2E3KA

Crystal structure of the human brd2 second bromodomain in complexed with the acetylated histone h4 peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title Structural basis for diacetylated histone H4 tail recognition by the second bromodomain of human BRD2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 38
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2e3kA00
5EICA 5ENCA 5AD3A 5KTXA 4YH4A 5FE4A 5A5OA 3JVJA 4QR5A 4O76A 5C85A 3MB3A 4UITA 3UV5A 5IIDA 2E3KA 2L5EA 2WP1A 4QB3A 5AD2A 5II2A 5JI8A 5CRMA 4TS8A 4ZW1A 4PKLA 4YY6A 4Y03A 5C87A 4HBXA 5C7NA 5FE0A 3SVHA 3JVKA 2D9EA 5LKXA 4YYMA 5F60A 5HFRA 5A81A 5EVAA 4TU6A 3Q2EA 4MEOA 4O7EA 5LKTA 5HQ6A 4J3IA 4O7FA 4A9JA 4TYLA 5ENHA 5CUCA 5L97A 4UIVA 5A5RA 5CPEA 4UIYA 4YYHA 5E0RA 2YEKA 4MEQA 3O37A 4Z93A 4NRBA 4QYLA 3DWYA 2I7KA 5F62A 4WIVA 5D3JA 5FE8A 4LYWA 3MB4A 4TQNA 4QEWA 4PY6A 4QUUA 4NR6A 4QSWA 5H1UA 1F68A 2RNYA 2YQDA 4J1PA 5CUDA 5A7CA 2E7OA 5D25A 4NYWA 5CUGA 3HMFA 4UYFB 5IGNA 5KHMA 4E96A 4MR6A 2R0YA 5ENFA 3ZYUA 1JSPB 5E9LA 4X2IA 4HXPA 4DONA 5A5QA 3AQAA 4CURA 4Z1QA 4HBWA 5DBMA 5IGMA 2L85A 2DVVA 4QSXA 5E73A 4QY4A 4CUSA 5IGKA 5EGUA 5DW1A 4QYDA 5K29A 5J0DA 4TT4A 5EISA 3D7CA 4NR9A 4O7AA 4PTBA 2DVSA 4LYIA 5CQTA 5DX4A 5IBNA 4FLPA 2FSAA 5FB0A 5CUAA 3UV2A 2DWWA 2YYNA 5BT3A 4TZ2A 5DW2A 4N4FA 3IU6A 5ACYA 3MUKA 5TCMA 2YDWA 5EA1A 4QNSA 5D7XA 4LRGA 4XYAA 4CUPA 5A83A 5II1A 4HXMA 2R0VA 4MR5A 4YYJA 3ONIA 3SVFA 1ZS5A 5LVQA 5CQ8A 2RFJA 2F6JA 5FFYA 4BW4A 4CFLA 5FE5A 5HRWA 5I1QA 4YH3A 4HXNA 4YABA 5HLSA 5I7YA 5A85A 4Z6IA 2YELA 4O78A 5CZGA 5IGLA 5FG5A 3U5NA 4QUTA 4Q0OA 5CRZA 5LKUA 4CUQA 5KO4A 4NR5A 2OUOA 5F1HA 5I89A 5DYUA 5COIA 5DKCA 4XY9A 2G4AA 4NUDA 5DYAA 4NXJA 4XUAA 5LVRA 5FE1A 4LZRA 4TZ8A 4QBMA 3UVWA 1WUGA 5EI4A 3LQHA 3TLPA 4BJXA 3LQIA 2F6NA 4NRAA 3P1FA 5LJ2A 5D3TA 1E6IA 2OO1A 5I83A 5BT5A 5ENJA 2D82A 4KV1A 4QR3A 5CGPA 3FKMX 3DAIA 5F5ZA 4UIXA 5C4QA 5L96A 5FG4A 4QSPA 4UIUA 4NYXA 4XUBA 4HXRA 5CQ3A 3O35A 5AMFA 4YYIA 5A5NA 4TT6A 4UYGA 4QR4A 4PCEA 4HXOA 5G4RA 2DATA 4MENA 2YW5A 4QSTA 4TTEA 5I80A 5JWMA 4NQNA 5DFBA 3P1CA 2DVRA 3MXFA 2DVQA 2YEMA 4MEPA 5H85A 3I3JA 5D3SA 3U5LA 5HM0A 5FH8A 4ZQLA 5C89A 5CS8A 2RI7A 3JVLA 4YYDA 4NQMA 4N4HA 4BW3A 2N9GA 1WUMA 5L99A 5ENIA 2E7NA 5CFWA 4A9OA 4YYKA 4QSSA 5DLXA 4PS5A 5ETBA 4O75A 2RS9B 5FE3A 4KCXA 2RO1A 5DLZA 1X0JA 4C66A 5ETDA 4UYDA 4UYFA 4IR5A 5BT4A 4UYEA 5D24A 5F25A 5E3DA 4UYHA 4A9FA 5HEMA 4OGIA 2DKWA 5HCLA 5TB6A 5EPRA 5FFVA 2GRCA 4NS5A 5LJ0A 3IU5A 5A5PA 5KTWA 4HXSA 4RVRA 5DKDA 5F63A 4AKNA 5FBXA 5EP7A 5EWDA 5FB1A 4MR4A 5FH6A 5HELA 4J0RA 4UIWA 5D3LA 3HMHA 4QZSA 5E9IA 4QC3A 3RCWA 5D3PA 5EWWA 4J0SA 5DKHA 5EWVA 5L8TA 5CQ4A 5ENBA 5AMEA 5E9VA 3JVMA 4O7CA 5CQ6A 4YBSA 3G0JA 4KV4A 5HRVA 4CLBA 4Z6HA 3UVYA 5CQ5A 4YADA 5DYXA 2H60A 5DFCA 3AADA 3P1EA 4A9EA 4O74A 2RNXA 2OSSA 5F2PA 4YY4A 3G0LA 3MQMA 5KTUA 3MULA 5FFWA 2WP2A 5HQ7A 5HJCA 4YC9A 5I7XA 4WHWA 5G4SA 4QEUA 4QSQA 5FE6A 3K2JA 5I88A 5L8UA 5DYCA 5EQ1A 3UW9A 2NXBA 4IORA 2L84A 4A9LA 5I40A 5F36A 4YATA 5FE9A 4A9IA 4IR6A 5KU3A 5EK9A 4YBTA 4GPJA 5FH7A 5LKZA 3O34A 4NR7A 5FDZA 2MJVB 4O77A 5A5SA 5F61A 4LDFA 5I29A 3P1DA 5DY7A 4QSVA 4TU4A 4YAXA 5CUEA 5E9KA 4ALHA 4QEVA 4MR3A 5E9MA 5E9YA 4HXKA 5LUUA 5D0CA 3Q2FA 1EQFA 5CQ7A 2KTBB 3HMEA 4NR4A 3UVXA 3LXJA 3LJWA 4ALGA 5E3GA 4PCIA 5EPSA 3UV4A 4A9KA 4ZC9A 5IG6A 3U5MA 3O33A 2R10A 4IOOA 4A9NA 3GG3A 3O36A 1N72A 5A82A 5I86A 4WHUA 3QZTA 5CY9A 4O7BA 4O72A 4A9MA 3S91A 5LJ1A 4NUEA 3S92A 2LSPB 4LC2A 4HBYA 4NYVA 5CQAA 5CTLA 5HENA 5HRXA 4CUTA 5E7DA 4IR4A 3SVGA 4XY8A 5EPBA 4O71A 5EU1A 5EWHA 5EWCA 3U5JA 4HBVA 3UVDA 4YK0A 4CFKA 4LZ2A 5D3NA 4YYNA 5L98A 5H1TA 5HQ5A 4BHWA 3U5KA 2RNWA 3U5PA 5ENEA 4A9HA 4F3IA 4C67A 4QSRA 4IOQA 5FE2A 4YBMA 4HXLA 4N4GA 5HFQA 5FG6A 4NR8A 4QSUA 4N4IA 4OUFA 5D3HA 4OGJA 5CUBA 4LR6A 4N3WA 3P5OA 4UIZA 5EV9A 4CL9A 3QZSA 4Z1SA 3U5OA 5CP5A 4CUUA 4IR3A 2I8NA 4BW2A 4YYGA 5H1VA 5FE7A 4NRCA 5CU8A 3NXBA 4O70A 5DFDA 5D3RA 5D26A 4NUCA 4TT2A 4Q0NA 2R0SA 4LYSA 3LQJA 4BW1A 5F1LA 5E74A 5C8GA 5ENGA 5F3AA 1JM4B 4LZSA 5EM3A 4QC1A 3QZVA
