2YYNA

Crystal sturcture of human bromodomain protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
KLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription intermediary factor 1-alpha
publication title Crystal sturcture of human bromodomain protein
rcsb
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yynA00
4QSTA 4WIVA 3S92A 5AD3A 4CL9A 5CQ8A 3SVGA 4UYFA 4OUFA 5EVAA 5I80A 5IGKA 2F6NA 5EU1A 3UW9A 4O72A 4NYXA 4QR5A 4QSWA 4A9KA 5DKHA 4HBWA 5ENGA 5HM0A 5D3TA 4UYEA 5HLSA 5HFQA 3QZTA 5AMFA 5EA1A 4YBSA 2F6JA 3ONIA 5DW2A 5D25A 4O75A 5F3AA 5F1HA 1JM4B 5L8TA 4TT6A 5F5ZA 5I29A 5L99A 3RCWA 4HXRA 4NRBA 5C85A 5FDZA 3JVLA 4GPJA 4MR5A 5FFYA 5J0DA 4CUPA 4NR5A 3FKMX 4QSPA 4NXJA 2E3KA 4ZQLA 5CFWA 5E9VA 4IR4A 4O78A 5ACYA 2YYNA 4YYMA 5LJ1A 2L85A 4UIXA 4BHWA 3AADA 5A5SA 4CFKA 2RO1A 3UVWA 4LR6A 4DONA 5CP5A 5II1A 2I7KA 4N4FA 4MR6A 5HRXA 4J1PA 2RS9B 5DYAA 3AQAA 4KCXA 4IR6A 5HQ5A 5E9IA 5FFVA 5ENBA 1E6IA 5CQ6A 4HXMA 2GRCA 5CY9A 4YY6A 5KTXA 5DY7A 4RVRA 3LQIA 3G0JA 5BT3A 5CUGA 3UV5A 5A5OA 4TT4A 5HFRA 4CUUA 5C7NA 4BJXA 5DKDA 2YW5A 3Q2EA 4TQNA 3UVDA 4QSQA 5FB1A 3O34A 4X2IA 5IGMA 4HXSA 5G4SA 2OSSA 4LRGA 5CS8A 5D24A 5I40A 3UV4A 4J0RA 2YDWA 4LZ2A 1X0JA 5HQ6A 4ALGA 3U5MA 4O7CA 5EWWA 4PS5A 4O7EA 5DBMA 5C89A 5HRWA 3IU6A 3MB4A 4IR5A 4O74A 5FE3A 5D3NA 5I83A 4QSVA 5LKZA 5FG6A 1EQFA 2RNXA 4QSSA 5AD2A 5C8GA 2RI7A 5F61A 3U5OA 4QSXA 4UYDA 5EWDA 5ENIA 4BW4A 5LVQA 4HBYA 4YYHA 4N4GA 5D3SA 5I89A 5D7XA 5I86A 5CUCA 3TLPA 5JWMA 2YQDA 5EICA 5FE6A 5D3JA 5COIA 4QYLA 4IR3A 4C67A 2DATA 3SVFA 4N3WA 5HENA 4HXPA 5KTUA 3O33A 5HRVA 4A9IA 4UYHA 5HEMA 4Q0OA 5A85A 4CUTA 4HXNA 2RNYA 5L98A 5A5PA 2RNWA 5FBXA 4TU6A 4QR4A 2R0YA 4YK0A 5ENJA 4O71A 5EWVA 5AMEA 4QSUA 3I3JA 3D7CA 4QZSA 5CQ5A 2N9GA 2DVRA 4O70A 5F2PA 2LSPB 4C66A 5BT5A 2FSAA 2DKWA 5HELA 4A9HA 4UITA 3UVYA 2DWWA 5LKUA 5ENHA 4TT2A 4MR3A 5IIDA 3SVHA 5FE9A 5DYCA 2YEMA 5A82A 4QUTA 5EWHA 4Z6HA 4LC2A 4YAXA 5II2A 3Q2FA 4CFLA 4LZSA 3K2JA 5D3LA 3DAIA 3UV2A 4BW1A 2KTBB 5DX4A 5EPBA 3P5OA 2R10A 4O77A 3HMFA 2RFJA 4TYLA 4E96A 4ALHA 4CLBA 4QUUA 3LXJA 4MR4A 5FG5A 5CZGA 3MXFA 5E9KA 4A9JA 4NR8A 4O7FA 5F25A 5E74A 2NXBA 5E9LA 3MB3A 5DLZA 4A9LA 5CUEA 3LQJA 4F3IA 5F62A 4HBVA 4QB3A 5DKCA 4OGIA 4QBMA 4NR9A 5C4QA 1N72A 3UVXA 4PY6A 5EI4A 4TTEA 4UYFB 3JVMA 4QC1A 3U5NA 3JVKA 4NS5A 4FLPA 3O36A 4KV4A 4YBMA 4Z1SA 2D82A 4J3IA 5DFCA 4XYAA 4TZ2A 2I8NA 3MUKA 2L84A 5KO4A 5TB6A 5G4RA 4LYSA 3HMHA 4MEOA 4BW3A 5F1LA 5ETDA 5CRMA 5L96A 5ENCA 5CQ4A 4YYKA 5D0CA 4XUBA 3P1CA 4A9MA 5F63A 5CUDA 4YY4A 5I7YA 5H1UA 5D3HA 3U5KA 4Z1QA 5CUAA 5CQAA 4XY8A 5A5QA 5I7XA 4Y03A 5A5NA 5ENEA 3U5JA 2WP1A 5DFBA 1ZS5A 3G0LA 4O7AA 5D3PA 5ENFA 2E7OA 5D3RA 4O7BA 5EQ1A 4NYWA 4OGJA 5E9MA 5F36A 2R0VA 5EWCA 2L5EA 5IG6A 4YATA 4AKNA 5FE8A 5LJ2A 4YABA 4QYDA 2DVQA 3QZSA 5EGUA 4CUSA 5FE4A 2OUOA 4QSRA 2YEKA 5EK9A 4YADA 3LJWA 4NRAA 5EISA 4QNSA 4HXKA 4QY4A 3JVJA 5DYXA 5LUUA 4PTBA 4IOOA 3HMEA 5LKTA 4KV1A 3ZYUA 5ETBA 5LJ0A 4MEQA 5A81A 5IGNA 4CURA 4NYVA 5KTWA 4YYNA 5H1TA 4YC9A 4NR4A 5L97A 4O76A 5DLXA 4ZW1A 5JI8A 5D26A 5IBNA 4A9OA 5CQTA 5E3GA 5CQ7A 4Z6IA 2WP2A 5CTLA 3MQMA 4YYDA 4BW2A 4UYGA 5FE1A 5E73A 1WUMA 5EPRA 4HXLA 5DFDA 5H85A 4A9NA 4LDFA 5IGLA 5A5RA 4YYGA 5KU3A 4LYIA 5FE0A 2DVSA 2R0SA 2E7NA 5C87A 5EPSA 2G4AA 5FG4A 5EV9A 5A83A 5I1QA 5LKXA 4NUEA 1WUGA 3U5LA 5EM3A 2MJVB 5CU8A 4QEVA 5H1VA 4PCEA 4Z93A 4MEPA 4Q0NA 4LYWA 4TU4A 3LQHA 1F68A 2H60A 4YH4A 5FFWA 4PKLA 4HXOA 4IORA 4UIUA 4N4HA 5FH8A 3MULA 5FE5A 5CUBA 4WHWA 4QEWA 4QC3A 2D9EA 5HQ7A 3DWYA 4MENA 4CUQA 4YYJA 4ZC9A 5FB0A 4LZRA 4UIYA 4NUCA 5CPEA 5FE7A 4XY9A 4QEUA 5HCLA 5I88A 5E7DA 5KHMA 5LVRA 5FH7A 4NQNA 3P1EA 5E9YA 4YYIA 4WHUA 4QR3A 2OO1A 1JSPB 4PCIA 4TZ8A 4NRCA 5DYUA 4HBXA 4A9FA 2DVVA 2YELA 3S91A 5FE2A 4N4IA 5BT4A 5K29A 3P1DA 5DW1A 4UIZA 5A7CA 4J0SA 4YBTA 4NR6A 3IU5A 5TCMA 3QZVA 5F60A 4A9EA 4NUDA 4UIWA 5L8UA 4YH3A 3P1FA 5HJCA 4XUAA 4NQMA 4IOQA 4NR7A 3U5PA 5EP7A 5E3DA 3O35A 3O37A 3NXBA 3GG3A 4UIVA 5CRZA 5FH6A 5CGPA 5E0RA 4TS8A 5CQ3A
