4MR6A

Crystal structure of the second bromodomain of human brd2 in complex with a quinazolinone ligand (rvx-208)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Bromodomain-containing protein 2
publication title RVX-208, an inhibitor of BET transcriptional regulators with selectivity for the second bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4mr6A00
5D3SA 5EU1A 3LQIA 5D3RA 2F6NA 5ENJA 4YYJA 5ETBA 5TB6A 3UW9A 5HQ5A 3U5NA 2RS9B 4CUPA 3MUKA 4NRBA 4PCEA 5CY9A 4Z1SA 4MR5A 5EV9A 4NR9A 4TT4A 4O76A 5FE2A 4NRAA 4J0RA 4XY8A 4HBVA 3JVMA 4QC3A 5FE1A 5HFRA 4YAXA 3U5MA 2E3KA 5J0DA 4J1PA 4HBWA 2E7NA 5C85A 4CLBA 4NYXA 4BW1A 4YYNA 5A5NA 5A5PA 5IGNA 4QSUA 3JVKA 3SVGA 5LJ1A 5AD3A 5EPBA 4BW4A 5FE0A 5CU8A 4TT2A 5FBXA 5FE4A 4MEOA 3LJWA 3QZSA 5DYUA 4CFLA 4UIXA 4Z1QA 5LKUA 3Q2EA 3DAIA 4YYKA 5CQ3A 4WHWA 5LVRA 5D3JA 4N4IA 5F25A 5FH7A 4Z6IA 4PTBA 4F3IA 4LYSA 5F62A 2RNXA 2GRCA 4O71A 3UV2A 2YELA 4N4FA 4WIVA 2D82A 5FB1A 2RNYA 5HRXA 5D3LA 5EWHA 4YYHA 3LQJA 4QB3A 5DYAA 5EWWA 5COIA 4IR4A 4KV1A 5C7NA 2OO1A 3AQAA 4O74A 4DONA 5LKZA 5FE5A 4O70A 3LXJA 4YATA 4OGIA 4IOOA 5F36A 5FB0A 4NYWA 4BHWA 4QYLA 4NR7A 4O75A 5A5RA 4LYWA 3UVWA 3MB3A 5A7CA 4KCXA 4YY6A 4UYDA 2D9EA 1E6IA 4BW2A 3K2JA 5E0RA 4HXSA 5CQAA 3U5LA 4A9NA 5DYXA 5KU3A 4BJXA 5I7YA 5DLXA 4QEUA 4YYDA 4MEQA 5EWVA 4UYFB 3U5OA 4NQMA 4C67A 4HXNA 5EPSA 4YYGA 4Z6HA 2I8NA 5JI8A 5FE9A 4GPJA 4MR6A 5DLZA 4O7CA 5DX4A 3MULA 4NQNA 5DBMA 5HQ6A 4UIUA 2YEKA 5CTLA 4CUSA 2DVSA 4UYGA 4TU6A 5EICA 5H85A 4O78A 4UITA 2H60A 5CQ7A 3AADA 5FE7A 2I7KA 5I40A 5HFQA 5K29A 5C89A 3O33A 4NRCA 4TQNA 4ZW1A 5KTXA 5EK9A 5LKTA 4CL9A 3UV4A 5CP5A 4MENA 5E3GA 4A9LA 5HQ7A 5IGKA 2F6JA 5L99A 4CUUA 5HRVA 2WP1A 5II1A 4O77A 4LC2A 4O72A 4HXLA 5KO4A 5BT5A 4QC1A 5E9IA 5A85A 5D3NA 3P1FA 5G4SA 3UVXA 1F68A 2YQDA 4O7EA 4A9FA 5I1QA 5ENBA 3MXFA 4Z93A 4YYIA 5BT4A 4BW3A 5I29A 4N4GA 5CUCA 4NUDA 5E9KA 5JWMA 4XUBA 5I86A 5FG6A 3FKMX 3QZVA 4UYEA 5FFWA 4O7AA 3GG3A 4MR4A 4J3IA 5F2PA 3UVDA 2R0YA 3MB4A 5FH6A 3P1DA 4PKLA 5A83A 5C8GA 5E9VA 5AMEA 2G4AA 4NYVA 5CUGA 5EQ1A 5I88A 2OSSA 5CS8A 3TLPA 2YYNA 4WHUA 3S91A 3P1CA 4QY4A 4LZSA 5E9LA 5CUAA 2LSPB 4QEWA 4YBSA 5D3HA 4ALGA 2DKWA 4QSSA 5L97A 3HMEA 4QEVA 5C87A 1JSPB 3UVYA 5FG4A 5ENGA 4X2IA 5H1UA 4LR6A 1X0JA 3D7CA 4A9HA 3P1EA 3O35A 2R0SA 3HMHA 5F63A 2DATA 5I80A 4HXKA 5FFVA 4MEPA 4N3WA 2DWWA 4NXJA 5FE6A 5TCMA 4YADA 2N9GA 4TS8A 5H1TA 1ZS5A 4QSWA 5AMFA 4TZ2A 4YYMA 5DW2A 5CFWA 2RO1A 5F1HA 4LZ2A 5D24A 5CUBA 3ZYUA 5EP7A 5D0CA 4Q0NA 5ACYA 4UIYA 2DVQA 4IR5A 4HBYA 4IR3A 3O34A 5LUUA 3SVHA 5ENCA 4PY6A 3G0JA 1N72A 4A9EA 3DWYA 5CZGA 5E3DA 4FLPA 5AD2A 2RI7A 5IGMA 5CRZA 5E74A 5I83A 5D26A 5I89A 5A81A 5CUEA 3HMFA 4QSPA 5A82A 4PS5A 3S92A 2YDWA 4Q0OA 5DFDA 5EWDA 4NR8A 5ENFA 4C66A 5E7DA 4A9JA 2OUOA 4YBTA 5CQ5A 4LRGA 5A5SA 4QSTA 5FH8A 4O7BA 4NR4A 5DW1A 5LJ2A 4TU4A 5D7XA 4NR5A 5CQ4A 5L8UA 5LJ0A 2E7OA 5EI4A 2YW5A 5DKCA 3ONIA 5L8TA 4QYDA 4HXRA 5CUDA 4Y03A 5FE3A 5KHMA 5F5ZA 4TTEA 4YC9A 5I7XA 4OGJA 3I3JA 4LYIA 5DYCA 4QR4A 4N4HA 5IBNA 4A9OA 5FE8A 4RVRA 5E9MA 5EA1A 4QUTA 5A5OA 4QR3A 3G0LA 5FG5A 4LDFA 5IIDA 3LQHA 4O7FA 1EQFA 4A9MA 4NUCA 2NXBA 5E73A 5DKHA 4UYHA 4ZQLA 4QSQA 5IGLA 5KTWA 4A9IA 5CPEA 5G4RA 5L96A 4CUQA 5DKDA 4HBXA 3U5JA 2L85A 4HXOA 4MR3A 5HRWA 3QZTA 2KTBB 3UV5A 4IOQA 4NR6A 5ENIA 4TYLA 2DVVA 3SVFA 4QNSA 4QSRA 3IU6A 4QSXA 3JVJA 2R10A 5EPRA 5F1LA 4ALHA 5HELA 5CQ8A 5F3AA 4J0SA 4YK0A 5LVQA 3RCWA 5DFBA 4QBMA 4XUAA 4HXPA 5LKXA 4IORA 5E9YA 4OUFA 5CRMA 1WUGA 5HCLA 5D3PA 5L98A 2FSAA 5ENHA 5FDZA 4A9KA 5F61A 3NXBA 3IU5A 4IR6A 4XY9A 3MQMA 4KV4A 5D3TA 4YABA 4YBMA 4QR5A 5ETDA 1WUMA 5C4QA 3O37A 3P5OA 4QUUA 4NUEA 4HXMA 5CGPA 4ZC9A 2L5EA 5EISA 5IG6A 5ENEA 5FFYA 4E96A 3O36A 2R0VA 2DVRA 5EWCA 3U5KA 5HM0A 5HENA 2MJVB 5KTUA 4YY4A 4CURA 5A5QA 2L84A 5CQ6A 5HEMA 5HJCA 5II2A 2WP2A 4QSVA 5DFCA 5DY7A 5BT3A 3JVLA 5D25A 4UYFA 2RFJA 3Q2FA 4UIVA 4UIZA 4LZRA 4UIWA 5EGUA 4TT6A 5F60A 5HLSA 4YH3A 2RNWA 5EVAA 4NS5A 1JM4B 4YH4A 4CUTA 4AKNA 4TZ8A 4CFKA 4XYAA 2YEMA 3U5PA 5CQTA 4QZSA 4PCIA 5EM3A 5H1VA
