4LRGA

Structure of brd4 bromodomain 1 with a dimethyl thiophene isoxazole azepine carboxamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery, Design, and Optimization of Isoxazole Azepine BET Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/inhibitor
total genus 44
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lrgA01
4A9FA 4QB3A 5EWCA 3ONIA 4QUTA 5FFYA 4YBMA 4NR4A 4O7EA 4A9MA 4N3WA 5CQAA 4WHUA 5CQ6A 5E7DA 5A81A 4QC3A 5DLZA 4QSUA 5E9KA 5KHMA 4O76A 4YYMA 4QBMA 5TCMA 4NR6A 3UVXA 2L84A 4MR6A 5DFDA 4HXRA 4J0SA 4O7FA 5TB6A 4YYKA 5D3JA 5IGKA 4QEUA 5ENJA 5CZGA 5AMEA 4HXOA 2F6JA 5E9IA 3HMHA 2E7NA 4HBWA 4BHWA 2DVSA 4ALGA 4YC9A 5F25A 4UYDA 5II2A 4YATA 5KTWA 2DVQA 4UYHA 5D25A 5DYCA 5D3RA 3P5OA 4IORA 1X0JA 2DKWA 4HXPA 1JM4B 5I86A 3GG3A 4BW2A 3U5PA 5HRXA 5CUDA 5E3DA 4NYWA 4WIVA 5FH7A 2FSAA 4HBXA 5CPEA 4BW1A 1ZS5A 4QSSA 5ETBA 2LSPB 3TLPA 3SVHA 5FB0A 2WP2A 4CUUA 4UIZA 5CQTA 4QSVA 5D3TA 5I89A 4IOQA 3NXBA 4CUQA 5L98A 4NQMA 5I40A 4CUPA 3HMFA 4LYWA 5ENHA 4E96A 2RNWA 2MJVB 5E0RA 4QSWA 5D3LA 4NR9A 4O71A 3UV4A 4IR3A 4DONA 5A85A 3LQIA 5FE5A 4TYLA 5ENCA 2E7OA 4HXNA 3U5LA 4XUBA 3AADA 5C89A 5FFWA 3U5OA 5ENGA 5CRMA 2I7KA 5FFVA 3DAIA 3SVFA 5F63A 3JVMA 4QSTA 4O7BA 5KTUA 4HXSA 4O75A 4NQNA 4CUTA 5D24A 5E3GA 4J3IA 4MR3A 5EU1A 5A5RA 5FE8A 5A5PA 4IR4A 5EP7A 4Q0NA 4Z93A 2D9EA 4UYGA 4AKNA 5JI8A 4NYXA 5CQ3A 4NR5A 5I1QA 3S91A 5IGMA 4FLPA 4YYIA 4HXMA 5D26A 4QSXA 5EVAA 4CLBA 2NXBA 5AMFA 4QR4A 4J0RA 4C66A 5KTXA 4UIXA 5FG5A 3JVKA 3MQMA 5AD2A 5FBXA 4LZ2A 2RO1A 5CUGA 2YW5A 2RI7A 4NRAA 3IU5A 4A9HA 4NR7A 4NS5A 2DATA 5A5SA 4UIYA 4O72A 4XY8A 4O77A 2YEMA 5I80A 2YDWA 4X2IA 5ENEA 3MB3A 4UYFB 4MEOA 4TT2A 5A5NA 5FE3A 3UV2A 4HXKA 4QC1A 5IGLA 5FE9A 3ZYUA 5DKDA 5FH6A 5DYUA 3O36A 4TQNA 2F6NA 5FE7A 2R0YA 4OGJA 4QZSA 2OO1A 5HLSA 4NRCA 5EICA 3MULA 3AQAA 5E9LA 4LZSA 5II1A 5K29A 2N9GA 2G4AA 2OUOA 4LYIA 4LRGA 5HENA 3LJWA 5CU8A 5HQ7A 4YABA 5DYAA 5IIDA 5D3HA 2L5EA 5EISA 3UV5A 4BJXA 5FB1A 5J0DA 5L8TA 4O70A 4TT4A 3MXFA 4PCEA 4LZRA 3FKMX 3JVJA 4LC2A 5D0CA 3G0JA 3U5MA 3K2JA 1EQFA 4QEVA 3UVDA 4TU6A 4YYJA 5JWMA 5E74A 5L96A 5AD3A 3G0LA 4MR5A 5DX4A 4Z6IA 5KO4A 3Q2EA 5EI4A 5EWDA 5LUUA 2RNXA 4OGIA 5DFBA 3P1EA 4LR6A 4PTBA 3D7CA 5EPBA 3UVWA 5CUBA 5HQ6A 3LQHA 4O7AA 4YYHA 5LJ1A 5CRZA 4YBSA 5F3AA 5LVQA 5DFCA 5FE6A 4QNSA 4PY6A 5G4SA 5LKUA 4HBYA 5LJ0A 4QSRA 5C7NA 2L85A 4ZQLA 1WUGA 5EA1A 4A9OA 5A5OA 1N72A 4UITA 4UYFA 5D7XA 5DY7A 5EWVA 5F2PA 5BT5A 2RS9B 3O33A 5FDZA 5I7XA 5KU3A 5A7CA 5BT4A 3P1CA 4TT6A 2YELA 5HFRA 5CFWA 4A9JA 4Z6HA 5A82A 5DW1A 4YK0A 4IR5A 3O34A 4O7CA 4HBVA 4LDFA 5CUAA 2OSSA 3I3JA 5A83A 5EK9A 4IOOA 5DKCA 