chains in the Genus database with same CATH superfamily
4QSTA 4WIVA 3S92A 5AD3A 4CL9A 5CQ8A 3SVGA 4UYFA 4OUFA 5EVAA 5I80A 5IGKA 2F6NA 5EU1A 3UW9A 4O72A 4NYXA 4QR5A 4QSWA 4A9KA 5DKHA 4HBWA 5ENGA 5HM0A 5D3TA 4UYEA 5HLSA 5HFQA 3QZTA 5AMFA 5EA1A 4YBSA 2F6JA 3ONIA 5DW2A 5D25A 4O75A 5F3AA 5F1HA 1JM4B 5L8TA 4TT6A 5F5ZA 5I29A 5L99A 3RCWA 4HXRA 4NRBA 5C85A 5FDZA 3JVLA 4GPJA 4MR5A 5FFYA 5J0DA 4CUPA 4NR5A 3FKMX 4QSPA 4NXJA 2E3KA 4ZQLA 5CFWA 5E9VA 4IR4A 4O78A 5ACYA 2YYNA 4YYMA 5LJ1A 2L85A 4UIXA 4BHWA 3AADA 5A5SA 4CFKA 2RO1A 3UVWA 4LR6A 4DONA 5CP5A 5II1A 2I7KA 4N4FA 4MR6A 5HRXA 4J1PA 2RS9B 5DYAA 3AQAA 4KCXA 4IR6A 5HQ5A 5E9IA 5FFVA 5ENBA 1E6IA 5CQ6A 4HXMA 2GRCA 5CY9A 4YY6A 5KTXA 5DY7A 4RVRA 3LQIA 3G0JA 5BT3A 5CUGA 3UV5A 5A5OA 4TT4A 5HFRA 4CUUA 5C7NA 4BJXA 5DKDA 2YW5A 3Q2EA 4TQNA 3UVDA 4QSQA 5FB1A 3O34A 4X2IA 5IGMA 4HXSA 5G4SA 3D1DA 2OSSA 4LRGA 5CS8A 5D24A 5I40A 3UV4A 4J0RA 2YDWA 4LZ2A 1X0JA 5HQ6A 4ALGA 3U5MA 4O7CA 5EWWA 4PS5A 4O7EA 5DBMA 5C89A 5HRWA 3IU6A 3MB4A 4IR5A 4O74A 5FE3A 5D3NA 5I83A 4QSVA 5LKZA 5FG6A 1EQFA 2RNXA 4QSSA 5AD2A 5C8GA 2RI7A 5F61A 3U5OA 4QSXA 4UYDA 5EWDA 5ENIA 4BW4A 5LVQA 4HBYA 4YYHA 4N4GA 5D3SA 5I89A 5D7XA 5I86A 5CUCA 3TLPA 5JWMA 2YQDA 5EICA 5FE6A 5D3JA 5COIA 4QYLA 4IR3A 4C67A 2DATA 3SVFA 4N3WA 5HENA 4HXPA 5KTUA 3O33A 5HRVA 4A9IA 4UYHA 5HEMA 4Q0OA 5A85A 4CUTA 4HXNA 2RNYA 5L98A 5A5PA 2RNWA 5FBXA 4TU6A 4QR4A 2R0YA 4YK0A 5ENJA 4O71A 5EWVA 5AMEA 4QSUA 3I3JA 3D7CA 4QZSA 1PUOA 5CQ5A 2N9GA 4AI6A 2DVRA 4O70A 5F2PA 2LSPB 4C66A 5BT5A 2FSAA 2DKWA 5HELA 4A9HA 4UITA 3UVYA 2DWWA 5LKUA 5ENHA 4TT2A 4MR3A 5IIDA 3SVHA 5FE9A 5DYCA 2YEMA 5A82A 4QUTA 5EWHA 4Z6HA 4LC2A 4YAXA 5II2A 3Q2FA 4CFLA 4LZSA 3K2JA 5D3LA 3DAIA 3UV2A 4BW1A 2KTBB 5DX4A 5EPBA 3P5OA 2R10A 4O77A 3HMFA 2RFJA 4TYLA 4E96A 4ALHA 4CLBA 4QUUA 3LXJA 4MR4A 5FG5A 5CZGA 3ERRA 3MXFA 5E9KA 4A9JA 4NR8A 4O7FA 5F25A 5E74A 2NXBA 5E9LA 3MB3A 5DLZA 4A9LA 5CUEA 2EJNA 3LQJA 4F3IA 5F62A 4HBVA 4QB3A 5DKCA 4OGIA 4QBMA 4NR9A 5C4QA 1N72A 4AKHA 3UVXA 4PY6A 5EI4A 4TTEA 4UYFB 3JVMA 4QC1A 3U5NA 3JVKA 4NS5A 4FLPA 3O36A 4KV4A 4YBMA 4Z1SA 2D82A 4J3IA 5DFCA 4XYAA 4TZ2A 2I8NA 3MUKA 2L84A 5KO4A 5TB6A 5G4RA 4LYSA 3HMHA 4MEOA 4BW3A 5F1LA 5ETDA 5CRMA 5L96A 5ENCA 5CQ4A 4YYKA 4AKGA 5D0CA 4XUBA 3P1CA 4A9MA 5F63A 5CUDA 4YY4A 5I7YA 5H1UA 5D3HA 3U5KA 4Z1QA 5CUAA 5CQAA 4XY8A 5A5QA 5I7XA 4Y03A 5A5NA 5ENEA 3U5JA 2WP1A 5DFBA 1ZS5A 3G0LA 4O7AA 5D3PA 5ENFA 2E7OA 5D3RA 4O7BA 5EQ1A 4NYWA 4OGJA 5E9MA 5F36A 2R0VA 5EWCA 2L5EA 5IG6A 4YATA 4AKNA 5FE8A 5LJ2A 3VKHA 4YABA 4QYDA 2DVQA 3QZSA 5EGUA 4CUSA 5FE4A 2OUOA 4QSRA 2YEKA 5EK9A 4YADA 3LJWA 4NRAA 5EISA 4QNSA 4HXKA 4QY4A 3JVJA 5DYXA 5LUUA 4PTBA 4IOOA 3HMEA 5LKTA 4KV1A 3ZYUA 5ETBA 5LJ0A 4MEQA 5A81A 5IGNA 4CURA 4NYVA 5KTWA 4YYNA 5H1TA 4YC9A 4NR4A 4AKIA 5L97A 4O76A 5DLXA 4ZW1A 5JI8A 5D26A 5IBNA 4A9OA 5CQTA 5E3GA 5CQ7A 4Z6IA 2WP2A 5CTLA 3MQMA 4YYDA 4BW2A 4UYGA 5FE1A 5E73A 1WUMA 5EPRA 4HXLA 5DFDA 5H85A 4A9NA 4LDFA 5IGLA 5A5RA 4YYGA 5KU3A 4LYIA 5FE0A 2DVSA 2R0SA 2E7NA 5C87A 5EPSA 2G4AA 5FG4A 5EV9A 5A83A 5I1QA 