2E3KA

Crystal structure of the human brd2 second bromodomain in complexed with the acetylated histone h4 peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title Structural basis for diacetylated histone H4 tail recognition by the second bromodomain of human BRD2
rcsb
source organism Homo sapiens
total genus 38
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2e3kA00
4PS5A 5ENBA 3FKMX 5DYUA 3AADA 5LVQA 5LKUA 5IGNA 4UIYA 5L8TA 5HENA 3D7CA 5KTXA 5FG6A 5F63A 5BT3A 4NUEA 4BJXA 5EK9A 4HXPA 5AMEA 4QYLA 4NRCA 4QEVA 5EGUA 4TTEA 4OGJA 5A7CA 4Q0NA 3NXBA 4NR4A 5I7YA 4QSUA 5ENJA 5HEMA 2RNYA 4O77A 5EWDA 3JVKA 2DKWA 5A81A 4MR4A 4BW2A 5F2PA 4DONA 4TT2A 4XUBA 4NR5A 2R10A 5CQ8A 5EP7A 4OUFA 5D3PA 4X2IA 4NUDA 2DVRA 5FDZA 3LQIA 4J3IA 2YEKA 5FBXA 3LXJA 5IGKA 5LJ2A 5C7NA 5D3LA 4TS8A 5CUGA 4N4GA 1WUMA 3MB3A 2E7NA 4CUSA 2D82A 3P5OA 3U5PA 5FE4A 2YELA 5FFVA 4HBVA 5CQAA 5I83A 4MR6A 3DWYA 4CFKA 5HELA 5FE6A 5H1UA 4Z1SA 4QR4A 5HCLA 4NYXA 5CU8A 5I7XA 3G0JA 4LYSA 5A83A 5FE0A 5EWVA 1F68A 5II2A 5E9YA 4NR8A 4YY4A 3P1EA 5FE9A 5DKDA 3UVXA 4FLPA 4O7FA 4QR5A 4LZSA 4A9JA 1ZS5A 4YYGA 3HMHA 5ENGA 3GG3A 4UIZA 4YYHA 4PKLA 5LKZA 4IR5A 5FH8A 5E9KA 5ENEA 5A5NA 4QSVA 3UVDA 3U5KA 5EWHA 3UVYA 4IORA 5K29A 4J0SA 4QNSA 5FE7A 5CP5A 5EWCA 4YY6A 5ENIA 4C67A 5LKXA 4TU6A 4O7CA 4YH4A 3SVHA 4RVRA 4YK0A 5H85A 5CGPA 4QUTA 4HBXA 5IIDA 4QB3A 2OO1A 4YYMA 2RI7A 5EM3A 4PCEA 4MEPA 4YBTA 5CQ7A 5HM0A 5A82A 3U5NA 4NXJA 2YEMA 5BT5A 5I86A 4QSWA 2RO1A 5DY7A 5F60A 4TU4A 5EA1A 3P1DA 3JVMA 5D3RA 4IOQA 2R0VA 4F3IA 5IGMA 5DFCA 2L84A 4WHWA 5I40A 4LYIA 5E74A 5F5ZA 2E7OA 1WUGA 5D3SA 4AKNA 3I3JA 4TT6A 4XY8A 3QZVA 4J1PA 5FH6A 2WP1A 5L99A 5DYAA 4CLBA 2I8NA 3UV2A 5CQ5A 4QZSA 5F62A 2YQDA 3Q2FA 4LC2A 4HXOA 3UW9A 4YYNA 2DVVA 3MB4A 4O78A 5EU1A 5HQ7A 5JI8A 2L5EA 1JM4B 5DW1A 4UYHA 4CURA 4ZQLA 1E6IA 5F61A 5D3TA 3JVLA 4MEOA 3UV5A 5FB0A 4IR4A 3U5MA 4YYIA 2RFJA 5CS8A 2LSPB 3LQJA 5FB1A 2E3KA 3O34A 4QSSA 3U5OA 3IU5A 4O7EA 4IOOA 3Q2EA 5E3GA 4CUTA 4YABA 3SVGA 5DYCA 5DX4A 5L96A 4YYDA 3ZYUA 4NQNA 4Q0OA 4MR3A 5DKHA 5J0DA 3O35A 3P1CA 4A9HA 4NR6A 5FG5A 5FE8A 5I80A 4TYLA 4BW3A 5CRMA 4N4IA 5CRZA 5HQ6A 5L8UA 2F6JA 5KHMA 4QEWA 4N4HA 3HMEA 4HXLA 5E9MA 4ALHA 4YAXA 2NXBA 4KCXA 5CUBA 4A9EA 4HXKA 4YBMA 2H60A 3AQAA 5HLSA 3JVJA 5G4SA 5CTLA 5ACYA 5LVRA 4CUPA 5DBMA 4HXRA 4LZRA 5EWWA 2MJVB 1X0JA 5E9VA 5CY9A 5E9IA 5D24A 5D0CA 4MR5A 4HXNA 4HBWA 5FFYA 4Z1QA 5C89A 2FSAA 4UYFB 5D25A 5HRVA 5I88A 5L97A 5CUCA 5H1TA 5ETBA 5HFRA 2F6NA 5CQ4A 5BT4A 5E7DA 5ETDA 5ENFA 4A9MA 5C8GA 2DVQA 4YATA 4XUAA 5II1A 4XY9A 4PTBA 3QZTA 4O70A 3UV4A 4NRAA 4TQNA 5F3AA 4CUQA 4YH3A 5LJ1A 3QZSA 5A5QA 5KTUA 4A9NA 5CZGA 4O75A 4Z6HA 5AD2A 5KO4A 4A9FA 4Y03A 3P1FA 5EPSA 5HFQA 4E96A 3MUKA 4KV4A 4QBMA 4QYDA 3ONIA 2R0SA 4UYDA 2YW5A 4NYWA 4LR6A 4UIXA 5ENCA 5LJ0A 5F1HA 2D9EA 2WP2A 5H1VA 5DKCA 4J0RA 4QEUA 1JSPB 3S92A 4CUUA 3G0LA 4NUCA 4QR3A 5CUEA 5D7XA 1EQFA 4PCIA 5D26A 4QSRA 2G4AA 5L98A 5CFWA 4QC1A 3O36A 2N9GA 4QC3A 5AD3A 5COIA 4QSTA 4YBSA 3LJWA 4A9KA 5I89A 5A5OA 5IBNA 3TLPA 5CQ6A 5IG6A 4YYKA 5F1LA 4WIVA 5DW2A 3LQHA 5FE3A 5CQ3A 4A9IA 5FG4A 1N72A 3U5JA 4N3WA 2OUOA 4CFLA 4TZ8A 4PY6A 3SVFA 5JWMA 5KTWA 5EQ1A 5IGLA 4O72A 4A9OA 2RNXA 5F36A 5FE2A 5CUDA 2DVSA 4UYFA 5DFBA 4BW4A 5E0RA 5EPBA 4O7AA 5C87A 4HXSA 4LDFA 5A85A 5DLXA 4ZC9A 5TCMA 4UIWA 5A5PA 5A5SA 5HRWA 2R0YA 4GPJA 5D3JA 4ZW1A 4O7BA 5EVAA 5DLZA 4HXMA 4Z93A 5EPRA 2GRCA 4QSPA 4UIVA 2YDWA 5EV9A 4BW1A 5A5RA 5E3DA 3MQMA 4O76A 3S91A 4OGIA 2DATA 4UYEA 2OSSA 4ALGA 2RNWA 5EISA 3UVWA 5HQ5A 3RCWA 2DWWA 3O33A 4O74A 4YADA 3MULA 4NR9A 5DYXA 4IR6A 4MENA 5C85A 5C4QA 4TT4A 4Z6IA 5CQTA 2RS9B 5FFWA 4QSQA 4QUUA 5LUUA 4LYWA 3K2JA 5FH7A 4BHWA 2YYNA 4KV1A 5HRXA 4NYVA 4YYJA 4XYAA 2KTBB 4C66A 3HMFA 5F25A 4CL9A 4A9LA 4WHUA 3DAIA 5CUAA 5ENHA 4YC9A 4IR3A 5EI4A 4N4FA 2L85A 5CPEA 4NS5A 4HBYA 5KU3A 4UITA 5E9LA 4TZ2A 4LZ2A 4QY4A 4MEQA 5EICA 3O37A 5LKTA 5DFDA 5FE1A 4O71A 4UYGA 5I29A 5G4RA 5D3HA 2I7KA 4LRGA 5AMFA 4NQMA 4NRBA 4QSXA 3IU6A 5E73A 3U5LA 5I1QA 5D3NA 3MXFA 4NR7A 5HJCA 4UIUA 5TB6A 5FE5A