chains in the Genus database with same CATH superfamily
5EICA 5ENCA 5AD3A 5KTXA 4YH4A 5FE4A 5A5OA 3JVJA 4QR5A 4O76A 5C85A 3MB3A 4UITA 3UV5A 5IIDA 2E3KA 2L5EA 2WP1A 4QB3A 5AD2A 5II2A 5JI8A 5CRMA 4TS8A 4ZW1A 4PKLA 4YY6A 4Y03A 5C87A 4HBXA 5C7NA 5FE0A 3SVHA 3JVKA 2D9EA 5LKXA 4YYMA 5F60A 5HFRA 5A81A 5EVAA 4TU6A 3Q2EA 4MEOA 4O7EA 5LKTA 5HQ6A 4J3IA 4O7FA 4A9JA 4TYLA 5ENHA 5CUCA 5L97A 4UIVA 5A5RA 5CPEA 4UIYA 4YYHA 5E0RA 2YEKA 4MEQA 3O37A 4Z93A 4NRBA 4QYLA 3DWYA 2I7KA 5F62A 4WIVA 5D3JA 5FE8A 4LYWA 3MB4A 4TQNA 4QEWA 4PY6A 4QUUA 4NR6A 4QSWA 5H1UA 1F68A 2RNYA 2YQDA 4J1PA 5CUDA 5A7CA 2E7OA 5D25A 4NYWA 5CUGA 3HMFA 4UYFB 5IGNA 5KHMA 4E96A 4MR6A 2R0YA 5ENFA 3ZYUA 1JSPB 5E9LA 4X2IA 4HXPA 4DONA 5A5QA 3AQAA 4CURA 4Z1QA 4HBWA 5DBMA 5IGMA 2L85A 2DVVA 4QSXA 5E73A 4QY4A 4CUSA 5IGKA 5EGUA 5DW1A 4QYDA 5K29A 5J0DA 4TT4A 5EISA 3D7CA 4NR9A 4O7AA 4PTBA 2DVSA 4LYIA 5CQTA 5DX4A 5IBNA 4FLPA 2FSAA 5FB0A 5CUAA 3UV2A 2DWWA 2YYNA 5BT3A 4TZ2A 5DW2A 4N4FA 3IU6A 5ACYA 3MUKA 5TCMA 2YDWA 5EA1A 4QNSA 5D7XA 4LRGA 4XYAA 4CUPA 5A83A 5II1A 4HXMA 2R0VA 4MR5A 4YYJA 3ONIA 3SVFA 1ZS5A 5LVQA 5CQ8A 2RFJA 2F6JA 5FFYA 4BW4A 4CFLA 5FE5A 5HRWA 5I1QA 3D1DA 4YH3A 4HXNA 4YABA 5HLSA 5I7YA 5A85A 4Z6IA 2YELA 4O78A 5CZGA 4AKHA 5IGLA 5FG5A 3U5NA 4QUTA 4Q0OA 5CRZA 5LKUA 4CUQA 5KO4A 4NR5A 2OUOA 5F1HA 3VKGA 5I89A 5DYUA 5COIA 5DKCA 4XY9A 2G4AA 4NUDA 5DYAA 4NXJA 4XUAA 5LVRA 5FE1A 4LZRA 4TZ8A 4QBMA 3UVWA 1WUGA 5EI4A 3LQHA 3TLPA 4BJXA 3LQIA 2F6NA 4NRAA 3P1FA 5LJ2A 5D3TA 1E6IA 2OO1A 5I83A 5BT5A 5ENJA 2D82A 4KV1A 4QR3A 5CGPA 3FKMX 3DAIA 5F5ZA 4UIXA 5C4QA 5L96A 5FG4A 4QSPA 4UIUA 4NYXA 4XUBA 4HXRA 5CQ3A 3O35A 5AMFA 4YYIA 5A5NA 4TT6A 4UYGA 4QR4A 4PCEA 4HXOA 5G4RA 2DATA 4MENA 2YW5A 4QSTA 4TTEA 5I80A 5JWMA 4NQNA 5DFBA 3P1CA 2DVRA 3MXFA 2DVQA 2YEMA 4MEPA 5H85A 3I3JA 5D3SA 3U5LA 5HM0A 5FH8A 4ZQLA 5C89A 5CS8A 2RI7A 3JVLA 4YYDA 4NQMA 4N4HA 4BW3A 2N9GA 1WUMA 5L99A 5ENIA 2E7NA 5CFWA 4A9OA 4YYKA 4QSSA 5DLXA 4PS5A 5ETBA 4O75A 2RS9B 5FE3A 1ZKRA 4KCXA 2RO1A 5DLZA 1X0JA 4C66A 5ETDA 4UYDA 3VKHA 4UYFA 4IR5A 5BT4A 4UYEA 5D24A 5F25A 5E3DA 4UYHA 4A9FA 5HEMA 4OGIA 2DKWA 5HCLA 5TB6A 5EPRA 5FFVA 2GRCA 4NS5A 5LJ0A 3IU5A 5A5PA 5KTWA 4HXSA 4RVRA 5DKDA 5F63A 4AKNA 5FBXA 5EP7A 5EWDA 5FB1A 4MR4A 5FH6A 5HELA 4J0RA 4UIWA 5D3LA 3HMHA 4QZSA 5E9IA 4QC3A 3RCWA 5D3PA 5EWWA 4J0SA 5DKHA 5EWVA 5L8TA 5CQ4A 5ENBA 4AI6A 5AMEA 5E9VA 3JVMA 4O7CA 5CQ6A 4YBSA 3G0JA 4KV4A 5HRVA 4CLBA 4Z6HA 3UVYA 5CQ5A 4YADA 5DYXA 2H60A 5DFCA 3AADA 3P1EA 4A9EA 4O74A 2RNXA 2OSSA 5F2PA 4YY4A 3G0LA 3MQMA 5KTUA 3MULA 5FFWA 2WP2A 5HQ7A 5HJCA 4YC9A 5I7XA 4WHWA 5G4SA 4QEUA 4QSQA 5FE6A 3K2JA 5I88A 5L8UA 5DYCA 5EQ1A 3UW9A 2NXBA 4IORA 2L84A 4A9LA 5I40A 5F36A 4YATA 5FE9A 4A9IA 4IR6A 5KU3A 5EK9A 4YBTA 4GPJA 5FH7A 5LKZA 3O34A 4NR7A 3D1BA 5FDZA 2MJVB 4O77A 5A5SA 5F61A 4AKIA 4LDFA 5I29A 3P1DA 5DY7A 4QSVA 4TU4A 4YAXA 5CUEA 5E9KA 4ALHA 4QEVA 4MR3A 5E9MA 5E9YA 4HXKA 5LUUA 2EJNA 5D0CA 3Q2FA 1EQFA 5CQ7A 2KTBB 3HMEA 4NR4A 3UVXA 3LXJA 3LJWA 4ALGA 5E3GA 4PCIA 