5LKXA 4NUEA 1WUGA 3U5LA 5EM3A 2MJVB 5CU8A 4QEVA 5H1VA 4PCEA 3VKGA 4Z93A 4MEPA 4Q0NA 1ZKRA 4LYWA 4TU4A 3LQHA 1F68A 2H60A 4YH4A 5FFWA 4PKLA 4HXOA 4IORA 4UIUA 4N4HA 5FH8A 3MULA 5FE5A 5CUBA 4WHWA 4QEWA 4QC3A 2D9EA 5HQ7A 3DWYA 4MENA 4CUQA 4YYJA 4ZC9A 5FB0A 4LZRA 4UIYA 4NUCA 5CPEA 5FE7A 4XY9A 4QEUA 5HCLA 5I88A 5E7DA 5KHMA 5LVRA 5FH7A 4NQNA 3P1EA 5E9YA 4YYIA 4WHUA 4QR3A 2OO1A 1JSPB 4PCIA 4TZ8A 4NRCA 5DYUA 4HBXA 4A9FA 2DVVA 2YELA 3S91A 5FE2A 4N4IA 5BT4A 5K29A 3P1DA 5DW1A 4UIZA 5A7CA 4J0SA 4YBTA 4NR6A 3IU5A 5TCMA 3QZVA 5F60A 4A9EA 4NUDA 4UIWA 5L8UA 4YH3A 3P1FA 5HJCA 4XUAA 4NQMA 4IOQA 4NR7A 3U5PA 5EP7A 5E3DA 3O35A 3O37A 3NXBA 3D1BA 3GG3A 4UIVA 5CRZA 5FH6A 5CGPA 5E0RA 4TS8A 5CQ3A
chains in the Genus database with same CATH topology
4QSTA 4WIVA 3S92A 5AD3A 4CL9A 5CQ8A 3SVGA 4UYFA 4OUFA 5EVAA 5I80A 5IGKA 2F6NA 5EU1A 3UW9A 4O72A 4NYXA 4QR5A 4QSWA 4A9KA 5DKHA 4HBWA 5ENGA 5HM0A 5D3TA 4UYEA 5HLSA 5HFQA 3QZTA 5AMFA 5EA1A 4YBSA 2F6JA 3ONIA 5DW2A 5D25A 4O75A 5F3AA 5F1HA 1JM4B 5L8TA 4TT6A 5F5ZA 5I29A 5L99A 3RCWA 4HXRA 4NRBA 5C85A 5FDZA 3JVLA 4GPJA 4MR5A 5FFYA 5J0DA 4CUPA 4NR5A 3FKMX 4QSPA 4NXJA 2E3KA 4ZQLA 5CFWA 5E9VA 4IR4A 4O78A 5ACYA 2YYNA 4YYMA 5LJ1A 2L85A 4UIXA 4BHWA 3AADA 5A5SA 4CFKA 2RO1A 3UVWA 4LR6A 4DONA 5CP5A 5II1A 2I7KA 4N4FA 4MR6A 5HRXA 4J1PA 2RS9B 5DYAA 3AQAA 4KCXA 4IR6A 5HQ5A 5E9IA 5FFVA 5ENBA 1E6IA 5CQ6A 4HXMA 2GRCA 5CY9A 4YY6A 5KTXA 5DY7A 4RVRA 3LQIA 3G0JA 5BT3A 5CUGA 3UV5A 5A5OA 4TT4A 5HFRA 4CUUA 5C7NA 4BJXA 5DKDA 2YW5A 3Q2EA 4TQNA 3UVDA 4QSQA 5FB1A 3O34A 4X2IA 5IGMA 4HXSA 5G4SA 2OSSA 4LRGA 5CS8A 5D24A 5I40A 3UV4A 4J0RA 2YDWA 4LZ2A 1X0JA 5HQ6A 4ALGA 3U5MA 4O7CA 5EWWA 4PS5A 4O7EA 5DBMA 5C89A 5HRWA 3IU6A 3MB4A 4IR5A 4O74A 5FE3A 5D3NA 5I83A 4QSVA 5LKZA 5FG6A 1EQFA 2RNXA 4QSSA 5AD2A 5C8GA 2RI7A 5F61A 3U5OA 4QSXA 4UYDA 5EWDA 5ENIA 4BW4A 5LVQA 4HBYA 4YYHA 4N4GA 5D3SA 5I89A 5D7XA 5I86A 5CUCA 3TLPA 5JWMA 2YQDA 5EICA 5FE6A 5D3JA 5COIA 4QYLA 4IR3A 4C67A 2DATA 3SVFA 4N3WA 5HENA 4HXPA 5KTUA 3O33A 5HRVA 4A9IA 4UYHA 5HEMA 4Q0OA 5A85A 4CUTA 4HXNA 2RNYA 5L98A 5A5PA 2RNWA 5FBXA 4TU6A 4QR4A 2R0YA 4YK0A 5ENJA 4O71A 5EWVA 5AMEA 4QSUA 3I3JA 3D7CA 4QZSA 5CQ5A 2N9GA 2DVRA 4O70A 5F2PA 2LSPB 4C66A 5BT5A 2FSAA 2DKWA 5HELA 4A9HA 4UITA 3UVYA 2DWWA 5LKUA 5ENHA 4TT2A 4MR3A 5IIDA 3SVHA 5FE9A 5DYCA 2YEMA 5A82A 4QUTA 5EWHA 4Z6HA 4LC2A 4YAXA 5II2A 3Q2FA 4CFLA 4LZSA 3K2JA 5D3LA 3DAIA 3UV2A 4BW1A 2KTBB 5DX4A 5EPBA 3P5OA 2R10A 4O77A 3HMFA 2RFJA 4TYLA 4E96A 4ALHA 4CLBA 4QUUA 3LXJA 4MR4A 5FG5A 5CZGA 3MXFA 5E9KA 4A9JA 4NR8A 4O7FA 5F25A 5E74A 2NXBA 5E9LA 3MB3A 5DLZA 4A9LA 5CUEA 3LQJA 4F3IA 5F62A 4HBVA 4QB3A 5DKCA 4OGIA 4QBMA 4NR9A 5C4QA 1N72A 3UVXA 4PY6A 5EI4A 4TTEA 4UYFB 3JVMA 4QC1A 3U5NA 3JVKA 4NS5A 4FLPA 3O36A 4KV4A 4YBMA 4Z1SA 2D82A 4J3IA 5DFCA 4XYAA 4TZ2A 2I8NA 3MUKA 2L84A 5KO4A 5TB6A 5G4RA 4LYSA 3HMHA 4MEOA 4BW3A 5F1LA 5ETDA 5CRMA 5L96A 5ENCA 5CQ4A 4YYKA 5D0CA 4XUBA 3P1CA 4A9MA 5F63A 5CUDA 4YY4A 5I7YA 5H1UA 5D3HA 3U5KA 4Z1QA 5CUAA 5CQAA 4XY8A 5A5QA 5I7XA 4Y03A 5A5NA 5ENEA 3U5JA 2WP1A 5DFBA 1ZS5A 3G0LA 4O7AA 5D3PA 5ENFA 2E7OA 5D3RA 4O7BA 5EQ1A 4NYWA 4OGJA 5E9MA 5F36A 2R0VA 5EWCA 2L5EA 5IG6A 4YATA 4AKNA 5FE8A 5LJ2A 4YABA 4QYDA 2DVQA 3QZSA 5EGUA 4CUSA 5FE4A 2OUOA 4QSRA 2YEKA 5EK9A 4YADA 3LJWA 4NRAA 5EISA 4QNSA 4HXKA 4QY4A 3JVJA 5DYXA 5LUUA 4PTBA 4IOOA 3HMEA 5LKTA 4KV1A 3ZYUA 5ETBA 5LJ0A 4MEQA 5A81A 5IGNA 4CURA 4NYVA 5KTWA 4YYNA 5H1TA 4YC9A 4NR4A 5L97A 4O76A 5DLXA 4ZW1A 5JI8A 5D26A 5IBNA 4A9OA 5CQTA 5E3GA 5CQ7A 4Z6IA 