chains in the Genus database with same CATH superfamily
5D3SA 5EU1A 3LQIA 5D3RA 2F6NA 5ENJA 4YYJA 5ETBA 5TB6A 3UW9A 5HQ5A 3U5NA 2RS9B 4CUPA 3MUKA 4NRBA 4PCEA 5CY9A 4Z1SA 4MR5A 5EV9A 4NR9A 4TT4A 4O76A 5FE2A 4NRAA 4J0RA 4XY8A 4HBVA 3JVMA 4QC3A 5FE1A 5HFRA 4YAXA 3U5MA 2E3KA 5J0DA 4J1PA 4HBWA 2E7NA 5C85A 4CLBA 4NYXA 4BW1A 4YYNA 5A5NA 5A5PA 5IGNA 4QSUA 3JVKA 3SVGA 5LJ1A 5AD3A 5EPBA 4BW4A 5FE0A 5CU8A 4TT2A 5FBXA 5FE4A 4MEOA 3LJWA 3QZSA 5DYUA 4CFLA 4UIXA 4Z1QA 5LKUA 3Q2EA 3DAIA 4YYKA 5CQ3A 4WHWA 5LVRA 5D3JA 4N4IA 5F25A 5FH7A 4Z6IA 4PTBA 4F3IA 4LYSA 5F62A 2RNXA 2GRCA 4O71A 3UV2A 2YELA 4N4FA 4WIVA 2D82A 5FB1A 2RNYA 5HRXA 5D3LA 5EWHA 4YYHA 3LQJA 4QB3A 5DYAA 5EWWA 5COIA 4IR4A 4KV1A 5C7NA 2OO1A 3AQAA 4O74A 4DONA 5LKZA 5FE5A 4O70A 3LXJA 4YATA 4OGIA 4IOOA 5F36A 5FB0A 4NYWA 4BHWA 4QYLA 4NR7A 4O75A 5A5RA 4LYWA 3UVWA 3MB3A 5A7CA 4KCXA 4YY6A 3D1DA 4UYDA 2D9EA 1E6IA 4BW2A 3K2JA 5E0RA 4HXSA 5CQAA 3U5LA 4A9NA 5DYXA 5KU3A 4BJXA 5I7YA 5DLXA 4QEUA 4YYDA 4MEQA 5EWVA 4UYFB 3U5OA 4NQMA 4C67A 4HXNA 5EPSA 4YYGA 4Z6HA 2I8NA 5JI8A 5FE9A 4GPJA 4MR6A 5DLZA 4O7CA 5DX4A 3MULA 4NQNA 5DBMA 5HQ6A 4UIUA 2YEKA 5CTLA 4CUSA 2DVSA 4UYGA 4TU6A 5EICA 5H85A 4O78A 4UITA 2H60A 5CQ7A 3AADA 5FE7A 2I7KA 5I40A 5HFQA 5K29A 5C89A 3O33A 4NRCA 4TQNA 4ZW1A 5KTXA 5EK9A 5LKTA 4CL9A 3UV4A 5CP5A 4MENA 5E3GA 4A9LA 5HQ7A 5IGKA 2F6JA 5L99A 4CUUA 5HRVA 2WP1A 5II1A 4O77A 4LC2A 4O72A 4HXLA 5KO4A 5BT5A 4QC1A 5E9IA 5A85A 5D3NA 3P1FA 5G4SA 3UVXA 1F68A 2YQDA 4O7EA 4A9FA 5I1QA 5ENBA 3MXFA 4AKGA 4Z93A 4YYIA 5BT4A 3VKGA 4BW3A 5I29A 4N4GA 5CUCA 4NUDA 5E9KA 5JWMA 4XUBA 5I86A 5FG6A 3FKMX 3QZVA 4UYEA 5FFWA 4O7AA 3GG3A 4MR4A 4J3IA 5F2PA 3UVDA 2R0YA 3MB4A 5FH6A 3P1DA 4PKLA 5A83A 5C8GA 5E9VA 5AMEA 2G4AA 4NYVA 5CUGA 5EQ1A 5I88A 2OSSA 5CS8A 3TLPA 2YYNA 4WHUA 3S91A 3P1CA 4QY4A 4LZSA 5E9LA 5CUAA 2LSPB 4QEWA 4YBSA 5D3HA 4ALGA 2DKWA 4QSSA 5L97A 3HMEA 4QEVA 5C87A 1JSPB 3UVYA 5FG4A 5ENGA 4X2IA 5H1UA 4LR6A 1X0JA 3D7CA 4A9HA 3P1EA 3O35A 2R0SA 3HMHA 5F63A 2DATA 5I80A 4HXKA 5FFVA 4MEPA 4N3WA 2DWWA 4NXJA 5FE6A 5TCMA 4YADA 2N9GA 4TS8A 5H1TA 1ZS5A 4QSWA 5AMFA 4TZ2A 4YYMA 5DW2A 5CFWA 2RO1A 5F1HA 4LZ2A 5D24A 5CUBA 3ZYUA 5EP7A 5D0CA 4Q0NA 5ACYA 4UIYA 2DVQA 4IR5A 4HBYA 4IR3A 3O34A 5LUUA 3SVHA 5ENCA 4PY6A 3G0JA 1N72A 4A9EA 3DWYA 5CZGA 5E3DA 4FLPA 5AD2A 2RI7A 5IGMA 5CRZA 5E74A 5I83A 5D26A 4AKHA 5I89A 5A81A 5CUEA 3HMFA 4QSPA 5A82A 4PS5A 3S92A 2YDWA 4Q0OA 5DFDA 5EWDA 4NR8A 5ENFA 4C66A 5E7DA 4A9JA 2OUOA 4YBTA 5CQ5A 4LRGA 5A5SA 4QSTA 5FH8A 4O7BA 4NR4A 5DW1A 5LJ2A 4TU4A 5D7XA 4NR5A 5CQ4A 5L8UA 5LJ0A 2E7OA 5EI4A 2YW5A 5DKCA 3ONIA 5L8TA 4QYDA 4HXRA 5CUDA 4Y03A 5FE3A 5KHMA 5F5ZA 4TTEA 4YC9A 5I7XA 4OGJA 3I3JA 4LYIA 5DYCA 3VKHA 4QR4A 4N4HA 5IBNA 4A9OA 5FE8A 4RVRA 5E9MA 5EA1A 1PUOA 4QUTA 5A5OA 4QR3A 3G0LA 5FG5A 4LDFA 4AKIA 5IIDA 3LQHA 4O7FA 1EQFA 4A9MA 4NUCA 2NXBA 5E73A 5DKHA 4UYHA 4ZQLA 4QSQA 5IGLA 5KTWA 4A9IA 5CPEA 5G4RA 5L96A 4CUQA 5DKDA 1ZKRA 4HBXA 3U5JA 2L85A 4HXOA 4MR3A 5HRWA 3QZTA 2KTBB 3UV5A 4IOQA 4NR6A 5ENIA 4TYLA 2DVVA 