chains in the Genus database with same CATH superfamily
4PS5A 5ENBA 3FKMX 5DYUA 3AADA 5LVQA 5LKUA 5IGNA 4UIYA 4AI6A 5L8TA 5HENA 3D7CA 5KTXA 5FG6A 5F63A 5BT3A 4NUEA 4BJXA 5EK9A 4HXPA 5AMEA 4QYLA 4NRCA 4QEVA 5EGUA 4TTEA 4OGJA 5A7CA 4Q0NA 3NXBA 4NR4A 5I7YA 4QSUA 5ENJA 5HEMA 2RNYA 4O77A 5EWDA 3JVKA 2DKWA 5A81A 4MR4A 4BW2A 5F2PA 4DONA 4TT2A 4XUBA 4NR5A 2R10A 5CQ8A 5EP7A 4OUFA 5D3PA 4X2IA 4NUDA 2DVRA 5FDZA 3LQIA 4J3IA 2YEKA 5FBXA 3LXJA 5IGKA 5LJ2A 5C7NA 5D3LA 4TS8A 5CUGA 4N4GA 1WUMA 3MB3A 2E7NA 4CUSA 2D82A 3P5OA 3U5PA 5FE4A 2YELA 5FFVA 4HBVA 5CQAA 5I83A 4MR6A 3DWYA 4CFKA 5HELA 5FE6A 5H1UA 4Z1SA 4QR4A 5HCLA 4NYXA 5CU8A 5I7XA 3G0JA 3D1DA 4LYSA 5A83A 5FE0A 5EWVA 1F68A 5II2A 5E9YA 4NR8A 4YY4A 3P1EA 5FE9A 5DKDA 3UVXA 4FLPA 4O7FA 4QR5A 4LZSA 4A9JA 1ZS5A 4YYGA 3HMHA 5ENGA 3GG3A 4UIZA 4YYHA 4PKLA 5LKZA 4IR5A 5FH8A 5E9KA 5ENEA 5A5NA 4QSVA 3UVDA 1PUOA 3U5KA 5EWHA 3UVYA 4IORA 3D1BA 5K29A 4J0SA 4QNSA 5FE7A 5CP5A 5EWCA 4YY6A 5ENIA 4C67A 5LKXA 4TU6A 4O7CA 4YH4A 3SVHA 4RVRA 4YK0A 5H85A 5CGPA 4QUTA 4HBXA 5IIDA 4QB3A 2OO1A 4YYMA 2RI7A 5EM3A 4PCEA 4MEPA 4YBTA 5CQ7A 5HM0A 4AKIA 5A82A 3U5NA 4NXJA 2YEMA 5BT5A 5I86A 4QSWA 2RO1A 5DY7A 5F60A 4TU4A 5EA1A 3P1DA 3JVMA 5D3RA 4IOQA 2R0VA 4F3IA 5IGMA 5DFCA 2L84A 4WHWA 5I40A 4LYIA 5E74A 5F5ZA 2E7OA 1WUGA 3VKHA 5D3SA 4AKNA 3I3JA 4TT6A 4XY8A 3QZVA 4J1PA 5FH6A 2WP1A 5L99A 5DYAA 4CLBA 2I8NA 3UV2A 5CQ5A 4QZSA 5F62A 2YQDA 3Q2FA 4LC2A 4HXOA 3UW9A 4YYNA 2DVVA 3MB4A 4O78A 5EU1A 5HQ7A 5JI8A 2L5EA 1JM4B 5DW1A 4UYHA 4CURA 4ZQLA 1E6IA 5F61A 5D3TA 3JVLA 4MEOA 3UV5A 5FB0A 4IR4A 3U5MA 4YYIA 2RFJA 5CS8A 2LSPB 3LQJA 5FB1A 2E3KA 3O34A 4QSSA 3U5OA 3IU5A 4O7EA 4IOOA 3Q2EA 5E3GA 4CUTA 4YABA 3SVGA 5DYCA 5DX4A 5L96A 4YYDA 3ZYUA 4NQNA 4Q0OA 4MR3A 5DKHA 5J0DA 3O35A 3P1CA 4A9HA 4NR6A 5FG5A 5FE8A 5I80A 4TYLA 4BW3A 5CRMA 4N4IA 5CRZA 5HQ6A 5L8UA 2F6JA 5KHMA 4QEWA 4N4HA 3HMEA 4HXLA 5E9MA 4ALHA 4YAXA 2NXBA 4KCXA 5CUBA 4A9EA 4HXKA 4YBMA 2H60A 3AQAA 5HLSA 3JVJA 5G4SA 5CTLA 5ACYA 5LVRA 4CUPA 5DBMA 4AKGA 4HXRA 4LZRA 5EWWA 2MJVB 1X0JA 5E9VA 5CY9A 5E9IA 5D24A 5D0CA 4MR5A 4HXNA 4HBWA 5FFYA 4Z1QA 5C89A 2FSAA 4UYFB 5D25A 5HRVA 5I88A 5L97A 5CUCA 5H1TA 5ETBA 5HFRA 2F6NA 5CQ4A 5BT4A 5E7DA 5ETDA 5ENFA 4A9MA 5C8GA 2DVQA 4YATA 4XUAA 5II1A 4XY9A 4PTBA 3QZTA 4O70A 3UV4A 4NRAA 4TQNA 5F3AA 4CUQA 4YH3A 5LJ1A 3QZSA 5A5QA 5KTUA 4A9NA 5CZGA 4O75A 4Z6HA 5AD2A 5KO4A 4A9FA 4Y03A 3P1FA 5EPSA 5HFQA 4E96A 3MUKA 4KV4A 4QBMA 4QYDA 3ONIA 2R0SA 4UYDA 2YW5A 4NYWA 4LR6A 4UIXA 5ENCA 5LJ0A 5F1HA 2D9EA 2WP2A 5H1VA 5DKCA 4J0RA 4QEUA 1JSPB 3S92A 4CUUA 3G0LA 4NUCA 4QR3A 5CUEA 5D7XA 1EQFA 4PCIA 5D26A 4QSRA 2G4AA 5L98A 5CFWA 4QC1A 3O36A 2N9GA 4QC3A 5AD3A 5COIA 4QSTA 4YBSA 3LJWA 4A9KA 5I89A 5A5OA 5IBNA 3TLPA 5CQ6A 5IG6A 4YYKA 5F1LA 4WIVA 5DW2A 3LQHA 5FE3A 5CQ3A 4A9IA 5FG4A 1N72A 3U5JA 4N3WA 2OUOA 4CFLA 4TZ8A 4PY6A 3SVFA 5JWMA 5KTWA 5EQ1A 5IGLA 4O72A 4A9OA 3VKGA 2RNXA 5F36A 5FE2A 5CUDA 2DVSA 4UYFA 5DFBA 4BW4A 5E0RA 5EPBA 4O7AA 5C87A 4HXSA 4LDFA 5A85A 5DLXA 4ZC9A 5TCMA 