2WP2A 5CTLA 3MQMA 4YYDA 4BW2A 4UYGA 5FE1A 5E73A 1WUMA 5EPRA 4HXLA 5DFDA 5H85A 4A9NA 4LDFA 5IGLA 5A5RA 4YYGA 5KU3A 4LYIA 5FE0A 2DVSA 2R0SA 2E7NA 5C87A 5EPSA 2G4AA 5FG4A 5EV9A 5A83A 5I1QA 5LKXA 4NUEA 1WUGA 3U5LA 5EM3A 2MJVB 5CU8A 4QEVA 5H1VA 4PCEA 4Z93A 4MEPA 4Q0NA 4LYWA 4TU4A 3LQHA 1F68A 2H60A 4YH4A 5FFWA 4PKLA 4HXOA 4IORA 4UIUA 4N4HA 5FH8A 3MULA 5FE5A 5CUBA 4WHWA 4QEWA 4QC3A 2D9EA 5HQ7A 3DWYA 4MENA 4CUQA 4YYJA 4ZC9A 5FB0A 4LZRA 4UIYA 4NUCA 5CPEA 5FE7A 4XY9A 4QEUA 5HCLA 5I88A 5E7DA 5KHMA 5LVRA 5FH7A 4NQNA 3P1EA 5E9YA 4YYIA 4WHUA 4QR3A 2OO1A 1JSPB 4PCIA 4TZ8A 4NRCA 5DYUA 4HBXA 4A9FA 2DVVA 2YELA 3S91A 5FE2A 4N4IA 5BT4A 5K29A 3P1DA 5DW1A 4UIZA 5A7CA 4J0SA 4YBTA 4NR6A 3IU5A 5TCMA 3QZVA 5F60A 4A9EA 4NUDA 4UIWA 5L8UA 4YH3A 3P1FA 5HJCA 4XUAA 4NQMA 4IOQA 4NR7A 3U5PA 5EP7A 5E3DA 3O35A 3O37A 3NXBA 3GG3A 4UIVA 5CRZA 5FH6A 5CGPA 5E0RA 4TS8A 5CQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QST A;  4WIV A;  3S92 A;  5AD3 A;  4CL9 A;  5CQ8 A;  3SVG A;  4UYF A;  4OUF A;  5EVA A;  5I80 A;  5IGK A;  2F6N A;  5EU1 A;  3UW9 A;  4O72 A;  4NYX A;  4QR5 A;  4QSW A;  4A9K A;  5DKH A;  4HBW A;  5ENG A;  5HM0 A;  5D3T A;  4UYE A;  5HLS A;  5HFQ A;  3QZT A;  5AMF A;  5EA1 A;  4YBS A;  2F6J A;  3ONI A;  5DW2 A;  5D25 A;  4O75 A;  5F3A A;  5F1H A;  1JM4 B;  5L8T A;  4TT6 A;  5F5Z A;  5I29 A;  5L99 A;  3RCW A;  4HXR A;  4NRB A;  5C85 A;  5FDZ A;  3JVL A;  4GPJ A;  4MR5 A;  5FFY A;  5J0D A;  4CUP A;  4NR5 A;  3FKM X;  4QSP A;  4NXJ A;  2E3K A;  4ZQL A;  5CFW A;  5E9V A;  4IR4 A;  4O78 A;  5ACY A;  2YYN A;  4YYM A;  5LJ1 A;  2L85 A;  4UIX A;  4BHW A;  3AAD A;  5A5S A;  4CFK A;  2RO1 A;  3UVW A;  4LR6 A;  4DON A;  5CP5 A;  5II1 A;  2I7K A;  4N4F A;  4MR6 A;  5HRX A;  4J1P A;  2RS9 B;  5DYA A;  3AQA A;  4KCX A;  4IR6 A;  5HQ5 A;  5E9I A;  5FFV A;  5ENB A;  1E6I A;  5CQ6 A;  4HXM A;  2GRC A;  5CY9 A;  4YY6 A;  5KTX A;  5DY7 A;  4RVR A;  3LQI A;  3G0J A;  5BT3 A;  5CUG A;  3UV5 A;  5A5O A;  4TT4 A;  5HFR A;  4CUU A;  5C7N A;  4BJX A;  5DKD A;  2YW5 A;  3Q2E A;  4TQN A;  3UVD A;  4QSQ A;  5FB1 A;  3O34 A;  4X2I A;  5IGM A;  4HXS A;  5G4S A;  2OSS A;  4LRG A;  5CS8 A;  5D24 A;  5I40 A;  3UV4 A;  4J0R A;  2YDW A;  4LZ2 A;  1X0J A;  5HQ6 A;  4ALG A;  3U5M A;  4O7C A;  5EWW A;  4PS5 A;  4O7E A;  5DBM A;  5C89 A;  5HRW A;  3IU6 A;  3MB4 A;  4IR5 A;  4O74 A;  5FE3 A;  5D3N A;  5I83 A;  4QSV A;  5LKZ A;  5FG6 A;  1EQF A;  2RNX A;  4QSS A;  5AD2 A;  5C8G A;  2RI7 A;  5F61 A;  3U5O A;  4QSX A;  4UYD A;  5EWD A;  5ENI A;  4BW4 A;  5LVQ A;  4HBY A;  4YYH A;  4N4G A;  5D3S A;  5I89 A;  5D7X A;  5I86 A;  5CUC A;  3TLP A;  5JWM A;  2YQD A;  5EIC A;  5FE6 A;  5D3J A;  5COI A;  4QYL A;  4IR3 A;  4C67 A;  2DAT A;  3SVF A;  4N3W A;  5HEN A;  4HXP A;  5KTU A;  3O33 A;  5HRV A;  4A9I A;  4UYH A;  5HEM A;  4Q0O A;  5A85 A;  4CUT A;  4HXN A;  2RNY A;  5L98 A;  5A5P A;  2RNW A;  5FBX A;  4TU6 A;  4QR4 A;  2R0Y A;  4YK0 A;  5ENJ A;  4O71 A;  5EWV A;  5AME A;  4QSU A;  3I3J A;  3D7C A;  4QZS A;  5CQ5 A;  2N9G A;  2DVR A;  4O70 A;  5F2P A;  2LSP B;  4C66 A;  5BT5 A;  2FSA A;  2DKW A;  5HEL A;  4A9H A;  4UIT A;  3UVY A;  2DWW A;  5LKU A;  5ENH A;  4TT2 A;  4MR3 A;  5IID A;  3SVH A;  5FE9 A;  5DYC A;  2YEM A;  5A82 A;  4QUT A;  5EWH A;  4Z6H A;  4LC2 A;  4YAX A;  5II2 A;  3Q2F A;  4CFL A;  4LZS A;  3K2J A;  5D3L A;  3DAI A;  3UV2 A;  4BW1 A;  2KTB B;  5DX4 A;  5EPB A;  3P5O A;  2R10 A;  4O77 A;  3HMF A;  2RFJ A;  4TYL A;  4E96 A;  4ALH