3SVFA 4QNSA 4QSRA 3IU6A 4QSXA 3JVJA 2R10A 5EPRA 5F1LA 4ALHA 5HELA 5CQ8A 5F3AA 4J0SA 4YK0A 5LVQA 3RCWA 5DFBA 4QBMA 4XUAA 4HXPA 5LKXA 4IORA 5E9YA 3D1BA 4OUFA 1WUGA 5CRMA 5D3PA 5HCLA 5L98A 2FSAA 5ENHA 5FDZA 4A9KA 5F61A 3NXBA 3IU5A 4IR6A 4XY9A 3MQMA 4KV4A 5D3TA 4YABA 4YBMA 4QR5A 2EJNA 5ETDA 1WUMA 5C4QA 3O37A 3P5OA 4QUUA 4NUEA 4HXMA 5CGPA 4ZC9A 2L5EA 3ERRA 5EISA 5IG6A 5ENEA 5FFYA 4E96A 3O36A 2R0VA 2DVRA 5EWCA 3U5KA 5HM0A 5HENA 2MJVB 5KTUA 4YY4A 4CURA 5A5QA 2L84A 5CQ6A 5HEMA 5HJCA 5II2A 2WP2A 4QSVA 5DFCA 5DY7A 5BT3A 3JVLA 5D25A 4UYFA 2RFJA 3Q2FA 4UIVA 4AI6A 4UIZA 4LZRA 4UIWA 5EGUA 4TT6A 5F60A 5HLSA 4YH3A 2RNWA 5EVAA 4NS5A 1JM4B 4YH4A 4CUTA 4AKNA 4TZ8A 4CFKA 4XYAA 2YEMA 3U5PA 5CQTA 4QZSA 4PCIA 5EM3A 5H1VA
chains in the Genus database with same CATH topology
5D3SA 5EU1A 3LQIA 5D3RA 2F6NA 5ENJA 4YYJA 5ETBA 5TB6A 3UW9A 5HQ5A 3U5NA 2RS9B 4CUPA 3MUKA 4NRBA 4PCEA 5CY9A 4Z1SA 4MR5A 5EV9A 4NR9A 4TT4A 4O76A 5FE2A 4NRAA 4J0RA 4XY8A 4HBVA 3JVMA 4QC3A 5FE1A 5HFRA 4YAXA 3U5MA 2E3KA 5J0DA 4J1PA 4HBWA 2E7NA 5C85A 4CLBA 4NYXA 4BW1A 4YYNA 5A5NA 5A5PA 5IGNA 4QSUA 3JVKA 3SVGA 5LJ1A 5AD3A 5EPBA 4BW4A 5FE0A 5CU8A 4TT2A 5FBXA 5FE4A 4MEOA 3LJWA 3QZSA 5DYUA 4CFLA 4UIXA 4Z1QA 5LKUA 3Q2EA 3DAIA 4YYKA 5CQ3A 4WHWA 5LVRA 5D3JA 4N4IA 5F25A 5FH7A 4Z6IA 4PTBA 4F3IA 4LYSA 5F62A 2RNXA 2GRCA 4O71A 3UV2A 2YELA 4N4FA 4WIVA 2D82A 5FB1A 2RNYA 5HRXA 5D3LA 5EWHA 4YYHA 3LQJA 4QB3A 5DYAA 5EWWA 5COIA 4IR4A 4KV1A 5C7NA 2OO1A 3AQAA 4O74A 4DONA 5LKZA 5FE5A 4O70A 3LXJA 4YATA 4OGIA 4IOOA 5F36A 5FB0A 4NYWA 4BHWA 4QYLA 4NR7A 4O75A 5A5RA 4LYWA 3UVWA 3MB3A 5A7CA 4KCXA 4YY6A 4UYDA 2D9EA 1E6IA 4BW2A 3K2JA 5E0RA 4HXSA 5CQAA 3U5LA 4A9NA 5DYXA 5KU3A 4BJXA 5I7YA 5DLXA 4QEUA 4YYDA 4MEQA 5EWVA 4UYFB 3U5OA 4NQMA 4C67A 4HXNA 5EPSA 4YYGA 4Z6HA 2I8NA 5JI8A 5FE9A 4GPJA 4MR6A 5DLZA 4O7CA 5DX4A 3MULA 4NQNA 5DBMA 5HQ6A 4UIUA 2YEKA 5CTLA 4CUSA 2DVSA 4UYGA 4TU6A 5EICA 5H85A 4O78A 4UITA 2H60A 5CQ7A 3AADA 5FE7A 2I7KA 5I40A 5HFQA 5K29A 5C89A 3O33A 4NRCA 4TQNA 4ZW1A 5KTXA 5EK9A 5LKTA 4CL9A 3UV4A 5CP5A 4MENA 5E3GA 4A9LA 5HQ7A 5IGKA 2F6JA 5L99A 4CUUA 5HRVA 2WP1A 5II1A 4O77A 4LC2A 4O72A 4HXLA 5KO4A 5BT5A 4QC1A 5E9IA 5A85A 5D3NA 3P1FA 5G4SA 3UVXA 1F68A 2YQDA 4O7EA 4A9FA 5I1QA 5ENBA 3MXFA 4Z93A 4YYIA 5BT4A 4BW3A 5I29A 4N4GA 5CUCA 4NUDA 5E9KA 5JWMA 4XUBA 5I86A 5FG6A 3FKMX 3QZVA 4UYEA 5FFWA 4O7AA 3GG3A 4MR4A 4J3IA 5F2PA 3UVDA 2R0YA 3MB4A 5FH6A 3P1DA 4PKLA 5A83A 5C8GA 5E9VA 5AMEA 2G4AA 4NYVA 5CUGA 5EQ1A 5I88A 2OSSA 5CS8A 3TLPA 2YYNA 4WHUA 3S91A 3P1CA 4QY4A 4LZSA 5E9LA 5CUAA 2LSPB 4QEWA 4YBSA 5D3HA 4ALGA 2DKWA 4QSSA 5L97A 3HMEA 4QEVA 5C87A 1JSPB 3UVYA 5FG4A 5ENGA 4X2IA 5H1UA 4LR6A 1X0JA 3D7CA 4A9HA 3P1EA 3O35A 2R0SA 3HMHA 5F63A 2DATA 5I80A 4HXKA 5FFVA 4MEPA 4N3WA 2DWWA 4NXJA 5FE6A 5TCMA 4YADA 2N9GA 4TS8A 5H1TA 1ZS5A 4QSWA 5AMFA 4TZ2A 4YYMA 5DW2A 5CFWA 2RO1A 5F1HA 4LZ2A 5D24A 5CUBA 3ZYUA 5EP7A 5D0CA 4Q0NA 5ACYA 4UIYA 2DVQA 4IR5A 4HBYA 4IR3A 3O34A 5LUUA 3SVHA 5ENCA 4PY6A 3G0JA 1N72A 4A9EA 3DWYA 5CZGA 5E3DA 4FLPA 5AD2A 2RI7A 5IGMA 5CRZA 5E74A 5I83A 5D26A 5I89A 5A81A 5CUEA 3HMFA 4QSPA 5A82A 4PS5A 3S92A 2YDWA 4Q0OA 5DFDA 5EWDA 4NR8A 5ENFA 4C66A 5E7DA 4A9JA 2OUOA 4YBTA 5CQ5A 4LRGA 5A5SA 4QSTA 5FH8A 4O7BA 4NR4A 5DW1A 5LJ2A 4TU4A 5D7XA 4NR5A 5CQ4A 5L8UA 5LJ0A 2E7OA 5EI4A 2YW5A 5DKCA 3ONIA 5L8TA 4QYDA 4HXRA 5CUDA 4Y03A 5FE3A 5KHMA 5F5ZA 4TTEA 4YC9A 5I7XA 4OGJA 3I3JA 4LYIA 5DYCA 4QR4A 4N4HA 5IBNA 4A9OA 5FE8A 4RVRA 5E9MA 5EA1A 4QUTA 5A5OA 4QR3A 3G0LA 5FG5A 4LDFA 5IIDA 3LQHA 4O7FA 