4UIWA 5A5PA 5A5SA 5HRWA 2R0YA 4GPJA 5D3JA 4ZW1A 4AKHA 4O7BA 5EVAA 5DLZA 4HXMA 4Z93A 5EPRA 2GRCA 4QSPA 4UIVA 2YDWA 5EV9A 4BW1A 5A5RA 5E3DA 3MQMA 4O76A 3S91A 3ERRA 4OGIA 2DATA 4UYEA 2OSSA 4ALGA 2RNWA 5EISA 3UVWA 5HQ5A 3RCWA 2DWWA 3O33A 4O74A 4YADA 3MULA 4NR9A 5DYXA 4IR6A 4MENA 5C85A 5C4QA 4TT4A 4Z6IA 5CQTA 2RS9B 5FFWA 4QSQA 4QUUA 5LUUA 4LYWA 3K2JA 5FH7A 4BHWA 2YYNA 4KV1A 5HRXA 4NYVA 4YYJA 4XYAA 2KTBB 4C66A 3HMFA 5F25A 4CL9A 4A9LA 1ZKRA 4WHUA 3DAIA 5CUAA 5ENHA 4YC9A 4IR3A 5EI4A 4N4FA 2L85A 5CPEA 4NS5A 4HBYA 5KU3A 4UITA 5E9LA 4TZ2A 4LZ2A 4QY4A 4MEQA 5EICA 3O37A 5LKTA 5DFDA 5FE1A 4O71A 4UYGA 5I29A 5G4RA 5D3HA 2I7KA 4LRGA 5AMFA 4NQMA 4NRBA 4QSXA 3IU6A 5E73A 3U5LA 5I1QA 5D3NA 3MXFA 4NR7A 5HJCA 2EJNA 4UIUA 5TB6A 5FE5A
chains in the Genus database with same CATH topology
4PS5A 5ENBA 3FKMX 5DYUA 3AADA 5LVQA 5LKUA 5IGNA 4UIYA 5L8TA 5HENA 3D7CA 5KTXA 5FG6A 5F63A 5BT3A 4NUEA 4BJXA 5EK9A 4HXPA 5AMEA 4QYLA 4NRCA 4QEVA 5EGUA 4TTEA 4OGJA 5A7CA 4Q0NA 3NXBA 4NR4A 5I7YA 4QSUA 5ENJA 5HEMA 2RNYA 4O77A 5EWDA 3JVKA 2DKWA 5A81A 4MR4A 4BW2A 5F2PA 4DONA 4TT2A 4XUBA 4NR5A 2R10A 5CQ8A 5EP7A 4OUFA 5D3PA 4X2IA 4NUDA 2DVRA 5FDZA 3LQIA 4J3IA 2YEKA 5FBXA 3LXJA 5IGKA 5LJ2A 5C7NA 5D3LA 4TS8A 5CUGA 4N4GA 1WUMA 3MB3A 2E7NA 4CUSA 2D82A 3P5OA 3U5PA 5FE4A 2YELA 5FFVA 4HBVA 5CQAA 5I83A 4MR6A 3DWYA 4CFKA 5HELA 5FE6A 5H1UA 4Z1SA 4QR4A 5HCLA 4NYXA 5CU8A 5I7XA 3G0JA 4LYSA 5A83A 5FE0A 5EWVA 1F68A 5II2A 5E9YA 4NR8A 4YY4A 3P1EA 5FE9A 5DKDA 3UVXA 4FLPA 4O7FA 4QR5A 4LZSA 4A9JA 1ZS5A 4YYGA 3HMHA 5ENGA 3GG3A 4UIZA 4YYHA 4PKLA 5LKZA 4IR5A 5FH8A 5E9KA 5ENEA 5A5NA 4QSVA 3UVDA 3U5KA 5EWHA 3UVYA 4IORA 5K29A 4J0SA 4QNSA 5FE7A 5CP5A 5EWCA 4YY6A 5ENIA 4C67A 5LKXA 4TU6A 4O7CA 4YH4A 3SVHA 4RVRA 4YK0A 5H85A 5CGPA 4QUTA 4HBXA 5IIDA 4QB3A 2OO1A 4YYMA 2RI7A 5EM3A 4PCEA 4MEPA 4YBTA 5CQ7A 5HM0A 5A82A 3U5NA 4NXJA 2YEMA 5BT5A 5I86A 4QSWA 2RO1A 5DY7A 5F60A 4TU4A 5EA1A 3P1DA 3JVMA 5D3RA 4IOQA 2R0VA 4F3IA 5IGMA 5DFCA 2L84A 4WHWA 5I40A 4LYIA 5E74A 5F5ZA 2E7OA 1WUGA 5D3SA 4AKNA 3I3JA 4TT6A 4XY8A 3QZVA 4J1PA 5FH6A 2WP1A 5L99A 5DYAA 4CLBA 2I8NA 3UV2A 5CQ5A 4QZSA 5F62A 2YQDA 3Q2FA 4LC2A 4HXOA 3UW9A 4YYNA 2DVVA 3MB4A 4O78A 5EU1A 5HQ7A 5JI8A 2L5EA 1JM4B 5DW1A 4UYHA 4CURA 4ZQLA 1E6IA 5F61A 5D3TA 3JVLA 4MEOA 3UV5A 5FB0A 4IR4A 3U5MA 4YYIA 2RFJA 5CS8A 2LSPB 3LQJA 5FB1A 2E3KA 3O34A 4QSSA 3U5OA 3IU5A 4O7EA 4IOOA 3Q2EA 5E3GA 4CUTA 4YABA 3SVGA 5DYCA 5DX4A 5L96A 4YYDA 3ZYUA 4NQNA 4Q0OA 4MR3A 5DKHA 5J0DA 3O35A 3P1CA 4A9HA 4NR6A 5FG5A 5FE8A 5I80A 4TYLA 4BW3A 5CRMA 4N4IA 5CRZA 5HQ6A 5L8UA 2F6JA 5KHMA 4QEWA 4N4HA 3HMEA 4HXLA 5E9MA 4ALHA 4YAXA 2NXBA 4KCXA 5CUBA 4A9EA 4HXKA 4YBMA 2H60A 3AQAA 5HLSA 3JVJA 5G4SA 5CTLA 5ACYA 5LVRA 4CUPA 5DBMA 4HXRA 4LZRA 5EWWA 2MJVB 1X0JA 5E9VA 5CY9A 5E9IA 5D24A 5D0CA 4MR5A 4HXNA 4HBWA 5FFYA 4Z1QA 5C89A 2FSAA 4UYFB 5D25A 5HRVA 5I88A 5L97A 5CUCA 5H1TA 5ETBA 5HFRA 2F6NA 5CQ4A 5BT4A 5E7DA 5ETDA 5ENFA 4A9MA 5C8GA 2DVQA 4YATA 4XUAA 5II1A 4XY9A 4PTBA 3QZTA 4O70A 3UV4A 4NRAA 4TQNA 5F3AA 4CUQA 4YH3A 5LJ1A 3QZSA 5A5QA 5KTUA 4A9NA 5CZGA 4O75A 4Z6HA 5AD2A 5KO4A 4A9FA 4Y03A 3P1FA 5EPSA 5HFQA 4E96A 3MUKA 4KV4A 4QBMA 4QYDA 3ONIA 2R0SA 4UYDA 2YW5A 4NYWA 4LR6A 4UIXA 5ENCA 5LJ0A 5F1HA 2D9EA 2WP2A 5H1VA 5DKCA 4J0RA 4QEUA 1JSPB 3S92A 4CUUA 3G0LA 4NUCA 4QR3A 5CUEA 5D7XA 1EQFA 4PCIA 5D26A 4QSRA 2G4AA 5L98A 5CFWA 4QC1A 3O36A 2N9GA 4QC3A 5AD3A 5COIA 4QSTA 4YBSA 3LJWA 4A9KA 5I89A 5A5OA 5IBNA 3TLPA 5CQ6A 5IG6A 4YYKA 5F1LA 4WIVA 5DW2A 3LQHA 5FE3A 5CQ3A 4A9IA 5FG4A 1N72A 3U5JA 