5EPSA 3UV4A 4A9KA 4ZC9A 5IG6A 3U5MA 3O33A 2R10A 4IOOA 4A9NA 3GG3A 3O36A 1N72A 5A82A 5I86A 4WHUA 3QZTA 5CY9A 4O7BA 4O72A 4A9MA 3S91A 5LJ1A 4NUEA 3S92A 2LSPB 4LC2A 4HBYA 4NYVA 5CQAA 5CTLA 5HENA 5HRXA 4CUTA 5E7DA 4IR4A 3SVGA 4XY8A 5EPBA 4O71A 5EU1A 5EWHA 5EWCA 3U5JA 4HBVA 3UVDA 4YK0A 4CFKA 4LZ2A 5D3NA 4YYNA 5L98A 5H1TA 5HQ5A 4BHWA 3U5KA 2RNWA 3U5PA 5ENEA 4A9HA 4F3IA 4C67A 4QSRA 4IOQA 5FE2A 4YBMA 4HXLA 4N4GA 5HFQA 5FG6A 4NR8A 4QSUA 3ERRA 4N4IA 4AKGA 4OUFA 5D3HA 4OGJA 5CUBA 4LR6A 4N3WA 3P5OA 4UIZA 5EV9A 4CL9A 3QZSA 4Z1SA 3U5OA 5CP5A 4CUUA 4IR3A 2I8NA 4BW2A 4YYGA 5H1VA 1PUOA 4NRCA 5CU8A 5FE7A 3NXBA 4O70A 5DFDA 5D3RA 5D26A 4NUCA 4TT2A 4Q0NA 2R0SA 4LYSA 3LQJA 4BW1A 5F1LA 5E74A 5C8GA 5ENGA 5F3AA 1JM4B 4LZSA 5EM3A 4QC1A 3QZVA
chains in the Genus database with same CATH topology
5EICA 5ENCA 5AD3A 5KTXA 4YH4A 5FE4A 5A5OA 3JVJA 4QR5A 4O76A 5C85A 3MB3A 4UITA 3UV5A 5IIDA 2E3KA 2L5EA 2WP1A 4QB3A 5AD2A 5II2A 5JI8A 5CRMA 4TS8A 4ZW1A 4PKLA 4YY6A 4Y03A 5C87A 4HBXA 5C7NA 5FE0A 3SVHA 3JVKA 2D9EA 5LKXA 4YYMA 5F60A 5HFRA 5A81A 5EVAA 4TU6A 3Q2EA 4MEOA 4O7EA 5LKTA 5HQ6A 4J3IA 4O7FA 4A9JA 4TYLA 5ENHA 5CUCA 5L97A 4UIVA 5A5RA 5CPEA 4UIYA 4YYHA 5E0RA 2YEKA 4MEQA 3O37A 4Z93A 4NRBA 4QYLA 3DWYA 2I7KA 5F62A 4WIVA 5D3JA 5FE8A 4LYWA 3MB4A 4TQNA 4QEWA 4PY6A 4QUUA 4NR6A 4QSWA 5H1UA 1F68A 2RNYA 2YQDA 4J1PA 5CUDA 5A7CA 2E7OA 5D25A 4NYWA 5CUGA 3HMFA 4UYFB 5IGNA 5KHMA 4E96A 4MR6A 2R0YA 5ENFA 3ZYUA 1JSPB 5E9LA 4X2IA 4HXPA 4DONA 5A5QA 3AQAA 4CURA 4Z1QA 4HBWA 5DBMA 5IGMA 2L85A 2DVVA 4QSXA 5E73A 4QY4A 4CUSA 5IGKA 5EGUA 5DW1A 4QYDA 5K29A 5J0DA 4TT4A 5EISA 3D7CA 4NR9A 4O7AA 4PTBA 2DVSA 4LYIA 5CQTA 5DX4A 5IBNA 4FLPA 2FSAA 5FB0A 5CUAA 3UV2A 2DWWA 2YYNA 5BT3A 4TZ2A 5DW2A 4N4FA 3IU6A 5ACYA 3MUKA 5TCMA 2YDWA 5EA1A 4QNSA 5D7XA 4LRGA 4XYAA 4CUPA 5A83A 5II1A 4HXMA 2R0VA 4MR5A 4YYJA 3ONIA 3SVFA 1ZS5A 5LVQA 5CQ8A 2RFJA 2F6JA 5FFYA 4BW4A 4CFLA 5FE5A 5HRWA 5I1QA 4YH3A 4HXNA 4YABA 5HLSA 5I7YA 5A85A 4Z6IA 2YELA 4O78A 5CZGA 5IGLA 5FG5A 3U5NA 4QUTA 4Q0OA 5CRZA 5LKUA 4CUQA 5KO4A 4NR5A 2OUOA 5F1HA 5I89A 5DYUA 5COIA 5DKCA 4XY9A 2G4AA 4NUDA 5DYAA 4NXJA 4XUAA 5LVRA 5FE1A 4LZRA 4TZ8A 4QBMA 3UVWA 1WUGA 5EI4A 3LQHA 3TLPA 4BJXA 3LQIA 2F6NA 4NRAA 3P1FA 5LJ2A 5D3TA 1E6IA 2OO1A 5I83A 5BT5A 5ENJA 2D82A 4KV1A 4QR3A 5CGPA 3FKMX 3DAIA 5F5ZA 4UIXA 5C4QA 5L96A 5FG4A 4QSPA 4UIUA 4NYXA 4XUBA 4HXRA 5CQ3A 3O35A 5AMFA 4YYIA 5A5NA 4TT6A 4UYGA 4QR4A 4PCEA 4HXOA 5G4RA 2DATA 4MENA 2YW5A 4QSTA 4TTEA 5I80A 5JWMA 4NQNA 5DFBA 3P1CA 2DVRA 3MXFA 2DVQA 2YEMA 4MEPA 5H85A 3I3JA 5D3SA 3U5LA 5HM0A 5FH8A 4ZQLA 5C89A 5CS8A 2RI7A 3JVLA 4YYDA 4NQMA 4N4HA 4BW3A 2N9GA 1WUMA 5L99A 5ENIA 2E7NA 5CFWA 4A9OA 4YYKA 4QSSA 5DLXA 4PS5A 5ETBA 4O75A 2RS9B 5FE3A 4KCXA 2RO1A 5DLZA 1X0JA 4C66A 5ETDA 4UYDA 4UYFA 4IR5A 5BT4A 4UYEA 5D24A 5F25A 5E3DA 4UYHA 4A9FA 5HEMA 4OGIA 2DKWA 5HCLA 5TB6A 5EPRA 5FFVA 2GRCA 4NS5A 5LJ0A 3IU5A 5A5PA 5KTWA 4HXSA 4RVRA 5DKDA 5F63A 4AKNA 5FBXA 5EP7A 5EWDA 5FB1A 4MR4A 5FH6A 5HELA 4J0RA 4UIWA 5D3LA 3HMHA 4QZSA 5E9IA 4QC3A 3RCWA 5D3PA 5EWWA 4J0SA 5DKHA 5EWVA 5L8TA 5CQ4A 5ENBA 5AMEA 5E9VA 3JVMA 4O7CA 5CQ6A 4YBSA 3G0JA 4KV4A 5HRVA 4CLBA 4Z6HA 3UVYA 5CQ5A 4YADA 5DYXA 2H60A 5DFCA 3AADA 3P1EA 4A9EA 4O74A 2RNXA 2OSSA 5F2PA 4YY4A 3G0LA 3MQMA 5KTUA 3MULA 5FFWA 2WP2A 5HQ7A 5HJCA 4YC9A 5I7XA 4WHWA 5G4SA 4QEUA 4QSQA 5FE6A 3K2JA 5I88A 5L8UA 5DYCA 5EQ1A 3UW9A 2NXBA 4IORA 2L84A 4A9LA 5I40A 5F36A 4YATA 5FE9A 4A9IA 4IR6A 5KU3A 5EK9A 4YBTA 4GPJA 5FH7A 5LKZA 3O34A 4NR7A 5FDZA 2MJVB 4O77A 5A5SA 