IGK A;  5HJC A;  4NUE A;  5EK9 A;  5EM3 A;  3HMH A;  3NXB A;  4UIY A;  5G4R A;  3Q2E A;  4UYF A;  5IID A;  3O37 A;  3JVJ A;  5D26 A;  5LJ2 A;  4YY4 A;  4QR5 A;  3DWY A;  5DYX A;  2H60 A;  4Z6I A;  4O7B A;  5HQ6 A;  4PKL A;  4MEP A;  3G0J A;  4A9N A;  4A9L A;  5DFC A;  4Z93 A;  3UV2 A;  4OGI A;  1WUM A;  1JSP B;  2RFJ A;  4QYL A;  5D3P A;  4A9J A;  4N4F A;  3MUL A;  5L8T A;  5FG5 A;  4IR3 A;  4YK0 A;  2WP1 A;  5HFR A;  4TU4 A;  3D7C A;  4A9E A;  2RNY A;  4NRC A;  4BW2 A;  5A5O A;  4OGJ A;  5DX4 A;  5BT4 A;  5C4Q A;  4LRG A;  5E9V A;  3UVX A;  2YQD A;  3U5P A;  5LJ1 A;  4BHW A;  5A83 A;  3U5M A;  2N9G A;  4A9H A;  4YYD A;  5EPR A;  3MXF A;  5CGP A;  5CU8 A;  4J0S A;  4UIT A;  5KTW A;  4QYD A;  5FB0 A;  5EU1 A;  5EIC A;  5HEL A;  5E9M A;  2WP2 A;  4HXP A;  5FE1 A;  5HCL A;  3O34 A;  5HRW A;  5F63 A;  2YEK A;  2YDW A;  4NYX A;  4BJX A;  3DAI A;  4A9O A;  2L5E A;  5FE4 A;  4LZS A;  1EQF A;  4KV4 A;  4TT4 A;  4YYM A;  5CTL A;  4O76 A;  5CRM A;  4YYJ A;  4YAD A;  4TT2 A;  2MJV B;  5CUG A;  4O7C A;  2L84 A;  4QSQ A;  2DAT A;  4NQM A;  4KCX A;  5DKH A;  4LZR A;  5ENG A;  5D3S A;  5I7X A;  5CFW A;  5A5Q A;  4WHU A;  4WIV A;  5HRV A;  4YBS A;  5DBM A;  4QSU A;  4LYW A;  4LR6 A;  4N4H A;  4NRA A;  4Z1S A;  4MR5 A;  2F6J A;  5DFD A;  5ETD A;  5EVA A;  5EWV A;  5II1 A;  4OUF A;  5A82 A;  2RO1 A;  4QY4 A;  5FH8 A;  5I7Y A;  5F1H A;  2RNX A;  4XUB A;  5KTU A;  5HRX A;  2RNW A;  5EQ1 A;  4CFK A;  4TS8 A;  2E7N A;  5E9L A;  5A5S A;  5A5N A;  3UVY A;  4YH3 A;  5DFB A;  4HXM A;  3U5L A;  2NXB A;  4YYN A;  5DW1 A;  4NUC A;  2YEL A;  3MB4 A;  4PTB A;  4O7E A;  5EIS A;  5ENC A;  5F36 A;  3P1D A;  5D3R A;  4YYK A;  4E96 A;  5E74 A;  5TCM A;  2DVQ A;  3K2J A;  4MR4 A;  2E7O A;  3JVM A;  4NRB A;  4NR5 A;  4QC1 A;  3GG3 A;  5FFV A;  4QUU A;  5FE3 A;  5DLZ A;  2DVV A;  2DWW A;  4UYH A;  4O78 A;  5D24 A;  5G4S A;  5HM0 A;  5H85 A;  5CUB A;  4Y03 A;  5LKT A;  4QZS A;  4QC3 A;  5E3G A;  4HBV A;  5KHM A;  3HMF A;  3RCW A;  5J0D A;  4YAT A;  3G0L A;  5CP5 A;  5IGN A;  4HXN A;  3LXJ A;  5F60 A;  5F62 A;  5EPS A;  5KO4 A;  5EA1 A;  3LQJ A;  5BT5 A;  2OUO A;  4C66 A;  5HQ5 A;  4A9K A;  4UIU A;  1E6I A;  5CUD A;  4ZW1 A;  4YYH A;  3ZYU A;  2LSP B;  4C67 A;  5DY7 A;  4UYE A;  5EWH A;  4YYG A;  3IU5 A;  4TTE A;  5FE7 A;  4QEW A;  5FH7 A;  4LDF A;  5L8U A;  5DKD A;  3U5O A;  5CQ6 A;  4UYG A;  4MR6 A;  5ENJ A;  4TT6 A;  4CL9 A;  5HLS A;  5D3L A;  5CQA A;  4PS5 A;  3P1E A;  5FE9 A;  3UVD A;  5ENB A;  5D0C A;  4HXL A;  5ENI A;  5F25 A;  2R0Y A;  5FDZ A;  4O77 A;  5A85 A;  2DVR A;  4CUR A;  5FB1 A;  1N72 A;  5FG6 A;  5L99 A;  4A9M A;  4YBT A;  3UW9 A;  4HBY A;  4O74 A;  3QZV A;  3JVL A;  4CFL A;  2YYN A;  5CQ8 A;  4X2I A;  4MEQ A;  4A9I A;  5FH6 A;  4NQN A;  4YY6 A;  2GRC A;  4YC9 A;  4QST A;  5AD3 A;  4O7F A;  4CUP A;  2R0S A;  4TZ2 A;  5E0R A;  5FFW A;  5C87 A;  4PY6 A;  3P1C A;  3SVF A;  4YBM A;  5LUU A;  4HBX A;  3P5O A;  2KTB B;  5I1Q A;  1F68 A;  3IU6 A;  3QZT A;  2FSA A;  3ONI A;  4TQN A;  3TLP A;  5E9K A;  4NR8 A;  5CY9 A;  4QSW A;  4HBW A;  4YH4 A;  4TZ8 A;  5E9Y A;  4O72 A;  4AKN A;  5ENE A;  3FKM X;  2G4A A;  5KU3 A;  4UIW A;  4QSS A;  5FE8 A;  2RS9 B;  4IOQ A;  2R10 A;  4QEU A;  4CUQ A;  5EPB A;  4Q0N A;  5HEM A;  3MUK A;  4CLB A;  4QNS A;  4YAB A;  4PCE A;  2L85 A;  5CQ5 A;  4NYV A;  5JI8 A;  5E7D A;  5FG4 A;  4UIV A;  4BW4 A;  5E73 A;  5E9I A;  5LVQ A;  2D9E A;  4XUA A;  3O35 A;  4WHW A;  5EWD A;  4N3W A;  5ACY A;  5CQT A;  5D3N A;  5CRZ A;  5K29 A;  5A81 A;  3S91 A;  4NUD A;  3UV5 A;  5II2 A;  4LZ2 A;  4IR6 A;  4ZQL A;  3I3J A;  4QR4 A;  4MEO A;  5ENF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...