4A9LA 5ENIA 3DWYA 4YH3A 2YYNA 2H60A 5HJCA 4CL9A 5D3NA 3SVGA 5H1TA 4MEPA 4MENA 4NRBA 5ETDA 4CFKA 5FG6A 3UVYA 4BW3A 4PKLA 5LJ2A 5EGUA 2I8NA 5F5ZA 5C4QA 4NXJA 2RFJA 5EWHA 4ZC9A 4BW4A 4NUCA 4N4HA 3S92A 4GPJA 3P1FA 4YYGA 3UW9A 5I83A 4YYNA 1WUMA 5ACYA 4KV1A 5FE0A 2R0SA 5HELA 5COIA 5L99A 5LKZA 5E73A 5EQ1A 5CQ4A 4MR4A 4TTEA 2DWWA 2DVVA 5CUEA 4CURA 4QYLA 5E9YA 4ZW1A 5G4RA 5EPRA 3IU6A 3HMEA 5C87A 2RNYA 4QSPA 5FE1A 3U5KA 4N4GA 4QR3A 4YH4A 5L97A 2R0VA 5DYXA 5HQ5A 4QY4A 4PS5A 5CP5A 4N4IA 4Z1QA 5F1LA 4KV4A 5F61A 5FG4A 4O74A 5I29A 5E9MA 5CQ7A 4NUEA 4UIWA 4KCXA 4A9EA 5FE2A 5C8GA 4TS8A 5F36A 3U5NA 2KTBB 2YQDA 4UYEA 5CY9A 5EV9A 3O35A 5I7YA 4XUAA 3QZVA 5EWWA 3QZTA 5F1HA 2DVRA 4UIVA 5C85A 5D3PA 5CQ5A 5E9VA 5CGPA 5EPSA 5IG6A 5CS8A 4IR6A 5HEMA 5L8UA 4TU4A 5H85A 4O78A 4ALHA 5F62A 4YY4A 3Q2FA 4QYDA 5ENFA 3O37A 4QEWA 4WHWA 4PCIA 2YEKA 4YY6A 5D3SA 3LXJA 1E6IA 4HXLA 5H1UA 5LKTA 4YADA 4NUDA 4NR8A 5LVRA 5HRVA 4RVRA 2WP1A 4N4FA 5I88A 4XY9A 4A9IA 4TZ8A 2D82A 5HRWA 5IGNA 4A9KA 2R10A 4CUSA 5F60A 5BT3A 2E3KA 5CQ8A 4XYAA 3QZSA 3MUKA 5CUCA 4QUUA 4YYDA 3LQJA 5IBNA 4YBTA 5LKXA 4QSQA 5EM3A 5A5QA 3JVLA 4TZ2A 4QR5A 1JSPB 4F3IA 5DLXA 5HM0A 3RCWA 4UIUA 4C67A 5HFQA 4Z1SA 4Q0OA 1F68A 5FE4A 4LYSA 5FH8A 5DW2A 5DBMA 4A9NA 5DKHA 2GRCA 4MEQA 5CTLA 5H1VA 4CFLA 4Y03A 4J1PA 3MB4A 3P1DA 4NYVA 5HCLA 4YAXA 3U5JA 5ENBA 4OUFA
chains in the Genus database with same CATH superfamily
4A9FA 4QB3A 5EWCA 3ONIA 4QUTA 5FFYA 4YBMA 4NR4A 4O7EA 4A9MA 4N3WA 5CQAA 4WHUA 5CQ6A 5E7DA 5A81A 4QC3A 5DLZA 4QSUA 5E9KA 5KHMA 4O76A 4YYMA 4QBMA 5TCMA 4NR6A 3UVXA 2L84A 4MR6A 5DFDA 4HXRA 4J0SA 4O7FA 5TB6A 4YYKA 5D3JA 5IGKA 4QEUA 5ENJA 5CZGA 5AMEA 4HXOA 2F6JA 5E9IA 3HMHA 2E7NA 4HBWA 4BHWA 2DVSA 4ALGA 4YC9A 5F25A 4UYDA 2EJNA 4YATA 5II2A 5KTWA 2DVQA 4UYHA 5D25A 5DYCA 5D3RA 3P5OA 4IORA 1X0JA 2DKWA 4HXPA 1JM4B 5I86A 3GG3A 4BW2A 3U5PA 5HRXA 5CUDA 5E3DA 4NYWA 4WIVA 5FH7A 2FSAA 4HBXA 5CPEA 4BW1A 1ZS5A 4QSSA 5ETBA 2LSPB 3TLPA 3SVHA 5FB0A 2WP2A 4CUUA 4UIZA 5CQTA 4QSVA 5D3TA 5I89A 4IOQA 3NXBA 4CUQA 5L98A 4NQMA 3D1BA 5I40A 4CUPA 3HMFA 4LYWA 5ENHA 4E96A 2RNWA 2MJVB 5E0RA 4QSWA 5D3LA 4NR9A 4O71A 3UV4A 4IR3A 4DONA 5A85A 3LQIA 5FE5A 4TYLA 5ENCA 2E7OA 4HXNA 3U5LA 4XUBA 3AADA 5C89A 5FFWA 3U5OA 5ENGA 5CRMA 2I7KA 5FFVA 3DAIA 3SVFA 5F63A 3JVMA 4QSTA 4O7BA 4AI6A 5KTUA 4HXSA 4O75A 4NQNA 4CUTA 5D24A 5E3GA 4J3IA 4MR3A 5EU1A 5A5RA 5FE8A 5A5PA 4IR4A 5EP7A 4Q0NA 4Z93A 2D9EA 4UYGA 4AKNA 5JI8A 4NYXA 5CQ3A 1ZKRA 4NR5A 5I1QA 3S91A 5IGMA 4FLPA 3ERRA 4YYIA 4HXMA 5D26A 4QSXA 5EVAA 4CLBA 2NXBA 5AMFA 4QR4A 4J0RA 4C66A 5KTXA 4UIXA 5FG5A 3JVKA 3MQMA 5AD2A 5FBXA 4LZ2A 