A;  4CLB A;  4QUU A;  3LXJ A;  4MR4 A;  5FG5 A;  5CZG A;  3MXF A;  5E9K A;  4A9J A;  4NR8 A;  4O7F A;  5F25 A;  5E74 A;  2NXB A;  5E9L A;  3MB3 A;  5DLZ A;  4A9L A;  5CUE A;  3LQJ A;  4F3I A;  5F62 A;  4HBV A;  4QB3 A;  5DKC A;  4OGI A;  4QBM A;  4NR9 A;  5C4Q A;  1N72 A;  3UVX A;  4PY6 A;  5EI4 A;  4TTE A;  4UYF B;  3JVM A;  4QC1 A;  3U5N A;  3JVK A;  4NS5 A;  4FLP A;  3O36 A;  4KV4 A;  4YBM A;  4Z1S A;  2D82 A;  4J3I A;  5DFC A;  4XYA A;  4TZ2 A;  2I8N A;  3MUK A;  2L84 A;  5KO4 A;  5TB6 A;  5G4R A;  4LYS A;  3HMH A;  4MEO A;  4BW3 A;  5F1L A;  5ETD A;  5CRM A;  5L96 A;  5ENC A;  5CQ4 A;  4YYK A;  5D0C A;  4XUB A;  3P1C A;  4A9M A;  5F63 A;  5CUD A;  4YY4 A;  5I7Y A;  5H1U A;  5D3H A;  3U5K A;  4Z1Q A;  5CUA A;  5CQA A;  4XY8 A;  5A5Q A;  5I7X A;  4Y03 A;  5A5N A;  5ENE A;  3U5J A;  2WP1 A;  5DFB A;  1ZS5 A;  3G0L A;  4O7A A;  5D3P A;  5ENF A;  2E7O A;  5D3R A;  4O7B A;  5EQ1 A;  4NYW A;  4OGJ A;  5E9M A;  5F36 A;  2R0V A;  5EWC A;  2L5E A;  5IG6 A;  4YAT A;  4AKN A;  5FE8 A;  5LJ2 A;  4YAB A;  4QYD A;  2DVQ A;  3QZS A;  5EGU A;  4CUS A;  5FE4 A;  2OUO A;  4QSR A;  2YEK A;  5EK9 A;  4YAD A;  3LJW A;  4NRA A;  5EIS A;  4QNS A;  4HXK A;  4QY4 A;  3JVJ A;  5DYX A;  5LUU A;  4PTB A;  4IOO A;  3HME A;  5LKT A;  4KV1 A;  3ZYU A;  5ETB A;  5LJ0 A;  4MEQ A;  5A81 A;  5IGN A;  4CUR A;  4NYV A;  5KTW A;  4YYN A;  5H1T A;  4YC9 A;  4NR4 A;  5L97 A;  4O76 A;  5DLX A;  4ZW1 A;  5JI8 A;  5D26 A;  5IBN A;  4A9O A;  5CQT A;  5E3G A;  5CQ7 A;  4Z6I A;  2WP2 A;  5CTL A;  3MQM A;  4YYD A;  4BW2 A;  4UYG A;  5FE1 A;  5E73 A;  1WUM A;  5EPR A;  4HXL A;  5DFD A;  5H85 A;  4A9N A;  4LDF A;  5IGL A;  5A5R A;  4YYG A;  5KU3 A;  4LYI A;  5FE0 A;  2DVS A;  2R0S A;  2E7N A;  5C87 A;  5EPS A;  2G4A A;  5FG4 A;  5EV9 A;  5A83 A;  5I1Q A;  5LKX A;  4NUE A;  1WUG A;  3U5L A;  5EM3 A;  2MJV B;  5CU8 A;  4QEV A;  5H1V A;  4PCE A;  4Z93 A;  4MEP A;  4Q0N A;  4LYW A;  4TU4 A;  3LQH A;  1F68 A;  2H60 A;  4YH4 A;  5FFW A;  4PKL A;  4HXO A;  4IOR A;  4UIU A;  4N4H A;  5FH8 A;  3MUL A;  5FE5 A;  5CUB A;  4WHW A;  4QEW A;  4QC3 A;  2D9E A;  5HQ7 A;  3DWY A;  4MEN A;  4CUQ A;  4YYJ A;  4ZC9 A;  5FB0 A;  4LZR A;  4UIY A;  4NUC A;  5CPE A;  5FE7 A;  4XY9 A;  4QEU A;  5HCL A;  5I88 A;  5E7D A;  5KHM A;  5LVR A;  5FH7 A;  4NQN A;  3P1E A;  5E9Y A;  4YYI A;  4WHU A;  4QR3 A;  2OO1 A;  1JSP B;  4PCI A;  4TZ8 A;  4NRC A;  5DYU A;  4HBX A;  4A9F A;  2DVV A;  2YEL A;  3S91 A;  5FE2 A;  4N4I A;  5BT4 A;  5K29 A;  3P1D A;  5DW1 A;  4UIZ A;  5A7C A;  4J0S A;  4YBT A;  4NR6 A;  3IU5 A;  5TCM A;  3QZV A;  5F60 A;  4A9E A;  4NUD A;  4UIW A;  5L8U A;  4YH3 A;  3P1F A;  5HJC A;  4XUA A;  4NQM A;  4IOQ A;  4NR7 A;  3U5P A;  5EP7 A;  5E3D A;  3O35 A;  3O37 A;  3NXB A;  3GG3 A;  4UIV A;  5CRZ A;  5FH6 A;  5CGP A;  5E0R A;  4TS8 A;  5CQ3 A; 
#chains in the Genus database with same CATH topology
 4QST A;  4WIV A;  3S92 A;  5AD3 A;  4CL9 A;  5CQ8 A;  3SVG A;  4UYF A;  4OUF A;  5EVA A;  5I80 A;  5IGK A;  2F6N A;  5EU1 A;  3UW9 A;  4O72 A;  4NYX A;  4QR5 A;  4QSW A;  4A9K A;  5DKH A;  4HBW A;  5ENG A;  5HM0 A;  5D3T A;  4UYE A;  5HLS A;  5HFQ A;  3QZT A;  5AMF A;  5EA1 A;  4YBS A;  2F6J A;  3ONI A;  5DW2 A;  5D25 A;  4O75 A;  5F3A A;  5F1H A;  1JM4 B;  5L8T A;  4TT6 A;  5F5Z A;  5I29 A;  5L99 A;  3RCW A;  4HXR A;  4NRB A;  5C85 A;  5FDZ A;  3JVL A;  4GPJ A;  4MR5 A;  5FFY A;  5J0D A;  4CUP A;  4NR5 A;  3FKM X;  4QSP A;  4NXJ A;  2E3K A;  