1EQFA 4A9MA 4NUCA 2NXBA 5E73A 5DKHA 4UYHA 4ZQLA 4QSQA 5IGLA 5KTWA 4A9IA 5CPEA 5G4RA 5L96A 4CUQA 5DKDA 4HBXA 3U5JA 2L85A 4HXOA 4MR3A 5HRWA 3QZTA 2KTBB 3UV5A 4IOQA 4NR6A 5ENIA 4TYLA 2DVVA 3SVFA 4QNSA 4QSRA 3IU6A 4QSXA 3JVJA 2R10A 5EPRA 5F1LA 4ALHA 5HELA 5CQ8A 5F3AA 4J0SA 4YK0A 5LVQA 3RCWA 5DFBA 4QBMA 4XUAA 4HXPA 5LKXA 4IORA 5E9YA 4OUFA 5CRMA 1WUGA 5HCLA 5D3PA 5L98A 2FSAA 5ENHA 5FDZA 4A9KA 5F61A 3NXBA 3IU5A 4IR6A 4XY9A 3MQMA 4KV4A 5D3TA 4YABA 4YBMA 4QR5A 5ETDA 1WUMA 5C4QA 3O37A 3P5OA 4QUUA 4NUEA 4HXMA 5CGPA 4ZC9A 2L5EA 5EISA 5IG6A 5ENEA 5FFYA 4E96A 3O36A 2R0VA 2DVRA 5EWCA 3U5KA 5HM0A 5HENA 2MJVB 5KTUA 4YY4A 4CURA 5A5QA 2L84A 5CQ6A 5HEMA 5HJCA 5II2A 2WP2A 4QSVA 5DFCA 5DY7A 5BT3A 3JVLA 5D25A 4UYFA 2RFJA 3Q2FA 4UIVA 4UIZA 4LZRA 4UIWA 5EGUA 4TT6A 5F60A 5HLSA 4YH3A 2RNWA 5EVAA 4NS5A 1JM4B 4YH4A 4CUTA 4AKNA 4TZ8A 4CFKA 4XYAA 2YEMA 3U5PA 5CQTA 4QZSA 4PCIA 5EM3A 5H1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3S A;  5EU1 A;  3LQI A;  5D3R A;  2F6N A;  5ENJ A;  4YYJ A;  5ETB A;  5TB6 A;  3UW9 A;  5HQ5 A;  3U5N A;  2RS9 B;  4CUP A;  3MUK A;  4NRB A;  4PCE A;  5CY9 A;  4Z1S A;  4MR5 A;  5EV9 A;  4NR9 A;  4TT4 A;  4O76 A;  5FE2 A;  4NRA A;  4J0R A;  4XY8 A;  4HBV A;  3JVM A;  4QC3 A;  5FE1 A;  5HFR A;  4YAX A;  3U5M A;  2E3K A;  5J0D A;  4J1P A;  4HBW A;  2E7N A;  5C85 A;  4CLB A;  4NYX A;  4BW1 A;  4YYN A;  5A5N A;  5A5P A;  5IGN A;  4QSU A;  3JVK A;  3SVG A;  5LJ1 A;  5AD3 A;  5EPB A;  4BW4 A;  5FE0 A;  5CU8 A;  4TT2 A;  5FBX A;  5FE4 A;  4MEO A;  3LJW A;  3QZS A;  5DYU A;  4CFL A;  4UIX A;  4Z1Q A;  5LKU A;  3Q2E A;  3DAI A;  4YYK A;  5CQ3 A;  4WHW A;  5LVR A;  5D3J A;  4N4I A;  5F25 A;  5FH7 A;  4Z6I A;  4PTB A;  4F3I A;  4LYS A;  5F62 A;  2RNX A;  2GRC A;  4O71 A;  3UV2 A;  2YEL A;  4N4F A;  4WIV A;  2D82 A;  5FB1 A;  2RNY A;  5HRX A;  5D3L A;  5EWH A;  4YYH A;  3LQJ A;  4QB3 A;  5DYA A;  5EWW A;  5COI A;  4IR4 A;  4KV1 A;  5C7N A;  2OO1 A;  3AQA A;  4O74 A;  4DON A;  5LKZ A;  5FE5 A;  4O70 A;  3LXJ A;  4YAT A;  4OGI A;  4IOO A;  5F36 A;  5FB0 A;  4NYW A;  4BHW A;  4QYL A;  4NR7 A;  4O75 A;  5A5R A;  4LYW A;  3UVW A;  3MB3 A;  5A7C A;  4KCX A;  4YY6 A;  4UYD A;  2D9E A;  1E6I A;  4BW2 A;  3K2J A;  5E0R A;  4HXS A;  5CQA A;  3U5L A;  4A9N A;  5DYX A;  5KU3 A;  4BJX A;  5I7Y A;  5DLX A;  4QEU A;  4YYD A;  4MEQ A;  5EWV A;  4UYF B;  3U5O A;  4NQM A;  4C67 A;  4HXN A;  5EPS A;  4YYG A;  4Z6H A;  2I8N A;  5JI8 A;  5FE9 A;  4GPJ A;  4MR6 A;  5DLZ A;  4O7C A;  5DX4 A;  3MUL A;  4NQN A;  5DBM A;  5HQ6 A;  4UIU A;  2YEK A;  5CTL A;  4CUS A;  2DVS A;  4UYG A;  4TU6 A;  5EIC A;  5H85 A;  4O78 A;  4UIT A;  2H60 A;  5CQ7 A;  3AAD A;  5FE7 A;  2I7K A;  5I40 A;  5HFQ A;  5K29 A;  5C89 A;  3O33 A;  4NRC A;  4TQN A;  4ZW1 A;  5KTX A;  5EK9 A;  5LKT A;  4CL9 A;  3UV4 A;  5CP5 A;  4MEN A;  5E3G A;  4A9L A;  5HQ7 A;  5IGK A;  2F6J A;  5L99 A;  4CUU A;  5HRV A;  2WP1 A;  5II1 A;  4O77 A;  4LC2 A;  4O72 A;  4HXL A;  5KO4 A;  5BT5 A;  4QC1 A;  5E9I A;  5A85 A;  5D3N A;  3P1F A;  5G4S A;  3UVX A;  1F68 A;  2YQD A;  4O7E A;  4A9F A;  5I1Q A;  5ENB A;  3MXF A;  4Z93 A;  4YYI A;  5BT4 A;  4BW3 A;  5I29 A;  4N4G A;  5CUC A;  4NUD A;  5E9K A;  5JWM A;  4XUB A;  5I86 A;  5FG6 A;  3FKM X;  3QZV A;  4UYE A;  5FFW A;  4O7A A;  3GG3 A;  4MR4 A;  4J3I A;  5F2P A;  3UVD A;  2R0Y A;  3MB4 A;  5FH6 A;  3P1D A;  4PKL A;  5A83 A;  5C8G A;  5E9V A;  5AME A;  2G4A A;  4NYV A;  5CUG A;  5EQ1 A;  5I88 A;  2OSS A;  5CS8 A;  