2RO1A 5CUGA 2YW5A 2RI7A 4NRAA 3IU5A 4A9HA 4NR7A 4NS5A 2DATA 5A5SA 4UIYA 4O72A 4XY8A 4O77A 2YEMA 5I80A 2YDWA 4X2IA 5ENEA 3MB3A 4UYFB 4MEOA 4TT2A 5A5NA 5FE3A 3UV2A 4HXKA 4QC1A 5IGLA 5FE9A 3ZYUA 5DKDA 5FH6A 5DYUA 3O36A 4TQNA 2F6NA 5FE7A 2R0YA 4OGJA 4QZSA 2OO1A 5HLSA 4NRCA 5EICA 3MULA 1PUOA 3AQAA 5E9LA 4LZSA 5II1A 5K29A 2N9GA 2G4AA 2OUOA 4LYIA 4LRGA 5HENA 3LJWA 5CU8A 5HQ7A 4YABA 5DYAA 5IIDA 5D3HA 2L5EA 5EISA 3UV5A 4BJXA 5FB1A 5J0DA 3VKGA 5L8TA 4O70A 4TT4A 3MXFA 4PCEA 4LZRA 3FKMX 3JVJA 4LC2A 5D0CA 3G0JA 3U5MA 3K2JA 1EQFA 4QEVA 3UVDA 4TU6A 4YYJA 5JWMA 5E74A 5L96A 5AD3A 3G0LA 4MR5A 5DX4A 4Z6IA 5KO4A 3Q2EA 5EI4A 5EWDA 5LUUA 2RNXA 4OGIA 5DFBA 3P1EA 4LR6A 4PTBA 3D7CA 5EPBA 3UVWA 5CUBA 5HQ6A 3LQHA 4O7AA 4YYHA 5LJ1A 5CRZA 4YBSA 5F3AA 5LVQA 5DFCA 5FE6A 4QNSA 4PY6A 5G4SA 5LKUA 4HBYA 5LJ0A 4QSRA 5C7NA 2L85A 4ZQLA 1WUGA 5EA1A 4A9OA 5A5OA 1N72A 4UITA 4UYFA 5D7XA 5DY7A 5EWVA 5F2PA 5BT5A 2RS9B 3O33A 5FDZA 5I7XA 5KU3A 5A7CA 5BT4A 3P1CA 4TT6A 2YELA 5HFRA 5CFWA 4A9JA 4Z6HA 5A82A 5DW1A 4YK0A 4IR5A 3O34A 4O7CA 4HBVA 4LDFA 5CUAA 2OSSA 3I3JA 5A83A 5EK9A 4IOOA 5DKCA 4A9LA 5ENIA 3DWYA 4YH3A 2YYNA 2H60A 5HJCA 4CL9A 5D3NA 3SVGA 5H1TA 4MEPA 4MENA 4NRBA 5ETDA 4CFKA 5FG6A 3UVYA 4BW3A 4PKLA 5LJ2A 5EGUA 2I8NA 5F5ZA 5C4QA 4NXJA 3D1DA 2RFJA 5EWHA 4ZC9A 4BW4A 4NUCA 4AKIA 4N4HA 3S92A 4GPJA 3P1FA 4YYGA 3UW9A 5I83A 4YYNA 1WUMA 5ACYA 4KV1A 5FE0A 2R0SA 5HELA 5COIA 5L99A 5LKZA 5E73A 5EQ1A 5CQ4A 4MR4A 4TTEA 2DWWA 2DVVA 5CUEA 4CURA 4QYLA 5E9YA 4ZW1A 5G4RA 5EPRA 3IU6A 3HMEA 5C87A 2RNYA 4QSPA 5FE1A 3U5KA 3VKHA 4N4GA 4QR3A 4YH4A 5L97A 2R0VA 5DYXA 5HQ5A 4AKGA 4QY4A 4PS5A 5CP5A 4N4IA 4Z1QA 5F1LA 4KV4A 5F61A 5FG4A 4O74A 5I29A 5E9MA 5CQ7A 4NUEA 4UIWA 4KCXA 4A9EA 5FE2A 5C8GA 4TS8A 5F36A 3U5NA 2KTBB 2YQDA 4UYEA 5CY9A 5EV9A 3O35A 5I7YA 4XUAA 3QZVA 5EWWA 4AKHA 3QZTA 5F1HA 2DVRA 4UIVA 5C85A 5D3PA 5CQ5A 5E9VA 5CGPA 5EPSA 5IG6A 5CS8A 4IR6A 5HEMA 5L8UA 4TU4A 5H85A 4O78A 4ALHA 5F62A 4YY4A 3Q2FA 4QYDA 5ENFA 3O37A 4QEWA 4WHWA 4PCIA 2YEKA 4YY6A 5D3SA 3LXJA 1E6IA 4HXLA 5H1UA 5LKTA 4YADA 4NUDA 4NR8A 5LVRA 5HRVA 4RVRA 2WP1A 4N4FA 5I88A 4XY9A 4A9IA 4TZ8A 2D82A 5HRWA 5IGNA 4A9KA 2R10A 4CUSA 5F60A 5BT3A 2E3KA 5CQ8A 4XYAA 3QZSA 3MUKA 5CUCA 4QUUA 4YYDA 3LQJA 5IBNA 4YBTA 5LKXA 4QSQA 5EM3A 5A5QA 3JVLA 4TZ2A 4QR5A 1JSPB 4F3IA 5DLXA 5HM0A 3RCWA 4UIUA 4C67A 5HFQA 4Z1SA 4Q0OA 1F68A 5FE4A 4LYSA 5FH8A 5DW2A 5DBMA 4A9NA 5DKHA 2GRCA 4MEQA 5CTLA 5H1VA 4CFLA 4Y03A 4J1PA 3MB4A 3P1DA 4NYVA 5HCLA 4YAXA 3U5JA 5ENBA 4OUFA
chains in the Genus database with same CATH topology