4ZQL A;  5CFW A;  5E9V A;  4IR4 A;  4O78 A;  5ACY A;  2YYN A;  4YYM A;  5LJ1 A;  2L85 A;  4UIX A;  4BHW A;  3AAD A;  5A5S A;  4CFK A;  2RO1 A;  3UVW A;  4LR6 A;  4DON A;  5CP5 A;  5II1 A;  2I7K A;  4N4F A;  4MR6 A;  5HRX A;  4J1P A;  2RS9 B;  5DYA A;  3AQA A;  4KCX A;  4IR6 A;  5HQ5 A;  5E9I A;  5FFV A;  5ENB A;  1E6I A;  5CQ6 A;  4HXM A;  2GRC A;  5CY9 A;  4YY6 A;  5KTX A;  5DY7 A;  4RVR A;  3LQI A;  3G0J A;  5BT3 A;  5CUG A;  3UV5 A;  5A5O A;  4TT4 A;  5HFR A;  4CUU A;  5C7N A;  4BJX A;  5DKD A;  2YW5 A;  3Q2E A;  4TQN A;  3UVD A;  4QSQ A;  5FB1 A;  3O34 A;  4X2I A;  5IGM A;  4HXS A;  5G4S A;  3D1D A;  2OSS A;  4LRG A;  5CS8 A;  5D24 A;  5I40 A;  3UV4 A;  4J0R A;  2YDW A;  4LZ2 A;  1X0J A;  5HQ6 A;  4ALG A;  3U5M A;  4O7C A;  5EWW A;  4PS5 A;  4O7E A;  5DBM A;  5C89 A;  5HRW A;  3IU6 A;  3MB4 A;  4IR5 A;  4O74 A;  5FE3 A;  5D3N A;  5I83 A;  4QSV A;  5LKZ A;  5FG6 A;  1EQF A;  2RNX A;  4QSS A;  5AD2 A;  5C8G A;  2RI7 A;  5F61 A;  3U5O A;  4QSX A;  4UYD A;  5EWD A;  5ENI A;  4BW4 A;  5LVQ A;  4HBY A;  4YYH A;  4N4G A;  5D3S A;  5I89 A;  5D7X A;  5I86 A;  5CUC A;  3TLP A;  5JWM A;  2YQD A;  5EIC A;  5FE6 A;  5D3J A;  5COI A;  4QYL A;  4IR3 A;  4C67 A;  2DAT A;  3SVF A;  4N3W A;  5HEN A;  4HXP A;  5KTU A;  3O33 A;  5HRV A;  4A9I A;  4UYH A;  5HEM A;  4Q0O A;  5A85 A;  4CUT A;  4HXN A;  2RNY A;  5L98 A;  5A5P A;  2RNW A;  5FBX A;  4TU6 A;  4QR4 A;  2R0Y A;  4YK0 A;  5ENJ A;  4O71 A;  5EWV A;  5AME A;  4QSU A;  3I3J A;  3D7C A;  4QZS A;  1PUO A;  5CQ5 A;  2N9G A;  4AI6 A;  2DVR A;  4O70 A;  5F2P A;  2LSP B;  4C66 A;  5BT5 A;  2FSA A;  2DKW A;  5HEL A;  4A9H A;  4UIT A;  3UVY A;  2DWW A;  5LKU A;  5ENH A;  4TT2 A;  4MR3 A;  5IID A;  3SVH A;  5FE9 A;  5DYC A;  2YEM A;  5A82 A;  4QUT A;  5EWH A;  4Z6H A;  4LC2 A;  4YAX A;  5II2 A;  3Q2F A;  4CFL A;  4LZS A;  3K2J A;  5D3L A;  3DAI A;  3UV2 A;  4BW1 A;  2KTB B;  5DX4 A;  5EPB A;  3P5O A;  2R10 A;  4O77 A;  3HMF A;  2RFJ A;  4TYL A;  4E96 A;  4ALH A;  4CLB A;  4QUU A;  3LXJ A;  4MR4 A;  5FG5 A;  5CZG A;  3ERR A;  3MXF A;  5E9K A;  4A9J A;  4NR8 A;  4O7F A;  5F25 A;  5E74 A;  2NXB A;  5E9L A;  3MB3 A;  5DLZ A;  4A9L A;  5CUE A;  2EJN A;  3LQJ A;  4F3I A;  5F62 A;  4HBV A;  4QB3 A;  5DKC A;  4OGI A;  4QBM A;  4NR9 A;  5C4Q A;  1N72 A;  4AKH A;  3UVX A;  4PY6 A;  5EI4 A;  4TTE A;  4UYF B;  3JVM A;  4QC1 A;  3U5N A;  3JVK A;  4NS5 A;  4FLP A;  3O36 A;  4KV4 A;  4YBM A;  4Z1S A;  2D82 A;  4J3I A;  5DFC A;  4XYA A;  4TZ2 A;  2I8N A;  3MUK A;  2L84 A;  5KO4 A;  5TB6 A;  5G4R A;  4LYS A;  3HMH A;  4MEO A;  4BW3 A;  5F1L A;  5ETD A;  5CRM A;  5L96 A;  5ENC A;  5CQ4 A;  4YYK A;  4AKG A;  5D0C A;  4XUB A;  3P1C A;  4A9M A;  5F63 A;  5CUD A;  4YY4 A;  5I7Y A;  5H1U A;  5D3H A;  3U5K A;  4Z1Q A;  5CUA A;  5CQA A;  4XY8 A;  5A5Q A;  5I7X A;  4Y03 A;  5A5N A;  5ENE A;  3U5J A;  2WP1 A;  5DFB A;  1ZS5 A;  3G0L A;  4O7A A;  5D3P A;  5ENF A;  2E7O A;  5D3R A;  4O7B A;  5EQ1 A;  4NYW A;  4OGJ A;  5E9M A;  5F36 A;  2R0V A;  5EWC A;  2L5E A;  5IG6 A;  4YAT A;  4AKN A;  5FE8 A;  5LJ2 A;  3VKH A;  4YAB A;  4QYD A;  2DVQ A;  3QZS A;  5EGU A;  4CUS A;  5FE4 A;  2OUO A;  4QSR A;  2YEK A;  5EK9 A;  4YAD A;  3LJW A;  4NRA A;  5EIS A;  4QNS A;  4HXK A;  4QY4 A;  3JVJ A;  5DYX A;  5LUU A;  4PTB A;  4IOO A;  3HME A;  5LKT A;  4KV1 A;  3ZYU A;  5ETB A;  5LJ0 A;  4MEQ A;  5A81 A;  5IGN A;  4CUR A;  4NYV A;  5KTW A;  4YYN A;  5H1T A;  4YC9 A;  4NR4 A;  4AKI A;  5L97 A;  