3TLP A;  2YYN A;  4WHU A;  3S91 A;  3P1C A;  4QY4 A;  4LZS A;  5E9L A;  5CUA A;  2LSP B;  4QEW A;  4YBS A;  5D3H A;  4ALG A;  2DKW A;  4QSS A;  5L97 A;  3HME A;  4QEV A;  5C87 A;  1JSP B;  3UVY A;  5FG4 A;  5ENG A;  4X2I A;  5H1U A;  4LR6 A;  1X0J A;  3D7C A;  4A9H A;  3P1E A;  3O35 A;  2R0S A;  3HMH A;  5F63 A;  2DAT A;  5I80 A;  4HXK A;  5FFV A;  4MEP A;  4N3W A;  2DWW A;  4NXJ A;  5FE6 A;  5TCM A;  4YAD A;  2N9G A;  4TS8 A;  5H1T A;  1ZS5 A;  4QSW A;  5AMF A;  4TZ2 A;  4YYM A;  5DW2 A;  5CFW A;  2RO1 A;  5F1H A;  4LZ2 A;  5D24 A;  5CUB A;  3ZYU A;  5EP7 A;  5D0C A;  4Q0N A;  5ACY A;  4UIY A;  2DVQ A;  4IR5 A;  4HBY A;  4IR3 A;  3O34 A;  5LUU A;  3SVH A;  5ENC A;  4PY6 A;  3G0J A;  1N72 A;  4A9E A;  3DWY A;  5CZG A;  5E3D A;  4FLP A;  5AD2 A;  2RI7 A;  5IGM A;  5CRZ A;  5E74 A;  5I83 A;  5D26 A;  5I89 A;  5A81 A;  5CUE A;  3HMF A;  4QSP A;  5A82 A;  4PS5 A;  3S92 A;  2YDW A;  4Q0O A;  5DFD A;  5EWD A;  4NR8 A;  5ENF A;  4C66 A;  5E7D A;  4A9J A;  2OUO A;  4YBT A;  5CQ5 A;  4LRG A;  5A5S A;  4QST A;  5FH8 A;  4O7B A;  4NR4 A;  5DW1 A;  5LJ2 A;  4TU4 A;  5D7X A;  4NR5 A;  5CQ4 A;  5L8U A;  5LJ0 A;  2E7O A;  5EI4 A;  2YW5 A;  5DKC A;  3ONI A;  5L8T A;  4QYD A;  4HXR A;  5CUD A;  4Y03 A;  5FE3 A;  5KHM A;  5F5Z A;  4TTE A;  4YC9 A;  5I7X A;  4OGJ A;  3I3J A;  4LYI A;  5DYC A;  4QR4 A;  4N4H A;  5IBN A;  4A9O A;  5FE8 A;  4RVR A;  5E9M A;  5EA1 A;  4QUT A;  5A5O A;  4QR3 A;  3G0L A;  5FG5 A;  4LDF A;  5IID A;  3LQH A;  4O7F A;  1EQF A;  4A9M A;  4NUC A;  2NXB A;  5E73 A;  5DKH A;  4UYH A;  4ZQL A;  4QSQ A;  5IGL A;  5KTW A;  4A9I A;  5CPE A;  5G4R A;  5L96 A;  4CUQ A;  5DKD A;  4HBX A;  3U5J A;  2L85 A;  4HXO A;  4MR3 A;  5HRW A;  3QZT A;  2KTB B;  3UV5 A;  4IOQ A;  4NR6 A;  5ENI A;  4TYL A;  2DVV A;  3SVF A;  4QNS A;  4QSR A;  3IU6 A;  4QSX A;  3JVJ A;  2R10 A;  5EPR A;  5F1L A;  4ALH A;  5HEL A;  5CQ8 A;  5F3A A;  4J0S A;  4YK0 A;  5LVQ A;  3RCW A;  5DFB A;  4QBM A;  4XUA A;  4HXP A;  5LKX A;  4IOR A;  5E9Y A;  4OUF A;  5CRM A;  1WUG A;  5HCL A;  5D3P A;  5L98 A;  2FSA A;  5ENH A;  5FDZ A;  4A9K A;  5F61 A;  3NXB A;  3IU5 A;  4IR6 A;  4XY9 A;  3MQM A;  4KV4 A;  5D3T A;  4YAB A;  4YBM A;  4QR5 A;  5ETD A;  1WUM A;  5C4Q A;  3O37 A;  3P5O A;  4QUU A;  4NUE A;  4HXM A;  5CGP A;  4ZC9 A;  2L5E A;  5EIS A;  5IG6 A;  5ENE A;  5FFY A;  4E96 A;  3O36 A;  2R0V A;  2DVR A;  5EWC A;  3U5K A;  5HM0 A;  5HEN A;  2MJV B;  5KTU A;  4YY4 A;  4CUR A;  5A5Q A;  2L84 A;  5CQ6 A;  5HEM A;  5HJC A;  5II2 A;  2WP2 A;  4QSV A;  5DFC A;  5DY7 A;  5BT3 A;  3JVL A;  5D25 A;  4UYF A;  2RFJ A;  3Q2F A;  4UIV A;  4UIZ A;  4LZR A;  4UIW A;  5EGU A;  4TT6 A;  5F60 A;  5HLS A;  4YH3 A;  2RNW A;  5EVA A;  4NS5 A;  1JM4 B;  4YH4 A;  4CUT A;  4AKN A;  4TZ8 A;  4CFK A;  4XYA A;  2YEM A;  3U5P A;  5CQT A;  4QZS A;  4PCI A;  5EM3 A;  5H1V A; 
#chains in the Genus database with same CATH topology
 5D3S A;  5EU1 A;  3LQI A;  5D3R A;  2F6N A;  5ENJ A;  4YYJ A;  5ETB A;  5TB6 A;  3UW9 A;  5HQ5 A;  3U5N A;  2RS9 B;  4CUP A;  3MUK A;  4NRB A;  4PCE A;  5CY9 A;  4Z1S A;  4MR5 A;  5EV9 A;  4NR9 A;  4TT4 A;  4O76 A;  5FE2 A;  4NRA A;  4J0R A;  4XY8 A;  4HBV A;  3JVM A;  4QC3 A;  5FE1 A;  5HFR A;  4YAX A;  3U5M A;  2E3K A;  5J0D A;  4J1P A;  4HBW A;  2E7N A;  5C85 A;  4CLB A;  4NYX A;  4BW1 A;  4YYN A;  5A5N A;  5A5P A;  5IGN A;  4QSU A;  3JVK A;  3SVG A;  5LJ1 A;  5AD3 A;  5EPB A;  4BW4 A;  5FE0 A;  5CU8 A;  4TT2 A;  5FBX A;  5FE4 