5F61A 4LDFA 5I29A 3P1DA 5DY7A 4QSVA 4TU4A 4YAXA 5CUEA 5E9KA 4ALHA 4QEVA 4MR3A 5E9MA 5E9YA 4HXKA 5LUUA 5D0CA 3Q2FA 1EQFA 5CQ7A 2KTBB 3HMEA 4NR4A 3UVXA 3LXJA 3LJWA 4ALGA 5E3GA 4PCIA 5EPSA 3UV4A 4A9KA 4ZC9A 5IG6A 3U5MA 3O33A 2R10A 4IOOA 4A9NA 3GG3A 3O36A 1N72A 5A82A 5I86A 4WHUA 3QZTA 5CY9A 4O7BA 4O72A 4A9MA 3S91A 5LJ1A 4NUEA 3S92A 2LSPB 4LC2A 4HBYA 4NYVA 5CQAA 5CTLA 5HENA 5HRXA 4CUTA 5E7DA 4IR4A 3SVGA 4XY8A 5EPBA 4O71A 5EU1A 5EWHA 5EWCA 3U5JA 4HBVA 3UVDA 4YK0A 4CFKA 4LZ2A 5D3NA 4YYNA 5L98A 5H1TA 5HQ5A 4BHWA 3U5KA 2RNWA 3U5PA 5ENEA 4A9HA 4F3IA 4C67A 4QSRA 4IOQA 5FE2A 4YBMA 4HXLA 4N4GA 5HFQA 5FG6A 4NR8A 4QSUA 4N4IA 4OUFA 5D3HA 4OGJA 5CUBA 4LR6A 4N3WA 3P5OA 4UIZA 5EV9A 4CL9A 3QZSA 4Z1SA 3U5OA 5CP5A 4CUUA 4IR3A 2I8NA 4BW2A 4YYGA 5H1VA 5FE7A 4NRCA 5CU8A 3NXBA 4O70A 5DFDA 5D3RA 5D26A 4NUCA 4TT2A 4Q0NA 2R0SA 4LYSA 3LQJA 4BW1A 5F1LA 5E74A 5C8GA 5ENGA 5F3AA 1JM4B 4LZSA 5EM3A 4QC1A 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIC A;  5ENC A;  5AD3 A;  5KTX A;  4YH4 A;  5FE4 A;  5A5O A;  3JVJ A;  4QR5 A;  4O76 A;  5C85 A;  3MB3 A;  4UIT A;  3UV5 A;  5IID A;  2E3K A;  2L5E A;  2WP1 A;  4QB3 A;  5AD2 A;  5II2 A;  5JI8 A;  5CRM A;  4TS8 A;  4ZW1 A;  4PKL A;  4YY6 A;  4Y03 A;  5C87 A;  4HBX A;  5C7N A;  5FE0 A;  3SVH A;  3JVK A;  2D9E A;  5LKX A;  4YYM A;  5F60 A;  5HFR A;  5A81 A;  5EVA A;  4TU6 A;  3Q2E A;  4MEO A;  4O7E A;  5LKT A;  5HQ6 A;  4J3I A;  4O7F A;  4A9J A;  4TYL A;  5ENH A;  5CUC A;  5L97 A;  4UIV A;  5A5R A;  5CPE A;  4UIY A;  4YYH A;  5E0R A;  2YEK A;  4MEQ A;  3O37 A;  4Z93 A;  4NRB A;  4QYL A;  3DWY A;  2I7K A;  5F62 A;  4WIV A;  5D3J A;  5FE8 A;  4LYW A;  3MB4 A;  4TQN A;  4QEW A;  4PY6 A;  4QUU A;  4NR6 A;  4QSW A;  5H1U A;  1F68 A;  2RNY A;  2YQD A;  4J1P A;  5CUD A;  5A7C A;  2E7O A;  5D25 A;  4NYW A;  5CUG A;  3HMF A;  4UYF B;  5IGN A;  5KHM A;  4E96 A;  4MR6 A;  2R0Y A;  5ENF A;  3ZYU A;  1JSP B;  5E9L A;  4X2I A;  4HXP A;  4DON A;  5A5Q A;  3AQA A;  4CUR A;  4Z1Q A;  4HBW A;  5DBM A;  5IGM A;  2L85 A;  2DVV A;  4QSX A;  5E73 A;  4QY4 A;  4CUS A;  5IGK A;  5EGU A;  5DW1 A;  4QYD A;  5K29 A;  5J0D A;  4TT4 A;  5EIS A;  3D7C A;  4NR9 A;  4O7A A;  4PTB A;  2DVS A;  4LYI A;  5CQT A;  5DX4 A;  5IBN A;  4FLP A;  2FSA A;  5FB0 A;  5CUA A;  3UV2 A;  2DWW A;  2YYN A;  5BT3 A;  4TZ2 A;  5DW2 A;  4N4F A;  3IU6 A;  5ACY A;  3MUK A;  5TCM A;  2YDW A;  5EA1 A;  4QNS A;  5D7X A;  4LRG A;  4XYA A;  4CUP A;  5A83 A;  5II1 A;  4HXM A;  2R0V A;  4MR5 A;  4YYJ A;  3ONI A;  3SVF A;  1ZS5 A;  5LVQ A;  5CQ8 A;  2RFJ A;  2F6J A;  5FFY A;  4BW4 A;  4CFL A;  5FE5 A;  5HRW A;  5I1Q A;  4YH3 A;  4HXN A;  4YAB A;  5HLS A;  5I7Y A;  5A85 A;  4Z6I A;  2YEL A;  4O78 A;  5CZG A;  5IGL A;  5FG5 A;  3U5N A;  4QUT A;  4Q0O A;  5CRZ A;  5LKU A;  4CUQ A;  5KO4 A;  4NR5 A;  2OUO A;  5F1H A;  5I89 A;  5DYU A;  5COI A;  5DKC A;  4XY9 A;  2G4A A;  4NUD A;  5DYA A;  4NXJ A;  4XUA A;  5LVR A;  5FE1 A;  4LZR A;  4TZ8 A;  4QBM A;  3UVW A;  1WUG A;  5EI4 A;  3LQH A;  3TLP A;  4BJX A;  3LQI A;  2F6N A;  4NRA A;  3P1F A;  5LJ2 A;  5D3T A;  1E6I A;  2OO1 A;  5I83 A;  5BT5 A;  5ENJ A;  2D82 A;  4KV1 A;  4QR3 A;  5CGP A;  3FKM X;  3DAI A;  5F5Z A;  4UIX A;  5C4Q A;  5L96 A;  5FG4 A;  4QSP A;  4UIU A;  4NYX A;  4XUB A;  4HXR A;  5CQ3 A;  3O35 A;  5AMF A;  4YYI A;  5A5N A;  4TT6 A;  4UYG A;  4QR4 A;  4PCE A;  4HXO A;  5G4R A;  2DAT A;  4MEN A;  2YW5 A;  4QST A;  4TTE A;  5I80 A;  5JWM A;  4NQN A;  5DFB A;  3P1C A;  2DVR A;  