4O76 A;  5DLX A;  4ZW1 A;  5JI8 A;  5D26 A;  5IBN A;  4A9O A;  5CQT A;  5E3G A;  5CQ7 A;  4Z6I A;  2WP2 A;  5CTL A;  3MQM A;  4YYD A;  4BW2 A;  4UYG A;  5FE1 A;  5E73 A;  1WUM A;  5EPR A;  4HXL A;  5DFD A;  5H85 A;  4A9N A;  4LDF A;  5IGL A;  5A5R A;  4YYG A;  5KU3 A;  4LYI A;  5FE0 A;  2DVS A;  2R0S A;  2E7N A;  5C87 A;  5EPS A;  2G4A A;  5FG4 A;  5EV9 A;  5A83 A;  5I1Q A;  5LKX A;  4NUE A;  1WUG A;  3U5L A;  5EM3 A;  2MJV B;  5CU8 A;  4QEV A;  5H1V A;  4PCE A;  3VKG A;  4Z93 A;  4MEP A;  4Q0N A;  1ZKR A;  4LYW A;  4TU4 A;  3LQH A;  1F68 A;  2H60 A;  4YH4 A;  5FFW A;  4PKL A;  4HXO A;  4IOR A;  4UIU A;  4N4H A;  5FH8 A;  3MUL A;  5FE5 A;  5CUB A;  4WHW A;  4QEW A;  4QC3 A;  2D9E A;  5HQ7 A;  3DWY A;  4MEN A;  4CUQ A;  4YYJ A;  4ZC9 A;  5FB0 A;  4LZR A;  4UIY A;  4NUC A;  5CPE A;  5FE7 A;  4XY9 A;  4QEU A;  5HCL A;  5I88 A;  5E7D A;  5KHM A;  5LVR A;  5FH7 A;  4NQN A;  3P1E A;  5E9Y A;  4YYI A;  4WHU A;  4QR3 A;  2OO1 A;  1JSP B;  4PCI A;  4TZ8 A;  4NRC A;  5DYU A;  4HBX A;  4A9F A;  2DVV A;  2YEL A;  3S91 A;  5FE2 A;  4N4I A;  5BT4 A;  5K29 A;  3P1D A;  5DW1 A;  4UIZ A;  5A7C A;  4J0S A;  4YBT A;  4NR6 A;  3IU5 A;  5TCM A;  3QZV A;  5F60 A;  4A9E A;  4NUD A;  4UIW A;  5L8U A;  4YH3 A;  3P1F A;  5HJC A;  4XUA A;  4NQM A;  4IOQ A;  4NR7 A;  3U5P A;  5EP7 A;  5E3D A;  3O35 A;  3O37 A;  3NXB A;  3D1B A;  3GG3 A;  4UIV A;  5CRZ A;  5FH6 A;  5CGP A;  5E0R A;  4TS8 A;  5CQ3 A; 
#chains in the Genus database with same CATH homology
 4QST A;  4WIV A;  3S92 A;  5AD3 A;  4CL9 A;  5CQ8 A;  3SVG A;  4UYF A;  4OUF A;  5EVA A;  5I80 A;  5IGK A;  2F6N A;  5EU1 A;  3UW9 A;  4O72 A;  4NYX A;  4QR5 A;  4QSW A;  4A9K A;  5DKH A;  4HBW A;  5ENG A;  5HM0 A;  5D3T A;  4UYE A;  5HLS A;  5HFQ A;  3QZT A;  5AMF A;  5EA1 A;  4YBS A;  2F6J A;  3ONI A;  5DW2 A;  5D25 A;  4O75 A;  5F3A A;  5F1H A;  1JM4 B;  5L8T A;  4TT6 A;  5F5Z A;  5I29 A;  5L99 A;  3RCW A;  4HXR A;  4NRB A;  5C85 A;  5FDZ A;  3JVL A;  4GPJ A;  4MR5 A;  5FFY A;  5J0D A;  4CUP A;  4NR5 A;  3FKM X;  4QSP A;  4NXJ A;  2E3K A;  4ZQL A;  5CFW A;  5E9V A;  4IR4 A;  4O78 A;  5ACY A;  2YYN A;  4YYM A;  5LJ1 A;  2L85 A;  4UIX A;  4BHW A;  3AAD A;  5A5S A;  4CFK A;  2RO1 A;  3UVW A;  4LR6 A;  4DON A;  5CP5 A;  5II1 A;  2I7K A;  4N4F A;  4MR6 A;  5HRX A;  4J1P A;  2RS9 B;  5DYA A;  3AQA A;  4KCX A;  4IR6 A;  5HQ5 A;  5E9I A;  5FFV A;  5ENB A;  1E6I A;  5CQ6 A;  4HXM A;  2GRC A;  5CY9 A;  4YY6 A;  5KTX A;  5DY7 A;  4RVR A;  3LQI A;  3G0J A;  5BT3 A;  5CUG A;  3UV5 A;  5A5O A;  4TT4 A;  5HFR A;  4CUU A;  5C7N A;  4BJX A;  5DKD A;  2YW5 A;  3Q2E A;  4TQN A;  3UVD A;  4QSQ A;  5FB1 A;  3O34 A;  4X2I A;  5IGM A;  4HXS A;  5G4S A;  2OSS A;  4LRG A;  5CS8 A;  5D24 A;  5I40 A;  3UV4 A;  4J0R A;  2YDW A;  4LZ2 A;  1X0J A;  5HQ6 A;  4ALG A;  3U5M A;  4O7C A;  5EWW A;  4PS5 A;  4O7E A;  5DBM A;  5C89 A;  5HRW A;  3IU6 A;  3MB4 A;  4IR5 A;  4O74 A;  5FE3 A;  5D3N A;  5I83 A;  4QSV A;  5LKZ A;  5FG6 A;  1EQF A;  2RNX A;  4QSS A;  5AD2 A;  5C8G A;  2RI7 A;  5F61 A;  3U5O A;  4QSX A;  4UYD A;  5EWD A;  5ENI A;  4BW4 A;  5LVQ A;  4HBY A;  4YYH A;  4N4G A;  5D3S A;  5I89 A;  5D7X A;  5I86 A;  5CUC A;  3TLP A;  5JWM A;  2YQD A;  5EIC A;  5FE6 A;  5D3J A;  5COI A;  4QYL A;  4IR3 A;  4C67 A;  2DAT A;  3SVF A;  4N3W A;  5HEN A;  4HXP A;  5KTU A;  3O33 A;  5HRV A;  4A9I A;  4UYH A;  5HEM A;  4Q0O A;  5A85 A;  4CUT A;  4HXN A;  2RNY A;  5L98 A;  5A5P A;  2RNW A;  5FBX