4A9FA 4QB3A 5EWCA 3ONIA 4QUTA 5FFYA 4YBMA 4NR4A 4O7EA 4A9MA 4N3WA 5CQAA 4WHUA 5CQ6A 5E7DA 5A81A 4QC3A 5DLZA 4QSUA 5E9KA 5KHMA 4O76A 4YYMA 4QBMA 5TCMA 4NR6A 3UVXA 2L84A 4MR6A 5DFDA 4HXRA 4J0SA 4O7FA 5TB6A 4YYKA 5D3JA 5IGKA 4QEUA 5ENJA 5CZGA 5AMEA 4HXOA 2F6JA 5E9IA 3HMHA 2E7NA 4HBWA 4BHWA 2DVSA 4ALGA 4YC9A 5F25A 4UYDA 5II2A 4YATA 5KTWA 2DVQA 4UYHA 5D25A 5DYCA 5D3RA 3P5OA 4IORA 1X0JA 2DKWA 4HXPA 1JM4B 5I86A 3GG3A 4BW2A 3U5PA 5HRXA 5CUDA 5E3DA 4NYWA 4WIVA 5FH7A 2FSAA 4HBXA 5CPEA 4BW1A 1ZS5A 4QSSA 5ETBA 2LSPB 3TLPA 3SVHA 5FB0A 2WP2A 4CUUA 4UIZA 5CQTA 4QSVA 5D3TA 5I89A 4IOQA 3NXBA 4CUQA 5L98A 4NQMA 5I40A 4CUPA 3HMFA 4LYWA 5ENHA 4E96A 2RNWA 2MJVB 5E0RA 4QSWA 5D3LA 4NR9A 4O71A 3UV4A 4IR3A 4DONA 5A85A 3LQIA 5FE5A 4TYLA 5ENCA 2E7OA 4HXNA 3U5LA 4XUBA 3AADA 5C89A 5FFWA 3U5OA 5ENGA 5CRMA 2I7KA 5FFVA 3DAIA 3SVFA 5F63A 3JVMA 4QSTA 4O7BA 5KTUA 4HXSA 4O75A 4NQNA 4CUTA 5D24A 5E3GA 4J3IA 4MR3A 5EU1A 5A5RA 5FE8A 5A5PA 4IR4A 5EP7A 4Q0NA 4Z93A 2D9EA 4UYGA 4AKNA 5JI8A 4NYXA 5CQ3A 4NR5A 5I1QA 3S91A 5IGMA 4FLPA 4YYIA 4HXMA 5D26A 4QSXA 5EVAA 4CLBA 2NXBA 5AMFA 4QR4A 4J0RA 4C66A 5KTXA 4UIXA 5FG5A 3JVKA 3MQMA 5AD2A 5FBXA 4LZ2A 2RO1A 5CUGA 2YW5A 2RI7A 4NRAA 3IU5A 4A9HA 4NR7A 4NS5A 2DATA 5A5SA 4UIYA 4O72A 4XY8A 4O77A 2YEMA 5I80A 2YDWA 4X2IA 5ENEA 3MB3A 4UYFB 4MEOA 4TT2A 5A5NA 5FE3A 3UV2A 4HXKA 4QC1A 5IGLA 5FE9A 3ZYUA 5DKDA 5FH6A 5DYUA 3O36A 4TQNA 2F6NA 5FE7A 2R0YA 4OGJA 4QZSA 2OO1A 5HLSA 4NRCA 5EICA 3MULA 3AQAA 5E9LA 4LZSA 5II1A 5K29A 2N9GA 2G4AA 2OUOA 4LYIA 4LRGA 5HENA 3LJWA 5CU8A 5HQ7A 4YABA 5DYAA 5IIDA 5D3HA 2L5EA 5EISA 3UV5A 4BJXA 5FB1A 5J0DA 5L8TA 4O70A 4TT4A 3MXFA 4PCEA 4LZRA 3FKMX 3JVJA 4LC2A 5D0CA 3G0JA 3U5MA 3K2JA 1EQFA 4QEVA 3UVDA 4TU6A 4YYJA 5JWMA 5E74A 5L96A 5AD3A 3G0LA 4MR5A 5DX4A 4Z6IA 5KO4A 3Q2EA 5EI4A 5EWDA 5LUUA 2RNXA 4OGIA 5DFBA 3P1EA 4LR6A 4PTBA 3D7CA 5EPBA 3UVWA 5CUBA 5HQ6A 3LQHA 4O7AA 4YYHA 5LJ1A 5CRZA 4YBSA 5F3AA 5LVQA 5DFCA 5FE6A 4QNSA 4PY6A 5G4SA 5LKUA 4HBYA 5LJ0A 4QSRA 5C7NA 2L85A 4ZQLA 1WUGA 5EA1A 4A9OA 5A5OA 1N72A 4UITA 4UYFA 5D7XA 5DY7A 5EWVA 5F2PA 5BT5A 2RS9B 3O33A 5FDZA 5I7XA 5KU3A 5A7CA 5BT4A 3P1CA 4TT6A 2YELA 5HFRA 5CFWA 4A9JA 4Z6HA 5A82A 5DW1A 4YK0A 4IR5A 3O34A 4O7CA 4HBVA 4LDFA 5CUAA 2OSSA 3I3JA 5A83A 5EK9A 4IOOA 5DKCA 4A9LA 5ENIA 3DWYA 4YH3A 2YYNA 2H60A 5HJCA 4CL9A 5D3NA 3SVGA 5H1TA 4MEPA 4MENA 4NRBA 5ETDA 4CFKA 5FG6A 3UVYA 4BW3A 4PKLA 5LJ2A 5EGUA 2I8NA 5F5ZA 5C4QA 4NXJA 2RFJA 5EWHA 4ZC9A 4BW4A 4NUCA 4N4HA 3S92A 4GPJA 3P1FA 4YYGA 3UW9A 5I83A 4YYNA 1WUMA 5ACYA 4KV1A 5FE0A 2R0SA 5HELA 5COIA 5L99A 5LKZA 5E73A 5EQ1A 5CQ4A 4MR4A 4TTEA 2DWWA 2DVVA 5CUEA 4CURA 4QYLA 5E9YA 4ZW1A 5G4RA 5EPRA 3IU6A 3HMEA 5C87A 2RNYA 4QSPA 