3MXF A;  2DVQ A;  2YEM A;  4MEP A;  5H85 A;  3I3J A;  5D3S A;  3U5L A;  5HM0 A;  5FH8 A;  4ZQL A;  5C89 A;  5CS8 A;  2RI7 A;  3JVL A;  4YYD A;  4NQM A;  4N4H A;  4BW3 A;  2N9G A;  1WUM A;  5L99 A;  5ENI A;  2E7N A;  5CFW A;  4A9O A;  4YYK A;  4QSS A;  5DLX A;  4PS5 A;  5ETB A;  4O75 A;  2RS9 B;  5FE3 A;  4KCX A;  2RO1 A;  5DLZ A;  1X0J A;  4C66 A;  5ETD A;  4UYD A;  4UYF A;  4IR5 A;  5BT4 A;  4UYE A;  5D24 A;  5F25 A;  5E3D A;  4UYH A;  4A9F A;  5HEM A;  4OGI A;  2DKW A;  5HCL A;  5TB6 A;  5EPR A;  5FFV A;  2GRC A;  4NS5 A;  5LJ0 A;  3IU5 A;  5A5P A;  5KTW A;  4HXS A;  4RVR A;  5DKD A;  5F63 A;  4AKN A;  5FBX A;  5EP7 A;  5EWD A;  5FB1 A;  4MR4 A;  5FH6 A;  5HEL A;  4J0R A;  4UIW A;  5D3L A;  3HMH A;  4QZS A;  5E9I A;  4QC3 A;  3RCW A;  5D3P A;  5EWW A;  4J0S A;  5DKH A;  5EWV A;  5L8T A;  5CQ4 A;  5ENB A;  5AME A;  5E9V A;  3JVM A;  4O7C A;  5CQ6 A;  4YBS A;  3G0J A;  4KV4 A;  5HRV A;  4CLB A;  4Z6H A;  3UVY A;  5CQ5 A;  4YAD A;  5DYX A;  2H60 A;  5DFC A;  3AAD A;  3P1E A;  4A9E A;  4O74 A;  2RNX A;  2OSS A;  5F2P A;  4YY4 A;  3G0L A;  3MQM A;  5KTU A;  3MUL A;  5FFW A;  2WP2 A;  5HQ7 A;  5HJC A;  4YC9 A;  5I7X A;  4WHW A;  5G4S A;  4QEU A;  4QSQ A;  5FE6 A;  3K2J A;  5I88 A;  5L8U A;  5DYC A;  5EQ1 A;  3UW9 A;  2NXB A;  4IOR A;  2L84 A;  4A9L A;  5I40 A;  5F36 A;  4YAT A;  5FE9 A;  4A9I A;  4IR6 A;  5KU3 A;  5EK9 A;  4YBT A;  4GPJ A;  5FH7 A;  5LKZ A;  3O34 A;  4NR7 A;  5FDZ A;  2MJV B;  4O77 A;  5A5S A;  5F61 A;  4LDF A;  5I29 A;  3P1D A;  5DY7 A;  4QSV A;  4TU4 A;  4YAX A;  5CUE A;  5E9K A;  4ALH A;  4QEV A;  4MR3 A;  5E9M A;  5E9Y A;  4HXK A;  5LUU A;  5D0C A;  3Q2F A;  1EQF A;  5CQ7 A;  2KTB B;  3HME A;  4NR4 A;  3UVX A;  3LXJ A;  3LJW A;  4ALG A;  5E3G A;  4PCI A;  5EPS A;  3UV4 A;  4A9K A;  4ZC9 A;  5IG6 A;  3U5M A;  3O33 A;  2R10 A;  4IOO A;  4A9N A;  3GG3 A;  3O36 A;  1N72 A;  5A82 A;  5I86 A;  4WHU A;  3QZT A;  5CY9 A;  4O7B A;  4O72 A;  4A9M A;  3S91 A;  5LJ1 A;  4NUE A;  3S92 A;  2LSP B;  4LC2 A;  4HBY A;  4NYV A;  5CQA A;  5CTL A;  5HEN A;  5HRX A;  4CUT A;  5E7D A;  4IR4 A;  3SVG A;  4XY8 A;  5EPB A;  4O71 A;  5EU1 A;  5EWH A;  5EWC A;  3U5J A;  4HBV A;  3UVD A;  4YK0 A;  4CFK A;  4LZ2 A;  5D3N A;  4YYN A;  5L98 A;  5H1T A;  5HQ5 A;  4BHW A;  3U5K A;  2RNW A;  3U5P A;  5ENE A;  4A9H A;  4F3I A;  4C67 A;  4QSR A;  4IOQ A;  5FE2 A;  4YBM A;  4HXL A;  4N4G A;  5HFQ A;  5FG6 A;  4NR8 A;  4QSU A;  4N4I A;  4OUF A;  5D3H A;  4OGJ A;  5CUB A;  4LR6 A;  4N3W A;  3P5O A;  4UIZ A;  5EV9 A;  4CL9 A;  3QZS A;  4Z1S A;  3U5O A;  5CP5 A;  4CUU A;  4IR3 A;  2I8N A;  4BW2 A;  4YYG A;  5H1V A;  5FE7 A;  4NRC A;  5CU8 A;  3NXB A;  4O70 A;  5DFD A;  5D3R A;  5D26 A;  4NUC A;  4TT2 A;  4Q0N A;  2R0S A;  4LYS A;  3LQJ A;  4BW1 A;  5F1L A;  5E74 A;  5C8G A;  5ENG A;  5F3A A;  1JM4 B;  4LZS A;  5EM3 A;  4QC1 A;  3QZV A; 
#chains in the Genus database with same CATH topology
 5EIC A;  5ENC A;  5AD3 A;  5KTX A;  4YH4 A;  5FE4 A;  5A5O A;  3JVJ A;  4QR5 A;  4O76 A;  5C85 A;  3MB3 A;  4UIT A;  3UV5 A;  5IID A;  2E3K A;  2L5E A;  2WP1 A;  4QB3 A;  5AD2 A;  5II2 A;  5JI8 A;  5CRM A;  4TS8 A;  4ZW1 A;  4PKL A;  4YY6 A;  4Y03 A;  5C87 A;  4HBX A;  5C7N A;  5FE0 A;  3SVH A;  3JVK A;  2D9E A;  5LKX A;  4YYM A;  5F60 A;  5HFR A;  5A81 A;  5EVA A;  4TU6 A;  3Q2E A;  4MEO A;  4O7E A;  5LKT A;  5HQ6 A;  4J3I A;  4O7F A;  4A9J A;  4TYL A;  5ENH A;  5CUC A;  5L97 A;  4UIV A;  5A5R A;  5CPE A;  4UIY A;  4YYH