4N3WA 2OUOA 4CFLA 4TZ8A 4PY6A 3SVFA 5JWMA 5KTWA 5EQ1A 5IGLA 4O72A 4A9OA 2RNXA 5F36A 5FE2A 5CUDA 2DVSA 4UYFA 5DFBA 4BW4A 5E0RA 5EPBA 4O7AA 5C87A 4HXSA 4LDFA 5A85A 5DLXA 4ZC9A 5TCMA 4UIWA 5A5PA 5A5SA 5HRWA 2R0YA 4GPJA 5D3JA 4ZW1A 4O7BA 5EVAA 5DLZA 4HXMA 4Z93A 5EPRA 2GRCA 4QSPA 4UIVA 2YDWA 5EV9A 4BW1A 5A5RA 5E3DA 3MQMA 4O76A 3S91A 4OGIA 2DATA 4UYEA 2OSSA 4ALGA 2RNWA 5EISA 3UVWA 5HQ5A 3RCWA 2DWWA 3O33A 4O74A 4YADA 3MULA 4NR9A 5DYXA 4IR6A 4MENA 5C85A 5C4QA 4TT4A 4Z6IA 5CQTA 2RS9B 5FFWA 4QSQA 4QUUA 5LUUA 4LYWA 3K2JA 5FH7A 4BHWA 2YYNA 4KV1A 5HRXA 4NYVA 4YYJA 4XYAA 2KTBB 4C66A 3HMFA 5F25A 4CL9A 4A9LA 4WHUA 3DAIA 5CUAA 5ENHA 4YC9A 4IR3A 5EI4A 4N4FA 2L85A 5CPEA 4NS5A 4HBYA 5KU3A 4UITA 5E9LA 4TZ2A 4LZ2A 4QY4A 4MEQA 5EICA 3O37A 5LKTA 5DFDA 5FE1A 4O71A 4UYGA 5I29A 5G4RA 5D3HA 2I7KA 4LRGA 5AMFA 4NQMA 4NRBA 4QSXA 3IU6A 5E73A 3U5LA 5I1QA 5D3NA 3MXFA 4NR7A 5HJCA 4UIUA 5TB6A 5FE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS5 A;  5ENB A;  3FKM X;  5DYU A;  3AAD A;  5LVQ A;  5LKU A;  5IGN A;  4UIY A;  5L8T A;  5HEN A;  3D7C A;  5KTX A;  5FG6 A;  5F63 A;  5BT3 A;  4NUE A;  4BJX A;  5EK9 A;  4HXP A;  5AME A;  4QYL A;  4NRC A;  4QEV A;  5EGU A;  4TTE A;  4OGJ A;  5A7C A;  4Q0N A;  3NXB A;  4NR4 A;  5I7Y A;  4QSU A;  5ENJ A;  5HEM A;  2RNY A;  4O77 A;  5EWD A;  3JVK A;  2DKW A;  5A81 A;  4MR4 A;  4BW2 A;  5F2P A;  4DON A;  4TT2 A;  4XUB A;  4NR5 A;  2R10 A;  5CQ8 A;  5EP7 A;  4OUF A;  5D3P A;  4X2I A;  4NUD A;  2DVR A;  5FDZ A;  3LQI A;  4J3I A;  2YEK A;  5FBX A;  3LXJ A;  5IGK A;  5LJ2 A;  5C7N A;  5D3L A;  4TS8 A;  5CUG A;  4N4G A;  1WUM A;  3MB3 A;  2E7N A;  4CUS A;  2D82 A;  3P5O A;  3U5P A;  5FE4 A;  2YEL A;  5FFV A;  4HBV A;  5CQA A;  5I83 A;  4MR6 A;  3DWY A;  4CFK A;  5HEL A;  5FE6 A;  5H1U A;  4Z1S A;  4QR4 A;  5HCL A;  4NYX A;  5CU8 A;  5I7X A;  3G0J A;  4LYS A;  5A83 A;  5FE0 A;  5EWV A;  1F68 A;  5II2 A;  5E9Y A;  4NR8 A;  4YY4 A;  3P1E A;  5FE9 A;  5DKD A;  3UVX A;  4FLP A;  4O7F A;  4QR5 A;  4LZS A;  4A9J A;  1ZS5 A;  4YYG A;  3HMH A;  5ENG A;  3GG3 A;  4UIZ A;  4YYH A;  4PKL A;  5LKZ A;  4IR5 A;  5FH8 A;  5E9K A;  5ENE A;  5A5N A;  4QSV A;  3UVD A;  3U5K A;  5EWH A;  3UVY A;  4IOR A;  5K29 A;  4J0S A;  4QNS A;  5FE7 A;  5CP5 A;  5EWC A;  4YY6 A;  5ENI A;  4C67 A;  5LKX A;  4TU6 A;  4O7C A;  4YH4 A;  3SVH A;  4RVR A;  4YK0 A;  5H85 A;  5CGP A;  4QUT A;  4HBX A;  5IID A;  4QB3 A;  2OO1 A;  4YYM A;  2RI7 A;  5EM3 A;  4PCE A;  4MEP A;  4YBT A;  5CQ7 A;  5HM0 A;  5A82 A;  3U5N A;  4NXJ A;  2YEM A;  5BT5 A;  5I86 A;  4QSW A;  2RO1 A;  5DY7 A;  5F60 A;  4TU4 A;  5EA1 A;  3P1D A;  3JVM A;  5D3R A;  4IOQ A;  2R0V A;  4F3I A;  5IGM A;  5DFC A;  2L84 A;  4WHW A;  5I40 A;  4LYI A;  5E74 A;  5F5Z A;  2E7O A;  1WUG A;  5D3S A;  4AKN A;  3I3J A;  4TT6 A;  4XY8 A;  3QZV A;  4J1P A;  5FH6 A;  2WP1 A;  5L99 A;  5DYA A;  4CLB A;  2I8N A;  3UV2 A;  5CQ5 A;  4QZS A;  5F62 A;  2YQD A;  3Q2F A;  4LC2 A;  4HXO A;  3UW9 A;  4YYN A;  2DVV A;  3MB4 A;  4O78 A;  5EU1 A;  5HQ7 A;  5JI8 A;  2L5E A;  1JM4 B;  5DW1 A;  4UYH A;  4CUR A;  4ZQL A;  1E6I A;  5F61 A;  5D3T A;  3JVL A;  4MEO A;  3UV5 A;  5FB0 A;  4IR4 A;  3U5M A;  4YYI A;  2RFJ A;  5CS8 A;  2LSP B;  3LQJ A;  5FB1 A;  2E3K A;  3O34 A;  4QSS A;  3U5O A;  3IU5 A;  4O7E A;  4IOO A;  3Q2E A;  5E3G A;  4CUT A;  4YAB A;  3SVG A;  5DYC A;  5DX4 A;  5L96 A;  4YYD A;  3ZYU A;  4NQN A;  4Q0O A;  4MR3 A;  5DKH A;  5J0D A;  3O35 A;  3P1C A;  4A9H A;  4NR6 A;  5FG5 