5FE1A 3U5KA 4N4GA 4QR3A 4YH4A 5L97A 2R0VA 5DYXA 5HQ5A 4QY4A 4PS5A 5CP5A 4N4IA 4Z1QA 5F1LA 4KV4A 5F61A 5FG4A 4O74A 5I29A 5E9MA 5CQ7A 4NUEA 4UIWA 4KCXA 4A9EA 5FE2A 5C8GA 4TS8A 5F36A 3U5NA 2KTBB 2YQDA 4UYEA 5CY9A 5EV9A 3O35A 5I7YA 4XUAA 3QZVA 5EWWA 3QZTA 5F1HA 2DVRA 4UIVA 5C85A 5D3PA 5CQ5A 5E9VA 5CGPA 5EPSA 5IG6A 5CS8A 4IR6A 5HEMA 5L8UA 4TU4A 5H85A 4O78A 4ALHA 5F62A 4YY4A 3Q2FA 4QYDA 5ENFA 3O37A 4QEWA 4WHWA 4PCIA 2YEKA 4YY6A 5D3SA 3LXJA 1E6IA 4HXLA 5H1UA 5LKTA 4YADA 4NUDA 4NR8A 5LVRA 5HRVA 4RVRA 2WP1A 4N4FA 5I88A 4XY9A 4A9IA 4TZ8A 2D82A 5HRWA 5IGNA 4A9KA 2R10A 4CUSA 5F60A 5BT3A 2E3KA 5CQ8A 4XYAA 3QZSA 3MUKA 5CUCA 4QUUA 4YYDA 3LQJA 5IBNA 4YBTA 5LKXA 4QSQA 5EM3A 5A5QA 3JVLA 4TZ2A 4QR5A 1JSPB 4F3IA 5DLXA 5HM0A 3RCWA 4UIUA 4C67A 5HFQA 4Z1SA 4Q0OA 1F68A 5FE4A 4LYSA 5FH8A 5DW2A 5DBMA 4A9NA 5DKHA 2GRCA 4MEQA 5CTLA 5H1VA 4CFLA 4Y03A 4J1PA 3MB4A 3P1DA 4NYVA 5HCLA 4YAXA 3U5JA 5ENBA 4OUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9F A;  4QB3 A;  5EWC A;  3ONI A;  4QUT A;  5FFY A;  4YBM A;  4NR4 A;  4O7E A;  4A9M A;  4N3W A;  5CQA A;  4WHU A;  5CQ6 A;  5E7D A;  5A81 A;  4QC3 A;  5DLZ A;  4QSU A;  5E9K A;  5KHM A;  4O76 A;  4YYM A;  4QBM A;  5TCM A;  4NR6 A;  3UVX A;  2L84 A;  4MR6 A;  5DFD A;  4HXR A;  4J0S A;  4O7F A;  5TB6 A;  4YYK A;  5D3J A;  5IGK A;  4QEU A;  5ENJ A;  5CZG A;  5AME A;  4HXO A;  2F6J A;  5E9I A;  3HMH A;  2E7N A;  4HBW A;  4BHW A;  2DVS A;  4ALG A;  4YC9 A;  5F25 A;  4UYD A;  5II2 A;  4YAT A;  5KTW A;  2DVQ A;  4UYH A;  5D25 A;  5DYC A;  5D3R A;  3P5O A;  4IOR A;  1X0J A;  2DKW A;  4HXP A;  1JM4 B;  5I86 A;  3GG3 A;  4BW2 A;  3U5P A;  5HRX A;  5CUD A;  5E3D A;  4NYW A;  4WIV A;  5FH7 A;  2FSA A;  4HBX A;  5CPE A;  4BW1 A;  1ZS5 A;  4QSS A;  5ETB A;  2LSP B;  3TLP A;  3SVH A;  5FB0 A;  2WP2 A;  4CUU A;  4UIZ A;  5CQT A;  4QSV A;  5D3T A;  5I89 A;  4IOQ A;  3NXB A;  4CUQ A;  5L98 A;  4NQM A;  5I40 A;  4CUP A;  3HMF A;  4LYW A;  5ENH A;  4E96 A;  2RNW A;  2MJV B;  5E0R A;  4QSW A;  5D3L A;  4NR9 A;  4O71 A;  3UV4 A;  4IR3 A;  4DON A;  5A85 A;  3LQI A;  5FE5 A;  4TYL A;  5ENC A;  2E7O A;  4HXN A;  3U5L A;  4XUB A;  3AAD A;  5C89 A;  5FFW A;  3U5O A;  5ENG A;  5CRM A;  2I7K A;  5FFV A;  3DAI A;  3SVF A;  5F63 A;  3JVM A;  4QST A;  4O7B A;  5KTU A;  4HXS A;  4O75 A;  4NQN A;  4CUT A;  5D24 A;  5E3G A;  4J3I A;  4MR3 A;  5EU1 A;  5A5R A;  5FE8 A;  5A5P A;  4IR4 A;  5EP7 A;  4Q0N A;  4Z93 A;  2D9E A;  4UYG A;  4AKN A;  5JI8 A;  4NYX A;  5CQ3 A;  4NR5 A;  5I1Q A;  3S91 A;  5IGM A;  4FLP A;  4YYI A;  4HXM A;  5D26 A;  4QSX A;  5EVA A;  4CLB A;  