A;  5E0R A;  2YEK A;  4MEQ A;  3O37 A;  4Z93 A;  4NRB A;  4QYL A;  3DWY A;  2I7K A;  5F62 A;  4WIV A;  5D3J A;  5FE8 A;  4LYW A;  3MB4 A;  4TQN A;  4QEW A;  4PY6 A;  4QUU A;  4NR6 A;  4QSW A;  5H1U A;  1F68 A;  2RNY A;  2YQD A;  4J1P A;  5CUD A;  5A7C A;  2E7O A;  5D25 A;  4NYW A;  5CUG A;  3HMF A;  4UYF B;  5IGN A;  5KHM A;  4E96 A;  4MR6 A;  2R0Y A;  5ENF A;  3ZYU A;  1JSP B;  5E9L A;  4X2I A;  4HXP A;  4DON A;  5A5Q A;  3AQA A;  4CUR A;  4Z1Q A;  4HBW A;  5DBM A;  5IGM A;  2L85 A;  2DVV A;  4QSX A;  5E73 A;  4QY4 A;  4CUS A;  5IGK A;  5EGU A;  5DW1 A;  4QYD A;  5K29 A;  5J0D A;  4TT4 A;  5EIS A;  3D7C A;  4NR9 A;  4O7A A;  4PTB A;  2DVS A;  4LYI A;  5CQT A;  5DX4 A;  5IBN A;  4FLP A;  2FSA A;  5FB0 A;  5CUA A;  3UV2 A;  2DWW A;  2YYN A;  5BT3 A;  4TZ2 A;  5DW2 A;  4N4F A;  3IU6 A;  5ACY A;  3MUK A;  5TCM A;  2YDW A;  5EA1 A;  4QNS A;  5D7X A;  4LRG A;  4XYA A;  4CUP A;  5A83 A;  5II1 A;  4HXM A;  2R0V A;  4MR5 A;  4YYJ A;  3ONI A;  3SVF A;  1ZS5 A;  5LVQ A;  5CQ8 A;  2RFJ A;  2F6J A;  5FFY A;  4BW4 A;  4CFL A;  5FE5 A;  5HRW A;  5I1Q A;  3D1D A;  4YH3 A;  4HXN A;  4YAB A;  5HLS A;  5I7Y A;  5A85 A;  4Z6I A;  2YEL A;  4O78 A;  5CZG A;  4AKH A;  5IGL A;  5FG5 A;  3U5N A;  4QUT A;  4Q0O A;  5CRZ A;  5LKU A;  4CUQ A;  5KO4 A;  4NR5 A;  2OUO A;  5F1H A;  3VKG A;  5I89 A;  5DYU A;  5COI A;  5DKC A;  4XY9 A;  2G4A A;  4NUD A;  5DYA A;  4NXJ A;  4XUA A;  5LVR A;  5FE1 A;  4LZR A;  4TZ8 A;  4QBM A;  3UVW A;  1WUG A;  5EI4 A;  3LQH A;  3TLP A;  4BJX A;  3LQI A;  2F6N A;  4NRA A;  3P1F A;  5LJ2 A;  5D3T A;  1E6I A;  2OO1 A;  5I83 A;  5BT5 A;  5ENJ A;  2D82 A;  4KV1 A;  4QR3 A;  5CGP A;  3FKM X;  3DAI A;  5F5Z A;  4UIX A;  5C4Q A;  5L96 A;  5FG4 A;  4QSP A;  4UIU A;  4NYX A;  4XUB A;  4HXR A;  5CQ3 A;  3O35 A;  5AMF A;  4YYI A;  5A5N A;  4TT6 A;  4UYG A;  4QR4 A;  4PCE A;  4HXO A;  5G4R A;  2DAT A;  4MEN A;  2YW5 A;  4QST A;  4TTE A;  5I80 A;  5JWM A;  4NQN A;  5DFB A;  3P1C A;  2DVR A;  3MXF A;  2DVQ A;  2YEM A;  4MEP A;  5H85 A;  3I3J A;  5D3S A;  3U5L A;  5HM0 A;  5FH8 A;  4ZQL A;  5C89 A;  5CS8 A;  2RI7 A;  3JVL A;  4YYD A;  4NQM A;  4N4H A;  4BW3 A;  2N9G A;  1WUM A;  5L99 A;  5ENI A;  2E7N A;  5CFW A;  4A9O A;  4YYK A;  4QSS A;  5DLX A;  4PS5 A;  5ETB A;  4O75 A;  2RS9 B;  5FE3 A;  1ZKR A;  4KCX A;  2RO1 A;  5DLZ A;  1X0J A;  4C66 A;  5ETD A;  4UYD A;  3VKH A;  4UYF A;  4IR5 A;  5BT4 A;  4UYE A;  5D24 A;  5F25 A;  5E3D A;  4UYH A;  4A9F A;  5HEM A;  4OGI A;  2DKW A;  5HCL A;  5TB6 A;  5EPR A;  5FFV A;  2GRC A;  4NS5 A;  5LJ0 A;  3IU5 A;  5A5P A;  5KTW A;  4HXS A;  4RVR A;  5DKD A;  5F63 A;  4AKN A;  5FBX A;  5EP7 A;  5EWD A;  5FB1 A;  4MR4 A;  5FH6 A;  5HEL A;  4J0R A;  4UIW A;  5D3L A;  3HMH A;  4QZS A;  5E9I A;  4QC3 A;  3RCW A;  5D3P A;  5EWW A;  4J0S A;  5DKH A;  5EWV A;  5L8T A;  5CQ4 A;  5ENB A;  4AI6 A;  5AME A;  5E9V A;  3JVM A;  4O7C A;  5CQ6 A;  4YBS A;  3G0J A;  4KV4 A;  5HRV A;  4CLB A;  4Z6H A;  3UVY A;  5CQ5 A;  4YAD A;  5DYX A;  2H60 A;  5DFC A;  3AAD A;  3P1E A;  4A9E A;  4O74 A;  2RNX A;  2OSS A;  5F2P A;  4YY4 A;  3G0L A;  3MQM A;  5KTU A;  3MUL A;  5FFW A;  2WP2 A;  5HQ7 A;  5HJC A;  4YC9 A;  5I7X A;  4WHW A;  5G4S A;  4QEU A;  4QSQ A;  5FE6 A;  3K2J A;  5I88 A;  5L8U A;  5DYC A;  5EQ1 A;  3UW9 A;  2NXB A;  4IOR A;  2L84 A;  4A9L A;  5I40 A;  5F36 A;  4YAT A;  5FE9 A;  4A9I A;  4IR6 A;  5KU3 A;  5EK9 A;  4YBT A;  4GPJ A;  5FH7 A;  5LKZ A;  3O34 A;  4NR7 A;  3D1B A;  