A;  5FE8 A;  5I80 A;  4TYL A;  4BW3 A;  5CRM A;  4N4I A;  5CRZ A;  5HQ6 A;  5L8U A;  2F6J A;  5KHM A;  4QEW A;  4N4H A;  3HME A;  4HXL A;  5E9M A;  4ALH A;  4YAX A;  2NXB A;  4KCX A;  5CUB A;  4A9E A;  4HXK A;  4YBM A;  2H60 A;  3AQA A;  5HLS A;  3JVJ A;  5G4S A;  5CTL A;  5ACY A;  5LVR A;  4CUP A;  5DBM A;  4HXR A;  4LZR A;  5EWW A;  2MJV B;  1X0J A;  5E9V A;  5CY9 A;  5E9I A;  5D24 A;  5D0C A;  4MR5 A;  4HXN A;  4HBW A;  5FFY A;  4Z1Q A;  5C89 A;  2FSA A;  4UYF B;  5D25 A;  5HRV A;  5I88 A;  5L97 A;  5CUC A;  5H1T A;  5ETB A;  5HFR A;  2F6N A;  5CQ4 A;  5BT4 A;  5E7D A;  5ETD A;  5ENF A;  4A9M A;  5C8G A;  2DVQ A;  4YAT A;  4XUA A;  5II1 A;  4XY9 A;  4PTB A;  3QZT A;  4O70 A;  3UV4 A;  4NRA A;  4TQN A;  5F3A A;  4CUQ A;  4YH3 A;  5LJ1 A;  3QZS A;  5A5Q A;  5KTU A;  4A9N A;  5CZG A;  4O75 A;  4Z6H A;  5AD2 A;  5KO4 A;  4A9F A;  4Y03 A;  3P1F A;  5EPS A;  5HFQ A;  4E96 A;  3MUK A;  4KV4 A;  4QBM A;  4QYD A;  3ONI A;  2R0S A;  4UYD A;  2YW5 A;  4NYW A;  4LR6 A;  4UIX A;  5ENC A;  5LJ0 A;  5F1H A;  2D9E A;  2WP2 A;  5H1V A;  5DKC A;  4J0R A;  4QEU A;  1JSP B;  3S92 A;  4CUU A;  3G0L A;  4NUC A;  4QR3 A;  5CUE A;  5D7X A;  1EQF A;  4PCI A;  5D26 A;  4QSR A;  2G4A A;  5L98 A;  5CFW A;  4QC1 A;  3O36 A;  2N9G A;  4QC3 A;  5AD3 A;  5COI A;  4QST A;  4YBS A;  3LJW A;  4A9K A;  5I89 A;  5A5O A;  5IBN A;  3TLP A;  5CQ6 A;  5IG6 A;  4YYK A;  5F1L A;  4WIV A;  5DW2 A;  3LQH A;  5FE3 A;  5CQ3 A;  4A9I A;  5FG4 A;  1N72 A;  3U5J A;  4N3W A;  2OUO A;  4CFL A;  4TZ8 A;  4PY6 A;  3SVF A;  5JWM A;  5KTW A;  5EQ1 A;  5IGL A;  4O72 A;  4A9O A;  2RNX A;  5F36 A;  5FE2 A;  5CUD A;  2DVS A;  4UYF A;  5DFB A;  4BW4 A;  5E0R A;  5EPB A;  4O7A A;  5C87 A;  4HXS A;  4LDF A;  5A85 A;  5DLX A;  4ZC9 A;  5TCM A;  4UIW A;  5A5P A;  5A5S A;  5HRW A;  2R0Y A;  4GPJ A;  5D3J A;  4ZW1 A;  4O7B A;  5EVA A;  5DLZ A;  4HXM A;  4Z93 A;  5EPR A;  2GRC A;  4QSP A;  4UIV A;  2YDW A;  5EV9 A;  4BW1 A;  5A5R A;  5E3D A;  3MQM A;  4O76 A;  3S91 A;  4OGI A;  2DAT A;  4UYE A;  2OSS A;  4ALG A;  2RNW A;  5EIS A;  3UVW A;  5HQ5 A;  3RCW A;  2DWW A;  3O33 A;  4O74 A;  4YAD A;  3MUL A;  4NR9 A;  5DYX A;  4IR6 A;  4MEN A;  5C85 A;  5C4Q A;  4TT4 A;  4Z6I A;  5CQT A;  2RS9 B;  5FFW A;  4QSQ A;  4QUU A;  5LUU A;  4LYW A;  3K2J A;  5FH7 A;  4BHW A;  2YYN A;  4KV1 A;  5HRX A;  4NYV A;  4YYJ A;  4XYA A;  2KTB B;  4C66 A;  3HMF A;  5F25 A;  4CL9 A;  4A9L A;  4WHU A;  3DAI A;  5CUA A;  5ENH A;  4YC9 A;  4IR3 A;  5EI4 A;  4N4F A;  2L85 A;  5CPE A;  4NS5 A;  4HBY A;  5KU3 A;  4UIT A;  5E9L A;  4TZ2 A;  4LZ2 A;  4QY4 A;  4MEQ A;  5EIC A;  3O37 A;  5LKT A;  5DFD A;  5FE1 A;  4O71 A;  4UYG A;  5I29 A;  5G4R A;  5D3H A;  2I7K A;  4LRG A;  5AMF A;  4NQM A;  4NRB A;  4QSX A;  3IU6 A;  5E73 A;  3U5L A;  5I1Q A;  5D3N A;  3MXF A;  4NR7 A;  5HJC A;  4UIU A;  5TB6 A;  5FE5 A; 
#chains in the Genus database with same CATH topology
 4PS5 A;  5ENB A;  3FKM X;  5DYU A;  3AAD A;  5LVQ A;  5LKU A;  5IGN A;  4UIY A;  4AI6 A;  5L8T A;  5HEN A;  3D7C A;  5KTX A;  5FG6 A;  5F63 A;  5BT3 A;  4NUE A;  4BJX A;  5EK9 A;  4HXP A;  5AME A;  4QYL A;  4NRC A;  4QEV A;  5EGU A;  4TTE A;  4OGJ A;  5A7C A;  4Q0N A;  3NXB A;  4NR4 A;  5I7Y A;  4QSU A;  5ENJ A;  5HEM A;  2RNY A;  4O77 A;  5EWD A;  3JVK A;  2DKW A;  5A81 A;  4MR4 A;  4BW2 A;  5F2P A;  4DON A;  4TT2 A;  4XUB A;  4NR5 A;  2R10 A;  5CQ8 A;  5EP7 A;  4OUF A;  5D3P A;  4X2I A;  4NUD A;  2DVR A;  5FDZ A;  3LQI A;  