A;  4MEO A;  3LJW A;  3QZS A;  5DYU A;  4CFL A;  4UIX A;  4Z1Q A;  5LKU A;  3Q2E A;  3DAI A;  4YYK A;  5CQ3 A;  4WHW A;  5LVR A;  5D3J A;  4N4I A;  5F25 A;  5FH7 A;  4Z6I A;  4PTB A;  4F3I A;  4LYS A;  5F62 A;  2RNX A;  2GRC A;  4O71 A;  3UV2 A;  2YEL A;  4N4F A;  4WIV A;  2D82 A;  5FB1 A;  2RNY A;  5HRX A;  5D3L A;  5EWH A;  4YYH A;  3LQJ A;  4QB3 A;  5DYA A;  5EWW A;  5COI A;  4IR4 A;  4KV1 A;  5C7N A;  2OO1 A;  3AQA A;  4O74 A;  4DON A;  5LKZ A;  5FE5 A;  4O70 A;  3LXJ A;  4YAT A;  4OGI A;  4IOO A;  5F36 A;  5FB0 A;  4NYW A;  4BHW A;  4QYL A;  4NR7 A;  4O75 A;  5A5R A;  4LYW A;  3UVW A;  3MB3 A;  5A7C A;  4KCX A;  4YY6 A;  3D1D A;  4UYD A;  2D9E A;  1E6I A;  4BW2 A;  3K2J A;  5E0R A;  4HXS A;  5CQA A;  3U5L A;  4A9N A;  5DYX A;  5KU3 A;  4BJX A;  5I7Y A;  5DLX A;  4QEU A;  4YYD A;  4MEQ A;  5EWV A;  4UYF B;  3U5O A;  4NQM A;  4C67 A;  4HXN A;  5EPS A;  4YYG A;  4Z6H A;  2I8N A;  5JI8 A;  5FE9 A;  4GPJ A;  4MR6 A;  5DLZ A;  4O7C A;  5DX4 A;  3MUL A;  4NQN A;  5DBM A;  5HQ6 A;  4UIU A;  2YEK A;  5CTL A;  4CUS A;  2DVS A;  4UYG A;  4TU6 A;  5EIC A;  5H85 A;  4O78 A;  4UIT A;  2H60 A;  5CQ7 A;  3AAD A;  5FE7 A;  2I7K A;  5I40 A;  5HFQ A;  5K29 A;  5C89 A;  3O33 A;  4NRC A;  4TQN A;  4ZW1 A;  5KTX A;  5EK9 A;  5LKT A;  4CL9 A;  3UV4 A;  5CP5 A;  4MEN A;  5E3G A;  4A9L A;  5HQ7 A;  5IGK A;  2F6J A;  5L99 A;  4CUU A;  5HRV A;  2WP1 A;  5II1 A;  4O77 A;  4LC2 A;  4O72 A;  4HXL A;  5KO4 A;  5BT5 A;  4QC1 A;  5E9I A;  5A85 A;  5D3N A;  3P1F A;  5G4S A;  3UVX A;  1F68 A;  2YQD A;  4O7E A;  4A9F A;  5I1Q A;  5ENB A;  3MXF A;  4AKG A;  4Z93 A;  4YYI A;  5BT4 A;  3VKG A;  4BW3 A;  5I29 A;  4N4G A;  5CUC A;  4NUD A;  5E9K A;  5JWM A;  4XUB A;  5I86 A;  5FG6 A;  3FKM X;  3QZV A;  4UYE A;  5FFW A;  4O7A A;  3GG3 A;  4MR4 A;  4J3I A;  5F2P A;  3UVD A;  2R0Y A;  3MB4 A;  5FH6 A;  3P1D A;  4PKL A;  5A83 A;  5C8G A;  5E9V A;  5AME A;  2G4A A;  4NYV A;  5CUG A;  5EQ1 A;  5I88 A;  2OSS A;  5CS8 A;  3TLP A;  2YYN A;  4WHU A;  3S91 A;  3P1C A;  4QY4 A;  4LZS A;  5E9L A;  5CUA A;  2LSP B;  4QEW A;  4YBS A;  5D3H A;  4ALG A;  2DKW A;  4QSS A;  5L97 A;  3HME A;  4QEV A;  5C87 A;  1JSP B;  3UVY A;  5FG4 A;  5ENG A;  4X2I A;  5H1U A;  4LR6 A;  1X0J A;  3D7C A;  4A9H A;  3P1E A;  3O35 A;  2R0S A;  3HMH A;  5F63 A;  2DAT A;  5I80 A;  4HXK A;  5FFV A;  4MEP A;  4N3W A;  2DWW A;  4NXJ A;  5FE6 A;  5TCM A;  4YAD A;  2N9G A;  4TS8 A;  5H1T A;  1ZS5 A;  4QSW A;  5AMF A;  4TZ2 A;  4YYM A;  5DW2 A;  5CFW A;  2RO1 A;  5F1H A;  4LZ2 A;  5D24 A;  5CUB A;  3ZYU A;  5EP7 A;  5D0C A;  4Q0N A;  5ACY A;  4UIY A;  2DVQ A;  4IR5 A;  4HBY A;  4IR3 A;  3O34 A;  5LUU A;  3SVH A;  5ENC A;  4PY6 A;  3G0J A;  1N72 A;  4A9E A;  3DWY A;  5CZG A;  5E3D A;  4FLP A;  5AD2 A;  2RI7 A;  5IGM A;  5CRZ A;  5E74 A;  5I83 A;  5D26 A;  4AKH A;  5I89 A;  5A81 A;  5CUE A;  3HMF A;  4QSP A;  5A82 A;  4PS5 A;  3S92 A;  2YDW A;  4Q0O A;  5DFD A;  5EWD A;  4NR8 A;  5ENF A;  4C66 A;  5E7D A;  4A9J A;  2OUO A;  4YBT A;  5CQ5 A;  4LRG A;  5A5S A;  4QST A;  5FH8 A;  4O7B A;  4NR4 A;  5DW1 A;  5LJ2 A;  4TU4 A;  5D7X A;  4NR5 A;  5CQ4 A;  5L8U A;  5LJ0 A;  2E7O A;  5EI4 A;  2YW5 A;  5DKC A;  3ONI A;  5L8T A;  4QYD A;  4HXR A;  5CUD A;  4Y03 A;  5FE3 A;  5KHM A;  5F5Z A;  4TTE A;  4YC9 A;  5I7X A;  4OGJ A;  3I3J A;  4LYI A;  5DYC A;  3VKH A;  4QR4 A;  4N4H A;  5IBN A;  4A9O A;  5FE8 A;  4RVR A;  5E9M A;  5EA1 A;  1PUO A;  4QUT A;  5A5O A;  4QR3 A;  3G0L A;  