5FDZ A;  2MJV B;  4O77 A;  5A5S A;  5F61 A;  4AKI A;  4LDF A;  5I29 A;  3P1D A;  5DY7 A;  4QSV A;  4TU4 A;  4YAX A;  5CUE A;  5E9K A;  4ALH A;  4QEV A;  4MR3 A;  5E9M A;  5E9Y A;  4HXK A;  5LUU A;  2EJN A;  5D0C A;  3Q2F A;  1EQF A;  5CQ7 A;  2KTB B;  3HME A;  4NR4 A;  3UVX A;  3LXJ A;  3LJW A;  4ALG A;  5E3G A;  4PCI A;  5EPS A;  3UV4 A;  4A9K A;  4ZC9 A;  5IG6 A;  3U5M A;  3O33 A;  2R10 A;  4IOO A;  4A9N A;  3GG3 A;  3O36 A;  1N72 A;  5A82 A;  5I86 A;  4WHU A;  3QZT A;  5CY9 A;  4O7B A;  4O72 A;  4A9M A;  3S91 A;  5LJ1 A;  4NUE A;  3S92 A;  2LSP B;  4LC2 A;  4HBY A;  4NYV A;  5CQA A;  5CTL A;  5HEN A;  5HRX A;  4CUT A;  5E7D A;  4IR4 A;  3SVG A;  4XY8 A;  5EPB A;  4O71 A;  5EU1 A;  5EWH A;  5EWC A;  3U5J A;  4HBV A;  3UVD A;  4YK0 A;  4CFK A;  4LZ2 A;  5D3N A;  4YYN A;  5L98 A;  5H1T A;  5HQ5 A;  4BHW A;  3U5K A;  2RNW A;  3U5P A;  5ENE A;  4A9H A;  4F3I A;  4C67 A;  4QSR A;  4IOQ A;  5FE2 A;  4YBM A;  4HXL A;  4N4G A;  5HFQ A;  5FG6 A;  4NR8 A;  4QSU A;  3ERR A;  4N4I A;  4AKG A;  4OUF A;  5D3H A;  4OGJ A;  5CUB A;  4LR6 A;  4N3W A;  3P5O A;  4UIZ A;  5EV9 A;  4CL9 A;  3QZS A;  4Z1S A;  3U5O A;  5CP5 A;  4CUU A;  4IR3 A;  2I8N A;  4BW2 A;  4YYG A;  5H1V A;  1PUO A;  4NRC A;  5CU8 A;  5FE7 A;  3NXB A;  4O70 A;  5DFD A;  5D3R A;  5D26 A;  4NUC A;  4TT2 A;  4Q0N A;  2R0S A;  4LYS A;  3LQJ A;  4BW1 A;  5F1L A;  5E74 A;  5C8G A;  5ENG A;  5F3A A;  1JM4 B;  4LZS A;  5EM3 A;  4QC1 A;  3QZV A; 
#chains in the Genus database with same CATH homology
 5EIC A;  5ENC A;  5AD3 A;  5KTX A;  4YH4 A;  5FE4 A;  5A5O A;  3JVJ A;  4QR5 A;  4O76 A;  5C85 A;  3MB3 A;  4UIT A;  3UV5 A;  5IID A;  2E3K A;  2L5E A;  2WP1 A;  4QB3 A;  5AD2 A;  5II2 A;  5JI8 A;  5CRM A;  4TS8 A;  4ZW1 A;  4PKL A;  4YY6 A;  4Y03 A;  5C87 A;  4HBX A;  5C7N A;  5FE0 A;  3SVH A;  3JVK A;  2D9E A;  5LKX A;  4YYM A;  5F60 A;  5HFR A;  5A81 A;  5EVA A;  4TU6 A;  3Q2E A;  4MEO A;  4O7E A;  5LKT A;  5HQ6 A;  4J3I A;  4O7F A;  4A9J A;  4TYL A;  5ENH A;  5CUC A;  5L97 A;  4UIV A;  5A5R A;  5CPE A;  4UIY A;  4YYH A;  5E0R A;  2YEK A;  4MEQ A;  3O37 A;  4Z93 A;  4NRB A;  4QYL A;  3DWY A;  2I7K A;  5F62 A;  4WIV A;  5D3J A;  5FE8 A;  4LYW A;  3MB4 A;  4TQN A;  4QEW A;  4PY6 A;  4QUU A;  4NR6 A;  4QSW A;  5H1U A;  1F68 A;  2RNY A;  2YQD A;  4J1P A;  5CUD A;  5A7C A;  2E7O A;  5D25 A;  4NYW A;  5CUG A;  3HMF A;  4UYF B;  5IGN A;  5KHM A;  4E96 A;  4MR6 A;  2R0Y A;  5ENF A;  3ZYU A;  1JSP B;  5E9L A;  4X2I A;  4HXP A;  4DON A;  5A5Q A;  3AQA A;  4CUR A;  4Z1Q A;  4HBW A;  5DBM A;  5IGM A;  2L85 A;  2DVV A;  4QSX A;  5E73 A;  4QY4 A;  4CUS A;  5IGK A;  5EGU A;  5DW1 A;  4QYD A;  5K29 A;  5J0D A;  4TT4 A;  5EIS A;  3D7C A;  4NR9 A;  4O7A A;  4PTB A;  2DVS A;  4LYI A;  5CQT A;  5DX4 A;  5IBN A;  4FLP A;  2FSA A;  5FB0 A;  5CUA A;  3UV2 A;  2DWW A;  2YYN A;  5BT3 A;  4TZ2 A;  5DW2 A;  4N4F A;  3IU6 A;  5ACY A;  3MUK A;  5TCM A;  2YDW A;  5EA1 A;  4QNS A;  5D7X A;  4LRG A;  4XYA A;  4CUP A;  5A83 A;  5II1 A;  4HXM A;  2R0V A;  4MR5 A;  4YYJ A;  3ONI A;  3SVF A;  1ZS5 A;  5LVQ A;  5CQ8 A;  2RFJ A;  2F6J A;  5FFY A;  4BW4 A;  4CFL A;  5FE5 A;  5HRW A;  5I1Q A;  4YH3 A;  4HXN A;  4YAB A;  5HLS A;  5I7Y A;  5A85 A;  4Z6I A;  2YEL A;  4O78 A;  5CZG A;  5IGL A;  5FG5 A;  3U5N A;  4QUT A;  4Q0O A;  5CRZ A;  5LKU A;  4CUQ A;  5KO4 A;  4NR5 A;  2OUO A;  5F1H A;  5I89 A;  5DYU A;  5COI A;  5DKC A;  4XY9 A;  2G4A A;  4NUD A;  5DYA A;  4NXJ A;  4XUA A;  5LVR