4J3I A;  2YEK A;  5FBX A;  3LXJ A;  5IGK A;  5LJ2 A;  5C7N A;  5D3L A;  4TS8 A;  5CUG A;  4N4G A;  1WUM A;  3MB3 A;  2E7N A;  4CUS A;  2D82 A;  3P5O A;  3U5P A;  5FE4 A;  2YEL A;  5FFV A;  4HBV A;  5CQA A;  5I83 A;  4MR6 A;  3DWY A;  4CFK A;  5HEL A;  5FE6 A;  5H1U A;  4Z1S A;  4QR4 A;  5HCL A;  4NYX A;  5CU8 A;  5I7X A;  3G0J A;  3D1D A;  4LYS A;  5A83 A;  5FE0 A;  5EWV A;  1F68 A;  5II2 A;  5E9Y A;  4NR8 A;  4YY4 A;  3P1E A;  5FE9 A;  5DKD A;  3UVX A;  4FLP A;  4O7F A;  4QR5 A;  4LZS A;  4A9J A;  1ZS5 A;  4YYG A;  3HMH A;  5ENG A;  3GG3 A;  4UIZ A;  4YYH A;  4PKL A;  5LKZ A;  4IR5 A;  5FH8 A;  5E9K A;  5ENE A;  5A5N A;  4QSV A;  3UVD A;  1PUO A;  3U5K A;  5EWH A;  3UVY A;  4IOR A;  3D1B A;  5K29 A;  4J0S A;  4QNS A;  5FE7 A;  5CP5 A;  5EWC A;  4YY6 A;  5ENI A;  4C67 A;  5LKX A;  4TU6 A;  4O7C A;  4YH4 A;  3SVH A;  4RVR A;  4YK0 A;  5H85 A;  5CGP A;  4QUT A;  4HBX A;  5IID A;  4QB3 A;  2OO1 A;  4YYM A;  2RI7 A;  5EM3 A;  4PCE A;  4MEP A;  4YBT A;  5CQ7 A;  5HM0 A;  4AKI A;  5A82 A;  3U5N A;  4NXJ A;  2YEM A;  5BT5 A;  5I86 A;  4QSW A;  2RO1 A;  5DY7 A;  5F60 A;  4TU4 A;  5EA1 A;  3P1D A;  3JVM A;  5D3R A;  4IOQ A;  2R0V A;  4F3I A;  5IGM A;  5DFC A;  2L84 A;  4WHW A;  5I40 A;  4LYI A;  5E74 A;  5F5Z A;  2E7O A;  1WUG A;  3VKH A;  5D3S A;  4AKN A;  3I3J A;  4TT6 A;  4XY8 A;  3QZV A;  4J1P A;  5FH6 A;  2WP1 A;  5L99 A;  5DYA A;  4CLB A;  2I8N A;  3UV2 A;  5CQ5 A;  4QZS A;  5F62 A;  2YQD A;  3Q2F A;  4LC2 A;  4HXO A;  3UW9 A;  4YYN A;  2DVV A;  3MB4 A;  4O78 A;  5EU1 A;  5HQ7 A;  5JI8 A;  2L5E A;  1JM4 B;  5DW1 A;  4UYH A;  4CUR A;  4ZQL A;  1E6I A;  5F61 A;  5D3T A;  3JVL A;  4MEO A;  3UV5 A;  5FB0 A;  4IR4 A;  3U5M A;  4YYI A;  2RFJ A;  5CS8 A;  2LSP B;  3LQJ A;  5FB1 A;  2E3K A;  3O34 A;  4QSS A;  3U5O A;  3IU5 A;  4O7E A;  4IOO A;  3Q2E A;  5E3G A;  4CUT A;  4YAB A;  3SVG A;  5DYC A;  5DX4 A;  5L96 A;  4YYD A;  3ZYU A;  4NQN A;  4Q0O A;  4MR3 A;  5DKH A;  5J0D A;  3O35 A;  3P1C A;  4A9H A;  4NR6 A;  5FG5 A;  5FE8 A;  5I80 A;  4TYL A;  4BW3 A;  5CRM A;  4N4I A;  5CRZ A;  5HQ6 A;  5L8U A;  2F6J A;  5KHM A;  4QEW A;  4N4H A;  3HME A;  4HXL A;  5E9M A;  4ALH A;  4YAX A;  2NXB A;  4KCX A;  5CUB A;  4A9E A;  4HXK A;  4YBM A;  2H60 A;  3AQA A;  5HLS A;  3JVJ A;  5G4S A;  5CTL A;  5ACY A;  5LVR A;  4CUP A;  5DBM A;  4AKG A;  4HXR A;  4LZR A;  5EWW A;  2MJV B;  1X0J A;  5E9V A;  5CY9 A;  5E9I A;  5D24 A;  5D0C A;  4MR5 A;  4HXN A;  4HBW A;  5FFY A;  4Z1Q A;  5C89 A;  2FSA A;  4UYF B;  5D25 A;  5HRV A;  5I88 A;  5L97 A;  5CUC A;  5H1T A;  5ETB A;  5HFR A;  2F6N A;  5CQ4 A;  5BT4 A;  5E7D A;  5ETD A;  5ENF A;  4A9M A;  5C8G A;  2DVQ A;  4YAT A;  4XUA A;  5II1 A;  4XY9 A;  4PTB A;  3QZT A;  4O70 A;  3UV4 A;  4NRA A;  4TQN A;  5F3A A;  4CUQ A;  4YH3 A;  5LJ1 A;  3QZS A;  5A5Q A;  5KTU A;  4A9N A;  5CZG A;  4O75 A;  4Z6H A;  5AD2 A;  5KO4 A;  4A9F A;  4Y03 A;  3P1F A;  5EPS A;  5HFQ A;  4E96 A;  3MUK A;  4KV4 A;  4QBM A;  4QYD A;  3ONI A;  2R0S A;  4UYD A;  2YW5 A;  4NYW A;  4LR6 A;  4UIX A;  5ENC A;  5LJ0 A;  5F1H A;  2D9E A;  2WP2 A;  5H1V A;  5DKC A;  4J0R A;  4QEU A;  1JSP B;  3S92 A;  4CUU A;  3G0L A;  4NUC A;  4QR3 A;  5CUE A;  5D7X A;  1EQF A;  4PCI A;  5D26 A;  4QSR A;  2G4A A;  5L98 A;  5CFW A;  4QC1 A;  3O36 A;  2N9G A;  4QC3 A;  5AD3 A;  5COI A;  4QST A;  4YBS A;  3LJW A;  4A9K A;  5I89 A;  5A5O A;  5IBN A;  3TLP A;  5CQ6 A;  5IG6 A;  4YYK A;  5F1L A;  4WIV A;  5DW2 A;  3LQH A;  5FE3 