2NXB A;  5AMF A;  4QR4 A;  4J0R A;  4C66 A;  5KTX A;  4UIX A;  5FG5 A;  3JVK A;  3MQM A;  5AD2 A;  5FBX A;  4LZ2 A;  2RO1 A;  5CUG A;  2YW5 A;  2RI7 A;  4NRA A;  3IU5 A;  4A9H A;  4NR7 A;  4NS5 A;  2DAT A;  5A5S A;  4UIY A;  4O72 A;  4XY8 A;  4O77 A;  2YEM A;  5I80 A;  2YDW A;  4X2I A;  5ENE A;  3MB3 A;  4UYF B;  4MEO A;  4TT2 A;  5A5N A;  5FE3 A;  3UV2 A;  4HXK A;  4QC1 A;  5IGL A;  5FE9 A;  3ZYU A;  5DKD A;  5FH6 A;  5DYU A;  3O36 A;  4TQN A;  2F6N A;  5FE7 A;  2R0Y A;  4OGJ A;  4QZS A;  2OO1 A;  5HLS A;  4NRC A;  5EIC A;  3MUL A;  3AQA A;  5E9L A;  4LZS A;  5II1 A;  5K29 A;  2N9G A;  2G4A A;  2OUO A;  4LYI A;  4LRG A;  5HEN A;  3LJW A;  5CU8 A;  5HQ7 A;  4YAB A;  5DYA A;  5IID A;  5D3H A;  2L5E A;  5EIS A;  3UV5 A;  4BJX A;  5FB1 A;  5J0D A;  5L8T A;  4O70 A;  4TT4 A;  3MXF A;  4PCE A;  4LZR A;  3FKM X;  3JVJ A;  4LC2 A;  5D0C A;  3G0J A;  3U5M A;  3K2J A;  1EQF A;  4QEV A;  3UVD A;  4TU6 A;  4YYJ A;  5JWM A;  5E74 A;  5L96 A;  5AD3 A;  3G0L A;  4MR5 A;  5DX4 A;  4Z6I A;  5KO4 A;  3Q2E A;  5EI4 A;  5EWD A;  5LUU A;  2RNX A;  4OGI A;  5DFB A;  3P1E A;  4LR6 A;  4PTB A;  3D7C A;  5EPB A;  3UVW A;  5CUB A;  5HQ6 A;  3LQH A;  4O7A A;  4YYH A;  5LJ1 A;  5CRZ A;  4YBS A;  5F3A A;  5LVQ A;  5DFC A;  5FE6 A;  4QNS A;  4PY6 A;  5G4S A;  5LKU A;  4HBY A;  5LJ0 A;  4QSR A;  5C7N A;  2L85 A;  4ZQL A;  1WUG A;  5EA1 A;  4A9O A;  5A5O A;  1N72 A;  4UIT A;  4UYF A;  5D7X A;  5DY7 A;  5EWV A;  5F2P A;  5BT5 A;  2RS9 B;  3O33 A;  5FDZ A;  5I7X A;  5KU3 A;  5A7C A;  5BT4 A;  3P1C A;  4TT6 A;  2YEL A;  5HFR A;  5CFW A;  4A9J A;  4Z6H A;  5A82 A;  5DW1 A;  4YK0 A;  4IR5 A;  3O34 A;  4O7C A;  4HBV A;  4LDF A;  5CUA A;  2OSS A;  3I3J A;  5A83 A;  5EK9 A;  4IOO A;  5DKC A;  4A9L A;  5ENI A;  3DWY A;  4YH3 A;  2YYN A;  2H60 A;  5HJC A;  4CL9 A;  5D3N A;  3SVG A;  5H1T A;  4MEP A;  4MEN A;  4NRB A;  5ETD A;  4CFK A;  5FG6 A;  3UVY A;  4BW3 A;  4PKL A;  5LJ2 A;  5EGU A;  2I8N A;  5F5Z A;  5C4Q A;  4NXJ A;  2RFJ A;  5EWH A;  4ZC9 A;  4BW4 A;  4NUC A;  4N4H A;  3S92 A;  4GPJ A;  3P1F A;  4YYG A;  3UW9 A;  5I83 A;  4YYN A;  1WUM A;  5ACY A;  4KV1 A;  5FE0 A;  2R0S A;  5HEL A;  5COI A;  5L99 A;  5LKZ A;  5E73 A;  5EQ1 A;  5CQ4 A;  4MR4 A;  4TTE A;  2DWW A;  2DVV A;  5CUE A;  4CUR A;  4QYL A;  5E9Y A;  4ZW1 A;  5G4R A;  5EPR A;  3IU6 A;  3HME A;  5C87 A;  2RNY A;  4QSP A;  5FE1 A;  3U5K A;  4N4G A;  4QR3 A;  4YH4 A;  5L97 A;  2R0V A;  5DYX A;  5HQ5 A;  4QY4 A;  4PS5 A;  5CP5 A;  4N4I A;  4Z1Q A;  5F1L A;  4KV4 A;  5F61 A;  5FG4 A;  4O74 A;  5I29 A;  5E9M A;  5CQ7 A;  4NUE A;  4UIW