A;  5FE1 A;  4LZR A;  4TZ8 A;  4QBM A;  3UVW A;  1WUG A;  5EI4 A;  3LQH A;  3TLP A;  4BJX A;  3LQI A;  2F6N A;  4NRA A;  3P1F A;  5LJ2 A;  5D3T A;  1E6I A;  2OO1 A;  5I83 A;  5BT5 A;  5ENJ A;  2D82 A;  4KV1 A;  4QR3 A;  5CGP A;  3FKM X;  3DAI A;  5F5Z A;  4UIX A;  5C4Q A;  5L96 A;  5FG4 A;  4QSP A;  4UIU A;  4NYX A;  4XUB A;  4HXR A;  5CQ3 A;  3O35 A;  5AMF A;  4YYI A;  5A5N A;  4TT6 A;  4UYG A;  4QR4 A;  4PCE A;  4HXO A;  5G4R A;  2DAT A;  4MEN A;  2YW5 A;  4QST A;  4TTE A;  5I80 A;  5JWM A;  4NQN A;  5DFB A;  3P1C A;  2DVR A;  3MXF A;  2DVQ A;  2YEM A;  4MEP A;  5H85 A;  3I3J A;  5D3S A;  3U5L A;  5HM0 A;  5FH8 A;  4ZQL A;  5C89 A;  5CS8 A;  2RI7 A;  3JVL A;  4YYD A;  4NQM A;  4N4H A;  4BW3 A;  2N9G A;  1WUM A;  5L99 A;  5ENI A;  2E7N A;  5CFW A;  4A9O A;  4YYK A;  4QSS A;  5DLX A;  4PS5 A;  5ETB A;  4O75 A;  2RS9 B;  5FE3 A;  4KCX A;  2RO1 A;  5DLZ A;  1X0J A;  4C66 A;  5ETD A;  4UYD A;  4UYF A;  4IR5 A;  5BT4 A;  4UYE A;  5D24 A;  5F25 A;  5E3D A;  4UYH A;  4A9F A;  5HEM A;  4OGI A;  2DKW A;  5HCL A;  5TB6 A;  5EPR A;  5FFV A;  2GRC A;  4NS5 A;  5LJ0 A;  3IU5 A;  5A5P A;  5KTW A;  4HXS A;  4RVR A;  5DKD A;  5F63 A;  4AKN A;  5FBX A;  5EP7 A;  5EWD A;  5FB1 A;  4MR4 A;  5FH6 A;  5HEL A;  4J0R A;  4UIW A;  5D3L A;  3HMH A;  4QZS A;  5E9I A;  4QC3 A;  3RCW A;  5D3P A;  5EWW A;  4J0S A;  5DKH A;  5EWV A;  5L8T A;  5CQ4 A;  5ENB A;  5AME A;  5E9V A;  3JVM A;  4O7C A;  5CQ6 A;  4YBS A;  3G0J A;  4KV4 A;  5HRV A;  4CLB A;  4Z6H A;  3UVY A;  5CQ5 A;  4YAD A;  5DYX A;  2H60 A;  5DFC A;  3AAD A;  3P1E A;  4A9E A;  4O74 A;  2RNX A;  2OSS A;  5F2P A;  4YY4 A;  3G0L A;  3MQM A;  5KTU A;  3MUL A;  5FFW A;  2WP2 A;  5HQ7 A;  5HJC A;  4YC9 A;  5I7X A;  4WHW A;  5G4S A;  4QEU A;  4QSQ A;  5FE6 A;  3K2J A;  5I88 A;  5L8U A;  5DYC A;  5EQ1 A;  3UW9 A;  2NXB A;  4IOR A;  2L84 A;  4A9L A;  5I40 A;  5F36 A;  4YAT A;  5FE9 A;  4A9I A;  4IR6 A;  5KU3 A;  5EK9 A;  4YBT A;  4GPJ A;  5FH7 A;  5LKZ A;  3O34 A;  4NR7 A;  5FDZ A;  2MJV B;  4O77 A;  5A5S A;  5F61 A;  4LDF A;  5I29 A;  3P1D A;  5DY7 A;  4QSV A;  4TU4 A;  4YAX A;  5CUE A;  5E9K A;  4ALH A;  4QEV A;  4MR3 A;  5E9M A;  5E9Y A;  4HXK A;  5LUU A;  5D0C A;  3Q2F A;  1EQF A;  5CQ7 A;  2KTB B;  3HME A;  4NR4 A;  3UVX A;  3LXJ A;  3LJW A;  4ALG A;  5E3G A;  4PCI A;  5EPS A;  3UV4 A;  4A9K A;  4ZC9 A;  5IG6 A;  3U5M A;  3O33 A;  2R10 A;  4IOO A;  4A9N A;  3GG3 A;  3O36 A;  1N72 A;  5A82 A;  5I86 A;  4WHU A;  3QZT A;  5CY9 A;  4O7B A;  4O72 A;  4A9M A;  3S91 A;  5LJ1 A;  4NUE A;  3S92 A;  2LSP B;  4LC2 A;  4HBY A;  4NYV A;  5CQA A;  5CTL A;  5HEN A;  5HRX A;  4CUT A;  5E7D A;  4IR4 A;  3SVG A;  4XY8 A;  5EPB A;  4O71 A;  5EU1 A;  5EWH A;  5EWC A;  3U5J A;  4HBV A;  3UVD A;  4YK0 A;  4CFK A;  4LZ2 A;  5D3N A;  4YYN A;  5L98 A;  5H1T A;  5HQ5 A;  4BHW A;  3U5K A;  2RNW A;  3U5P A;  5ENE A;  4A9H A;  4F3I A;  4C67 A;  4QSR A;  4IOQ A;  5FE2 A;  4YBM A;  4HXL A;  4N4G A;  5HFQ A;  5FG6 A;  4NR8 A;  4QSU A;  4N4I A;  4OUF A;  5D3H A;  4OGJ A;  5CUB A;  4LR6 A;  4N3W A;  3P5O A;  4UIZ A;  5EV9 A;  4CL9 A;  3QZS A;  4Z1S A;  3U5O A;  5CP5 A;  4CUU A;  4IR3 A;  2I8N A;  4BW2 A;  4YYG A;  5H1V A;  5FE7 A;  4NRC A;  5CU8 A;  3NXB A;  4O70 A;  5DFD A;  5D3R A;  5D26 A;  4NUC A;  4TT2 A;  4Q0N A;  2R0S A;  4LYS A;  3LQJ A;  4BW1 A;  5F1L A;  5E74 A;  5C8G A;  5ENG A;  5F3A A;  1JM4 B;  4LZS A;  5EM3 A;  4QC1 A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...