A;  5CQ3 A;  4A9I A;  5FG4 A;  1N72 A;  3U5J A;  4N3W A;  2OUO A;  4CFL A;  4TZ8 A;  4PY6 A;  3SVF A;  5JWM A;  5KTW A;  5EQ1 A;  5IGL A;  4O72 A;  4A9O A;  3VKG A;  2RNX A;  5F36 A;  5FE2 A;  5CUD A;  2DVS A;  4UYF A;  5DFB A;  4BW4 A;  5E0R A;  5EPB A;  4O7A A;  5C87 A;  4HXS A;  4LDF A;  5A85 A;  5DLX A;  4ZC9 A;  5TCM A;  4UIW A;  5A5P A;  5A5S A;  5HRW A;  2R0Y A;  4GPJ A;  5D3J A;  4ZW1 A;  4AKH A;  4O7B A;  5EVA A;  5DLZ A;  4HXM A;  4Z93 A;  5EPR A;  2GRC A;  4QSP A;  4UIV A;  2YDW A;  5EV9 A;  4BW1 A;  5A5R A;  5E3D A;  3MQM A;  4O76 A;  3S91 A;  3ERR A;  4OGI A;  2DAT A;  4UYE A;  2OSS A;  4ALG A;  2RNW A;  5EIS A;  3UVW A;  5HQ5 A;  3RCW A;  2DWW A;  3O33 A;  4O74 A;  4YAD A;  3MUL A;  4NR9 A;  5DYX A;  4IR6 A;  4MEN A;  5C85 A;  5C4Q A;  4TT4 A;  4Z6I A;  5CQT A;  2RS9 B;  5FFW A;  4QSQ A;  4QUU A;  5LUU A;  4LYW A;  3K2J A;  5FH7 A;  4BHW A;  2YYN A;  4KV1 A;  5HRX A;  4NYV A;  4YYJ A;  4XYA A;  2KTB B;  4C66 A;  3HMF A;  5F25 A;  4CL9 A;  4A9L A;  1ZKR A;  4WHU A;  3DAI A;  5CUA A;  5ENH A;  4YC9 A;  4IR3 A;  5EI4 A;  4N4F A;  2L85 A;  5CPE A;  4NS5 A;  4HBY A;  5KU3 A;  4UIT A;  5E9L A;  4TZ2 A;  4LZ2 A;  4QY4 A;  4MEQ A;  5EIC A;  3O37 A;  5LKT A;  5DFD A;  5FE1 A;  4O71 A;  4UYG A;  5I29 A;  5G4R A;  5D3H A;  2I7K A;  4LRG A;  5AMF A;  4NQM A;  4NRB A;  4QSX A;  3IU6 A;  5E73 A;  3U5L A;  5I1Q A;  5D3N A;  3MXF A;  4NR7 A;  5HJC A;  2EJN A;  4UIU A;  5TB6 A;  5FE5 A; 
#chains in the Genus database with same CATH homology
 4PS5 A;  5ENB A;  3FKM X;  5DYU A;  3AAD A;  5LVQ A;  5LKU A;  5IGN A;  4UIY A;  5L8T A;  5HEN A;  3D7C A;  5KTX A;  5FG6 A;  5F63 A;  5BT3 A;  4NUE A;  4BJX A;  5EK9 A;  4HXP A;  5AME A;  4QYL A;  4NRC A;  4QEV A;  5EGU A;  4TTE A;  4OGJ A;  5A7C A;  4Q0N A;  3NXB A;  4NR4 A;  5I7Y A;  4QSU A;  5ENJ A;  5HEM A;  2RNY A;  4O77 A;  5EWD A;  3JVK A;  2DKW A;  5A81 A;  4MR4 A;  4BW2 A;  5F2P A;  4DON A;  4TT2 A;  4XUB A;  4NR5 A;  2R10 A;  5CQ8 A;  5EP7 A;  4OUF A;  5D3P A;  4X2I A;  4NUD A;  2DVR A;  5FDZ A;  3LQI A;  4J3I A;  2YEK A;  5FBX A;  3LXJ A;  5IGK A;  5LJ2 A;  5C7N A;  5D3L A;  4TS8 A;  5CUG A;  4N4G A;  1WUM A;  3MB3 A;  2E7N A;  4CUS A;  2D82 A;  3P5O A;  3U5P A;  5FE4 A;  2YEL A;  5FFV A;  4HBV A;  5CQA A;  5I83 A;  4MR6 A;  3DWY A;  4CFK A;  5HEL A;  5FE6 A;  5H1U A;  4Z1S A;  4QR4 A;  5HCL A;  4NYX A;  5CU8 A;  5I7X A;  3G0J A;  4LYS A;  5A83 A;  5FE0 A;  5EWV A;  1F68 A;  5II2 A;  5E9Y A;  4NR8 A;  4YY4 A;  3P1E A;  5FE9 A;  5DKD A;  3UVX A;  4FLP A;  4O7F A;  4QR5 A;  4LZS A;  4A9J A;  1ZS5 A;  4YYG A;  3HMH A;  5ENG A;  3GG3 A;  4UIZ A;  4YYH A;  4PKL A;  5LKZ A;  4IR5 A;  5FH8 A;  5E9K A;  5ENE A;  5A5N A;  4QSV A;  3UVD A;  3U5K A;  5EWH A;  3UVY A;  4IOR A;  5K29 A;  4J0S A;  4QNS A;  5FE7 A;  5CP5 A;  5EWC A;  4YY6 A;  5ENI A;  4C67 A;  5LKX A;  4TU6 A;  4O7C A;  4YH4 A;  3SVH A;  4RVR A;  4YK0 A;  5H85 A;  5CGP A;  4QUT A;  4HBX A;  5IID A;  4QB3 A;  2OO1 A;  4YYM A;  2RI7 A;  5EM3 A;  4PCE A;  4MEP A;  4YBT A;  5CQ7 A;  5HM0 A;  5A82 A;  3U5N A;  4NXJ A;  2YEM A;  5BT5 A;  5I86 A;  4QSW A;  2RO1 A;  5DY7 A;  5F60 A;  4TU4 A;  5EA1 A;  3P1D A;  3JVM A;  5D3R A;  4IOQ A;  2R0V A;  4F3I A;  5IGM A;  5DFC A;  2L84 A;  4WHW A;  5I40 A;  4LYI A;  5E74 A;  5F5Z A;  2E7O A;  1WUG A;  5D3S A;  4AKN A;  3I3J A;  4TT6 A;  4XY8 A;  3QZV A;  4J1P A;  5FH6 A;  2WP1 A;  5L99 A;  5DYA A;  4CLB A;  2I8N A;  3UV2 A;  5CQ5 A;  4QZS A;  5F62 A;  