A;  4KCX A;  4A9E A;  5FE2 A;  5C8G A;  4TS8 A;  5F36 A;  3U5N A;  2KTB B;  2YQD A;  4UYE A;  5CY9 A;  5EV9 A;  3O35 A;  5I7Y A;  4XUA A;  3QZV A;  5EWW A;  3QZT A;  5F1H A;  2DVR A;  4UIV A;  5C85 A;  5D3P A;  5CQ5 A;  5E9V A;  5CGP A;  5EPS A;  5IG6 A;  5CS8 A;  4IR6 A;  5HEM A;  5L8U A;  4TU4 A;  5H85 A;  4O78 A;  4ALH A;  5F62 A;  4YY4 A;  3Q2F A;  4QYD A;  5ENF A;  3O37 A;  4QEW A;  4WHW A;  4PCI A;  2YEK A;  4YY6 A;  5D3S A;  3LXJ A;  1E6I A;  4HXL A;  5H1U A;  5LKT A;  4YAD A;  4NUD A;  4NR8 A;  5LVR A;  5HRV A;  4RVR A;  2WP1 A;  4N4F A;  5I88 A;  4XY9 A;  4A9I A;  4TZ8 A;  2D82 A;  5HRW A;  5IGN A;  4A9K A;  2R10 A;  4CUS A;  5F60 A;  5BT3 A;  2E3K A;  5CQ8 A;  4XYA A;  3QZS A;  3MUK A;  5CUC A;  4QUU A;  4YYD A;  3LQJ A;  5IBN A;  4YBT A;  5LKX A;  4QSQ A;  5EM3 A;  5A5Q A;  3JVL A;  4TZ2 A;  4QR5 A;  1JSP B;  4F3I A;  5DLX A;  5HM0 A;  3RCW A;  4UIU A;  4C67 A;  5HFQ A;  4Z1S A;  4Q0O A;  1F68 A;  5FE4 A;  4LYS A;  5FH8 A;  5DW2 A;  5DBM A;  4A9N A;  5DKH A;  2GRC A;  4MEQ A;  5CTL A;  5H1V A;  4CFL A;  4Y03 A;  4J1P A;  3MB4 A;  3P1D A;  4NYV A;  5HCL A;  4YAX A;  3U5J A;  5ENB A;  4OUF A; 
#chains in the Genus database with same CATH topology
 4A9F A;  4QB3 A;  5EWC A;  3ONI A;  4QUT A;  5FFY A;  4YBM A;  4NR4 A;  4O7E A;  4A9M A;  4N3W A;  5CQA A;  4WHU A;  5CQ6 A;  5E7D A;  5A81 A;  4QC3 A;  5DLZ A;  4QSU A;  5E9K A;  5KHM A;  4O76 A;  4YYM A;  4QBM A;  5TCM A;  4NR6 A;  3UVX A;  2L84 A;  4MR6 A;  5DFD A;  4HXR A;  4J0S A;  4O7F A;  5TB6 A;  4YYK A;  5D3J A;  5IGK A;  4QEU A;  5ENJ A;  5CZG A;  5AME A;  4HXO A;  2F6J A;  5E9I A;  3HMH A;  2E7N A;  4HBW A;  4BHW A;  2DVS A;  4ALG A;  4YC9 A;  5F25 A;  4UYD A;  2EJN A;  4YAT A;  5II2 A;  5KTW A;  2DVQ A;  4UYH A;  5D25 A;  5DYC A;  5D3R A;  3P5O A;  4IOR A;  1X0J A;  2DKW A;  4HXP A;  1JM4 B;  5I86 A;  3GG3 A;  4BW2 A;  3U5P A;  5HRX A;  5CUD A;  5E3D A;  4NYW A;  4WIV A;  5FH7 A;  2FSA A;  4HBX A;  5CPE A;  4BW1 A;  1ZS5 A;  4QSS A;  5ETB A;  2LSP B;  3TLP A;  3SVH A;  5FB0 A;  2WP2 A;  4CUU A;  4UIZ A;  5CQT A;  4QSV A;  5D3T A;  5I89 A;  4IOQ A;  3NXB A;  4CUQ A;  5L98 A;  4NQM A;  3D1B A;  5I40 A;  4CUP A;  3HMF A;  4LYW A;  5ENH A;  4E96 A;  2RNW A;  2MJV B;  5E0R A;  4QSW A;  5D3L A;  4NR9 A;  4O71 A;  3UV4 A;  4IR3 A;  4DON A;  5A85 A;  3LQI A;  5FE5 A;  4TYL A;  5ENC A;  2E7O A;  4HXN A;  3U5L A;  4XUB A;  3AAD A;  5C89 A;  5FFW A;  3U5O A;  5ENG A;  5CRM A;  2I7K A;  5FFV A;  3DAI A;  3SVF A;  5F63 A;  3JVM A;  4QST A;  4O7B A;  4AI6 A;  5KTU A;  4HXS A;  4O75 A;  4NQN A;  4CUT