A;  4TU6 A;  4QR4 A;  2R0Y A;  4YK0 A;  5ENJ A;  4O71 A;  5EWV A;  5AME A;  4QSU A;  3I3J A;  3D7C A;  4QZS A;  5CQ5 A;  2N9G A;  2DVR A;  4O70 A;  5F2P A;  2LSP B;  4C66 A;  5BT5 A;  2FSA A;  2DKW A;  5HEL A;  4A9H A;  4UIT A;  3UVY A;  2DWW A;  5LKU A;  5ENH A;  4TT2 A;  4MR3 A;  5IID A;  3SVH A;  5FE9 A;  5DYC A;  2YEM A;  5A82 A;  4QUT A;  5EWH A;  4Z6H A;  4LC2 A;  4YAX A;  5II2 A;  3Q2F A;  4CFL A;  4LZS A;  3K2J A;  5D3L A;  3DAI A;  3UV2 A;  4BW1 A;  2KTB B;  5DX4 A;  5EPB A;  3P5O A;  2R10 A;  4O77 A;  3HMF A;  2RFJ A;  4TYL A;  4E96 A;  4ALH A;  4CLB A;  4QUU A;  3LXJ A;  4MR4 A;  5FG5 A;  5CZG A;  3MXF A;  5E9K A;  4A9J A;  4NR8 A;  4O7F A;  5F25 A;  5E74 A;  2NXB A;  5E9L A;  3MB3 A;  5DLZ A;  4A9L A;  5CUE A;  3LQJ A;  4F3I A;  5F62 A;  4HBV A;  4QB3 A;  5DKC A;  4OGI A;  4QBM A;  4NR9 A;  5C4Q A;  1N72 A;  3UVX A;  4PY6 A;  5EI4 A;  4TTE A;  4UYF B;  3JVM A;  4QC1 A;  3U5N A;  3JVK A;  4NS5 A;  4FLP A;  3O36 A;  4KV4 A;  4YBM A;  4Z1S A;  2D82 A;  4J3I A;  5DFC A;  4XYA A;  4TZ2 A;  2I8N A;  3MUK A;  2L84 A;  5KO4 A;  5TB6 A;  5G4R A;  4LYS A;  3HMH A;  4MEO A;  4BW3 A;  5F1L A;  5ETD A;  5CRM A;  5L96 A;  5ENC A;  5CQ4 A;  4YYK A;  5D0C A;  4XUB A;  3P1C A;  4A9M A;  5F63 A;  5CUD A;  4YY4 A;  5I7Y A;  5H1U A;  5D3H A;  3U5K A;  4Z1Q A;  5CUA A;  5CQA A;  4XY8 A;  5A5Q A;  5I7X A;  4Y03 A;  5A5N A;  5ENE A;  3U5J A;  2WP1 A;  5DFB A;  1ZS5 A;  3G0L A;  4O7A A;  5D3P A;  5ENF A;  2E7O A;  5D3R A;  4O7B A;  5EQ1 A;  4NYW A;  4OGJ A;  5E9M A;  5F36 A;  2R0V A;  5EWC A;  2L5E A;  5IG6 A;  4YAT A;  4AKN A;  5FE8 A;  5LJ2 A;  4YAB A;  4QYD A;  2DVQ A;  3QZS A;  5EGU A;  4CUS A;  5FE4 A;  2OUO A;  4QSR A;  2YEK A;  5EK9 A;  4YAD A;  3LJW A;  4NRA A;  5EIS A;  4QNS A;  4HXK A;  4QY4 A;  3JVJ A;  5DYX A;  5LUU A;  4PTB A;  4IOO A;  3HME A;  5LKT A;  4KV1 A;  3ZYU A;  5ETB A;  5LJ0 A;  4MEQ A;  5A81 A;  5IGN A;  4CUR A;  4NYV A;  5KTW A;  4YYN A;  5H1T A;  4YC9 A;  4NR4 A;  5L97 A;  4O76 A;  5DLX A;  4ZW1 A;  5JI8 A;  5D26 A;  5IBN A;  4A9O A;  5CQT A;  5E3G A;  5CQ7 A;  4Z6I A;  2WP2 A;  5CTL A;  3MQM A;  4YYD A;  4BW2 A;  4UYG A;  5FE1 A;  5E73 A;  1WUM A;  5EPR A;  4HXL A;  5DFD A;  5H85 A;  4A9N A;  4LDF A;  5IGL A;  5A5R A;  4YYG A;  5KU3 A;  4LYI A;  5FE0 A;  2DVS A;  2R0S A;  2E7N A;  5C87 A;  5EPS A;  2G4A A;  5FG4 A;  5EV9 A;  5A83 A;  5I1Q A;  5LKX A;  4NUE A;  1WUG A;  3U5L A;  5EM3 A;  2MJV B;  5CU8 A;  4QEV A;  5H1V A;  4PCE A;  4Z93 A;  4MEP A;  4Q0N A;  4LYW A;  4TU4 A;  3LQH A;  1F68 A;  2H60 A;  4YH4 A;  5FFW A;  4PKL A;  4HXO A;  4IOR A;  4UIU A;  4N4H A;  5FH8 A;  3MUL A;  5FE5 A;  5CUB A;  4WHW A;  4QEW A;  4QC3 A;  2D9E A;  5HQ7 A;  3DWY A;  4MEN A;  4CUQ A;  4YYJ A;  4ZC9 A;  5FB0 A;  4LZR A;  4UIY A;  4NUC A;  5CPE A;  5FE7 A;  4XY9 A;  4QEU A;  5HCL A;  5I88 A;  5E7D A;  5KHM A;  5LVR A;  5FH7 A;  4NQN A;  3P1E A;  5E9Y A;  4YYI A;  4WHU A;  4QR3 A;  2OO1 A;  1JSP B;  4PCI A;  4TZ8 A;  4NRC A;  5DYU A;  4HBX A;  4A9F A;  2DVV A;  2YEL A;  3S91 A;  5FE2 A;  4N4I A;  5BT4 A;  5K29 A;  3P1D A;  5DW1 A;  4UIZ A;  5A7C A;  4J0S A;  4YBT A;  4NR6 A;  3IU5 A;  5TCM A;  3QZV A;  5F60 A;  4A9E A;  4NUD A;  4UIW A;  5L8U A;  4YH3 A;  3P1F A;  5HJC A;  4XUA A;  4NQM A;  4IOQ A;  4NR7 A;  3U5P A;  5EP7 A;  5E3D A;  3O35 A;  3O37 A;  3NXB A;  3GG3 A;  4UIV A;  5CRZ A;  5FH6 A;  5CGP A;  5E0R A;  4TS8 A;  5CQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...