2YQD A;  3Q2F A;  4LC2 A;  4HXO A;  3UW9 A;  4YYN A;  2DVV A;  3MB4 A;  4O78 A;  5EU1 A;  5HQ7 A;  5JI8 A;  2L5E A;  1JM4 B;  5DW1 A;  4UYH A;  4CUR A;  4ZQL A;  1E6I A;  5F61 A;  5D3T A;  3JVL A;  4MEO A;  3UV5 A;  5FB0 A;  4IR4 A;  3U5M A;  4YYI A;  2RFJ A;  5CS8 A;  2LSP B;  3LQJ A;  5FB1 A;  2E3K A;  3O34 A;  4QSS A;  3U5O A;  3IU5 A;  4O7E A;  4IOO A;  3Q2E A;  5E3G A;  4CUT A;  4YAB A;  3SVG A;  5DYC A;  5DX4 A;  5L96 A;  4YYD A;  3ZYU A;  4NQN A;  4Q0O A;  4MR3 A;  5DKH A;  5J0D A;  3O35 A;  3P1C A;  4A9H A;  4NR6 A;  5FG5 A;  5FE8 A;  5I80 A;  4TYL A;  4BW3 A;  5CRM A;  4N4I A;  5CRZ A;  5HQ6 A;  5L8U A;  2F6J A;  5KHM A;  4QEW A;  4N4H A;  3HME A;  4HXL A;  5E9M A;  4ALH A;  4YAX A;  2NXB A;  4KCX A;  5CUB A;  4A9E A;  4HXK A;  4YBM A;  2H60 A;  3AQA A;  5HLS A;  3JVJ A;  5G4S A;  5CTL A;  5ACY A;  5LVR A;  4CUP A;  5DBM A;  4HXR A;  4LZR A;  5EWW A;  2MJV B;  1X0J A;  5E9V A;  5CY9 A;  5E9I A;  5D24 A;  5D0C A;  4MR5 A;  4HXN A;  4HBW A;  5FFY A;  4Z1Q A;  5C89 A;  2FSA A;  4UYF B;  5D25 A;  5HRV A;  5I88 A;  5L97 A;  5CUC A;  5H1T A;  5ETB A;  5HFR A;  2F6N A;  5CQ4 A;  5BT4 A;  5E7D A;  5ETD A;  5ENF A;  4A9M A;  5C8G A;  2DVQ A;  4YAT A;  4XUA A;  5II1 A;  4XY9 A;  4PTB A;  3QZT A;  4O70 A;  3UV4 A;  4NRA A;  4TQN A;  5F3A A;  4CUQ A;  4YH3 A;  5LJ1 A;  3QZS A;  5A5Q A;  5KTU A;  4A9N A;  5CZG A;  4O75 A;  4Z6H A;  5AD2 A;  5KO4 A;  4A9F A;  4Y03 A;  3P1F A;  5EPS A;  5HFQ A;  4E96 A;  3MUK A;  4KV4 A;  4QBM A;  4QYD A;  3ONI A;  2R0S A;  4UYD A;  2YW5 A;  4NYW A;  4LR6 A;  4UIX A;  5ENC A;  5LJ0 A;  5F1H A;  2D9E A;  2WP2 A;  5H1V A;  5DKC A;  4J0R A;  4QEU A;  1JSP B;  3S92 A;  4CUU A;  3G0L A;  4NUC A;  4QR3 A;  5CUE A;  5D7X A;  1EQF A;  4PCI A;  5D26 A;  4QSR A;  2G4A A;  5L98 A;  5CFW A;  4QC1 A;  3O36 A;  2N9G A;  4QC3 A;  5AD3 A;  5COI A;  4QST A;  4YBS A;  3LJW A;  4A9K A;  5I89 A;  5A5O A;  5IBN A;  3TLP A;  5CQ6 A;  5IG6 A;  4YYK A;  5F1L A;  4WIV A;  5DW2 A;  3LQH A;  5FE3 A;  5CQ3 A;  4A9I A;  5FG4 A;  1N72 A;  3U5J A;  4N3W A;  2OUO A;  4CFL A;  4TZ8 A;  4PY6 A;  3SVF A;  5JWM A;  5KTW A;  5EQ1 A;  5IGL A;  4O72 A;  4A9O A;  2RNX A;  5F36 A;  5FE2 A;  5CUD A;  2DVS A;  4UYF A;  5DFB A;  4BW4 A;  5E0R A;  5EPB A;  4O7A A;  5C87 A;  4HXS A;  4LDF A;  5A85 A;  5DLX A;  4ZC9 A;  5TCM A;  4UIW A;  5A5P A;  5A5S A;  5HRW A;  2R0Y A;  4GPJ A;  5D3J A;  4ZW1 A;  4O7B A;  5EVA A;  5DLZ A;  4HXM A;  4Z93 A;  5EPR A;  2GRC A;  4QSP A;  4UIV A;  2YDW A;  5EV9 A;  4BW1 A;  5A5R A;  5E3D A;  3MQM A;  4O76 A;  3S91 A;  4OGI A;  2DAT A;  4UYE A;  2OSS A;  4ALG A;  2RNW A;  5EIS A;  3UVW A;  5HQ5 A;  3RCW A;  2DWW A;  3O33 A;  4O74 A;  4YAD A;  3MUL A;  4NR9 A;  5DYX A;  4IR6 A;  4MEN A;  5C85 A;  5C4Q A;  4TT4 A;  4Z6I A;  5CQT A;  2RS9 B;  5FFW A;  4QSQ A;  4QUU A;  5LUU A;  4LYW A;  3K2J A;  5FH7 A;  4BHW A;  2YYN A;  4KV1 A;  5HRX A;  4NYV A;  4YYJ A;  4XYA A;  2KTB B;  4C66 A;  3HMF A;  5F25 A;  4CL9 A;  4A9L A;  4WHU A;  3DAI A;  5CUA A;  5ENH A;  4YC9 A;  4IR3 A;  5EI4 A;  4N4F A;  2L85 A;  5CPE A;  4NS5 A;  4HBY A;  5KU3 A;  4UIT A;  5E9L A;  4TZ2 A;  4LZ2 A;  4QY4 A;  4MEQ A;  5EIC A;  3O37 A;  5LKT A;  5DFD A;  5FE1 A;  4O71 A;  4UYG A;  5I29 A;  5G4R A;  5D3H A;  2I7K A;  4LRG A;  5AMF A;  4NQM A;  4NRB A;  4QSX A;  3IU6 A;  5E73 A;  3U5L A;  5I1Q A;  5D3N A;  3MXF A;  4NR7 A;  5HJC A;  4UIU A;  5TB6 A;  5FE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...