5FG5 A;  4LDF A;  4AKI A;  5IID A;  3LQH A;  4O7F A;  1EQF A;  4A9M A;  4NUC A;  2NXB A;  5E73 A;  5DKH A;  4UYH A;  4ZQL A;  4QSQ A;  5IGL A;  5KTW A;  4A9I A;  5CPE A;  5G4R A;  5L96 A;  4CUQ A;  5DKD A;  1ZKR A;  4HBX A;  3U5J A;  2L85 A;  4HXO A;  4MR3 A;  5HRW A;  3QZT A;  2KTB B;  3UV5 A;  4IOQ A;  4NR6 A;  5ENI A;  4TYL A;  2DVV A;  3SVF A;  4QNS A;  4QSR A;  3IU6 A;  4QSX A;  3JVJ A;  2R10 A;  5EPR A;  5F1L A;  4ALH A;  5HEL A;  5CQ8 A;  5F3A A;  4J0S A;  4YK0 A;  5LVQ A;  3RCW A;  5DFB A;  4QBM A;  4XUA A;  4HXP A;  5LKX A;  4IOR A;  5E9Y A;  3D1B A;  4OUF A;  1WUG A;  5CRM A;  5D3P A;  5HCL A;  5L98 A;  2FSA A;  5ENH A;  5FDZ A;  4A9K A;  5F61 A;  3NXB A;  3IU5 A;  4IR6 A;  4XY9 A;  3MQM A;  4KV4 A;  5D3T A;  4YAB A;  4YBM A;  4QR5 A;  2EJN A;  5ETD A;  1WUM A;  5C4Q A;  3O37 A;  3P5O A;  4QUU A;  4NUE A;  4HXM A;  5CGP A;  4ZC9 A;  2L5E A;  3ERR A;  5EIS A;  5IG6 A;  5ENE A;  5FFY A;  4E96 A;  3O36 A;  2R0V A;  2DVR A;  5EWC A;  3U5K A;  5HM0 A;  5HEN A;  2MJV B;  5KTU A;  4YY4 A;  4CUR A;  5A5Q A;  2L84 A;  5CQ6 A;  5HEM A;  5HJC A;  5II2 A;  2WP2 A;  4QSV A;  5DFC A;  5DY7 A;  5BT3 A;  3JVL A;  5D25 A;  4UYF A;  2RFJ A;  3Q2F A;  4UIV A;  4AI6 A;  4UIZ A;  4LZR A;  4UIW A;  5EGU A;  4TT6 A;  5F60 A;  5HLS A;  4YH3 A;  2RNW A;  5EVA A;  4NS5 A;  1JM4 B;  4YH4 A;  4CUT A;  4AKN A;  4TZ8 A;  4CFK A;  4XYA A;  2YEM A;  3U5P A;  5CQT A;  4QZS A;  4PCI A;  5EM3 A;  5H1V A; 
#chains in the Genus database with same CATH homology
 5D3S A;  5EU1 A;  3LQI A;  5D3R A;  2F6N A;  5ENJ A;  4YYJ A;  5ETB A;  5TB6 A;  3UW9 A;  5HQ5 A;  3U5N A;  2RS9 B;  4CUP A;  3MUK A;  4NRB A;  4PCE A;  5CY9 A;  4Z1S A;  4MR5 A;  5EV9 A;  4NR9 A;  4TT4 A;  4O76 A;  5FE2 A;  4NRA A;  4J0R A;  4XY8 A;  4HBV A;  3JVM A;  4QC3 A;  5FE1 A;  5HFR A;  4YAX A;  3U5M A;  2E3K A;  5J0D A;  4J1P A;  4HBW A;  2E7N A;  5C85 A;  4CLB A;  4NYX A;  4BW1 A;  4YYN A;  5A5N A;  5A5P A;  5IGN A;  4QSU A;  3JVK A;  3SVG A;  5LJ1 A;  5AD3 A;  5EPB A;  4BW4 A;  5FE0 A;  5CU8 A;  4TT2 A;  5FBX A;  5FE4 A;  4MEO A;  3LJW A;  3QZS A;  5DYU A;  4CFL A;  4UIX A;  4Z1Q A;  5LKU A;  3Q2E A;  3DAI A;  4YYK A;  5CQ3 A;  4WHW A;  5LVR A;  5D3J A;  4N4I A;  5F25 A;  5FH7 A;  4Z6I A;  4PTB A;  4F3I A;  4LYS A;  5F62 A;  2RNX A;  2GRC A;  4O71 A;  3UV2 A;  2YEL A;  4N4F A;  4WIV A;  2D82 A;  5FB1 A;  2RNY A;  5HRX A;  5D3L A;  5EWH A;  4YYH A;  3LQJ A;  4QB3 A;  5DYA A;  5EWW A;  5COI A;  4IR4 A;  4KV1 A;  5C7N A;  2OO1 A;  3AQA A;  4O74 A;  4DON A;  5LKZ A;  5FE5 A;  4O70 A;  3LXJ A;  4YAT A;  4OGI A;  4IOO A;  5F36 A;  5FB0 A;  4NYW A;  4BHW A;  4QYL A;  4NR7 A;  4O75 A;  5A5R A;  4LYW A;  3UVW A;  3MB3 A;  5A7C A;  4KCX A;  4YY6 A;  4UYD A;  2D9E A;  1E6I A;  4BW2 A;  3K2J A;  5E0R A;  4HXS A;  5CQA A;  3U5L A;  4A9N A;  5DYX A;  5KU3 A;  4BJX A;  5I7Y A;  5DLX A;  4QEU A;  4YYD A;  4MEQ A;  5EWV A;  4UYF B;  3U5O A;  4NQM A;  4C67 A;  4HXN A;  5EPS A;  4YYG A;  4Z6H A;  2I8N A;  5JI8 A;  5FE9 A;  4GPJ A;  4MR6 A;  5DLZ A;  4O7C A;  5DX4 A;  3MUL A;  4NQN A;  5DBM A;  5HQ6 A;  4UIU A;  2YEK A;  5CTL A;  4CUS A;  2DVS A;  4UYG A;  4TU6 A;  5EIC A;  5H85 A;  4O78 A;  4UIT A;  2H60 A;  5CQ7 A;  3AAD A;  5FE7 A;  2I7K A;  5I40 A;  5HFQ A;  5K29 A;  5C89 A;  3O33 A;  4NRC A;  4TQN A;  4ZW1 A;  5KTX A;  5EK9 A;  5LKT A;  4CL9 A;  3UV4 A;  5CP5 A;  4MEN A;  5E3G A;  4A9L A;  5HQ7 A;  5IGK A;  2F6J A;  5L99 A;  4CUU A;  5HRV A;  2WP1 A;  5II1 A;  4O77 A;  4LC2 A;  4O72 A;  4HXL A;  5KO4 A;  5BT5 A;  4QC1 A;  5E9I A;  5A85 A;  5D3N A;  3P1F A;  5G4S A;  3UVX A;  1F68 A;  2YQD A;  4O7E A;  4A9F A;  5I1Q A;  5ENB A;  3MXF A;  4Z93 A;  4YYI A;  5BT4 A;  4BW3 A;  5I29 A;  4N4G A;  5CUC A;  4NUD A;  5E9K A;  5JWM A;  4XUB A;  5I86 A;  5FG6 A;  3FKM X;  3QZV A;  4UYE A;  5FFW A;  4O7A A;  3GG3 A;  4MR4 A;  4J3I A;  5F2P A;  3UVD A;  2R0Y A;  3MB4 A;  5FH6 A;  3P1D A;  4PKL A;  5A83 A;  5C8G A;  5E9V A;  5AME A;  2G4A A;  4NYV A;  5CUG A;  5EQ1 A;  5I88 A;  2OSS A;  5CS8 A;  3TLP A;  2YYN A;  4WHU A;  3S91 A;  3P1C A;  4QY4 A;  4LZS A;  5E9L A;  5CUA A;  2LSP B;  4QEW A;  4YBS A;  5D3H A;  4ALG A;  2DKW A;  4QSS A;  5L97 A;  3HME A;  4QEV A;  5C87 A;  1JSP B;  3UVY A;  5FG4 A;  5ENG A;  4X2I A;  5H1U A;  4LR6 A;  1X0J A;  3D7C A;  4A9H A;  3P1E A;  3O35 A;  2R0S A;  3HMH A;  5F63 A;  2DAT A;  5I80 A;  4HXK A;  5FFV A;  4MEP A;  4N3W A;  2DWW A;  4NXJ A;  5FE6 A;  5TCM A;  4YAD A;  2N9G A;  4TS8 A;  5H1T A;  1ZS5 A;  4QSW A;  5AMF A;  4TZ2 A;  4YYM A;  5DW2 A;  5CFW A;  2RO1 A;  5F1H A;  4LZ2 A;  5D24 A;  5CUB A;  3ZYU A;  5EP7 A;  5D0C A;  4Q0N A;  5ACY A;  4UIY A;  2DVQ A;  4IR5 A;  4HBY A;  4IR3 A;  3O34 A;  5LUU A;  3SVH A;  5ENC A;  4PY6 A;  3G0J A;  1N72 A;  4A9E A;  3DWY A;  5CZG A;  5E3D A;  4FLP A;  5AD2 A;  2RI7 A;  5IGM A;  5CRZ A;  5E74 A;  5I83 A;  5D26 A;  5I89 A;  5A81 A;  5CUE A;  3HMF A;  4QSP A;  5A82 A;  4PS5 A;  3S92 A;  2YDW A;  4Q0O A;  5DFD A;  5EWD A;  4NR8 A;  5ENF A;  4C66 A;  5E7D A;  4A9J A;  2OUO A;  4YBT A;  5CQ5 A;  4LRG A;  5A5S A;  4QST A;  5FH8 A;  4O7B A;  4NR4 A;  5DW1 A;  5LJ2 A;  4TU4 A;  5D7X A;  4NR5 A;  5CQ4 A;  5L8U A;  5LJ0 A;  2E7O A;  5EI4 A;  2YW5 A;  5DKC A;  3ONI A;  5L8T A;  4QYD A;  4HXR A;  5CUD A;  4Y03 A;  5FE3 A;  5KHM A;  5F5Z A;  4TTE A;  4YC9 A;  5I7X A;  4OGJ A;  3I3J A;  4LYI A;  5DYC A;  4QR4 A;  4N4H A;  5IBN A;  4A9O A;  5FE8 A;  4RVR A;  5E9M A;  5EA1 A;  4QUT A;  5A5O A;  4QR3 A;  3G0L A;  5FG5 A;  4LDF A;  5IID A;  3LQH A;  4O7F A;  1EQF A;  4A9M A;  4NUC A;  2NXB A;  5E73 A;  5DKH A;  4UYH A;  4ZQL A;  4QSQ A;  5IGL A;  5KTW A;  4A9I A;  5CPE A;  5G4R A;  5L96 A;  4CUQ A;  5DKD A;  4HBX A;  3U5J A;  2L85 A;  4HXO A;  4MR3 A;  5HRW A;  3QZT A;  2KTB B;  3UV5 A;  4IOQ A;  4NR6 A;  5ENI A;  4TYL A;  2DVV A;  3SVF A;  4QNS A;  4QSR A;  3IU6 A;  4QSX A;  3JVJ A;  2R10 A;  5EPR A;  5F1L A;  4ALH A;  5HEL A;  5CQ8 A;  5F3A A;  4J0S A;  4YK0 A;  5LVQ A;  3RCW A;  5DFB A;  4QBM A;  4XUA A;  4HXP A;  5LKX A;  4IOR A;  5E9Y A;  4OUF A;  5CRM A;  1WUG A;  5HCL A;  5D3P A;  5L98 A;  2FSA A;  5ENH A;  5FDZ A;  4A9K A;  5F61 A;  3NXB A;  3IU5 A;  4IR6 A;  4XY9 A;  3MQM A;  4KV4 A;  5D3T A;  4YAB A;  4YBM A;  4QR5 A;  5ETD A;  1WUM A;  5C4Q A;  3O37 A;  3P5O A;  4QUU A;  4NUE A;  4HXM A;  5CGP A;  4ZC9 A;  2L5E A;  5EIS A;  5IG6 A;  5ENE A;  5FFY A;  4E96 A;  3O36 A;  2R0V A;  2DVR A;  5EWC A;  3U5K A;  5HM0 A;  5HEN A;  2MJV B;  5KTU A;  4YY4 A;  4CUR A;  5A5Q A;  2L84 A;  5CQ6 A;  5HEM A;  5HJC A;  5II2 A;  2WP2 A;  4QSV A;  5DFC A;  5DY7 A;  5BT3 A;  3JVL A;  5D25 A;  4UYF A;  2RFJ A;  3Q2F A;  4UIV A;  4UIZ A;  4LZR A;  4UIW A;  5EGU A;  4TT6 A;  5F60 A;  5HLS A;  4YH3 A;  2RNW A;  5EVA A;  4NS5 A;  1JM4 B;  4YH4 A;  4CUT A;  4AKN A;  4TZ8 A;  4CFK A;  4XYA A;  2YEM A;  3U5P A;  5CQT A;  4QZS A;  4PCI A;  5EM3 A;  5H1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...