A;  5D24 A;  5E3G A;  4J3I A;  4MR3 A;  5EU1 A;  5A5R A;  5FE8 A;  5A5P A;  4IR4 A;  5EP7 A;  4Q0N A;  4Z93 A;  2D9E A;  4UYG A;  4AKN A;  5JI8 A;  4NYX A;  5CQ3 A;  1ZKR A;  4NR5 A;  5I1Q A;  3S91 A;  5IGM A;  4FLP A;  3ERR A;  4YYI A;  4HXM A;  5D26 A;  4QSX A;  5EVA A;  4CLB A;  2NXB A;  5AMF A;  4QR4 A;  4J0R A;  4C66 A;  5KTX A;  4UIX A;  5FG5 A;  3JVK A;  3MQM A;  5AD2 A;  5FBX A;  4LZ2 A;  2RO1 A;  5CUG A;  2YW5 A;  2RI7 A;  4NRA A;  3IU5 A;  4A9H A;  4NR7 A;  4NS5 A;  2DAT A;  5A5S A;  4UIY A;  4O72 A;  4XY8 A;  4O77 A;  2YEM A;  5I80 A;  2YDW A;  4X2I A;  5ENE A;  3MB3 A;  4UYF B;  4MEO A;  4TT2 A;  5A5N A;  5FE3 A;  3UV2 A;  4HXK A;  4QC1 A;  5IGL A;  5FE9 A;  3ZYU A;  5DKD A;  5FH6 A;  5DYU A;  3O36 A;  4TQN A;  2F6N A;  5FE7 A;  2R0Y A;  4OGJ A;  4QZS A;  2OO1 A;  5HLS A;  4NRC A;  5EIC A;  3MUL A;  1PUO A;  3AQA A;  5E9L A;  4LZS A;  5II1 A;  5K29 A;  2N9G A;  2G4A A;  2OUO A;  4LYI A;  4LRG A;  5HEN A;  3LJW A;  5CU8 A;  5HQ7 A;  4YAB A;  5DYA A;  5IID A;  5D3H A;  2L5E A;  5EIS A;  3UV5 A;  4BJX A;  5FB1 A;  5J0D A;  3VKG A;  5L8T A;  4O70 A;  4TT4 A;  3MXF A;  4PCE A;  4LZR A;  3FKM X;  3JVJ A;  4LC2 A;  5D0C A;  3G0J A;  3U5M A;  3K2J A;  1EQF A;  4QEV A;  3UVD A;  4TU6 A;  4YYJ A;  5JWM A;  5E74 A;  5L96 A;  5AD3 A;  3G0L A;  4MR5 A;  5DX4 A;  4Z6I A;  5KO4 A;  3Q2E A;  5EI4 A;  5EWD A;  5LUU A;  2RNX A;  4OGI A;  5DFB A;  3P1E A;  4LR6 A;  4PTB A;  3D7C A;  5EPB A;  3UVW A;  5CUB A;  5HQ6 A;  3LQH A;  4O7A A;  4YYH A;  5LJ1 A;  5CRZ A;  4YBS A;  5F3A A;  5LVQ A;  5DFC A;  5FE6 A;  4QNS A;  4PY6 A;  5G4S A;  5LKU A;  4HBY A;  5LJ0 A;  4QSR A;  5C7N A;  2L85 A;  4ZQL A;  1WUG A;  5EA1 A;  4A9O A;  5A5O A;  1N72 A;  4UIT A;  4UYF A;  5D7X A;  5DY7 A;  5EWV A;  5F2P A;  5BT5 A;  2RS9 B;  3O33 A;  5FDZ A;  5I7X A;  5KU3 A;  5A7C A;  5BT4 A;  3P1C A;  4TT6 A;  2YEL A;  5HFR A;  5CFW A;  4A9J A;  4Z6H A;  5A82 A;  5DW1 A;  4YK0 A;  4IR5 A;  3O34 A;  4O7C A;  4HBV A;  4LDF A;  5CUA A;  2OSS A;  3I3J A;  5A83 A;  5EK9 A;  4IOO A;  5DKC A;  4A9L A;  5ENI A;  3DWY A;  4YH3 A;  2YYN A;  2H60 A;  5HJC A;  4CL9 A;  5D3N A;  3SVG A;  5H1T A;  4MEP A;  4MEN A;  4NRB A;  5ETD A;  4CFK A;  5FG6 A;  3UVY A;  4BW3 A;  4PKL A;  5LJ2 A;  5EGU A;  2I8N A;  5F5Z A;  5C4Q A;  4NXJ A;  3D1D A;  2RFJ A;  5EWH A;  4ZC9 A;  4BW4 A;  4NUC A;  4AKI A;  4N4H A;  3S92 A;  4GPJ A;  3P1F A;  4YYG A;  3UW9 A;  5I83 A;  4YYN A;  1WUM A;  5ACY A;  4KV1 A;  5FE0 A;  2R0S A;  5HEL A;  5COI A;  5L99 A;  5LKZ A;  5E73 A;  5EQ1 A;  5CQ4 A;  4MR4 A;  4TTE A;  2DWW A;  2DVV A;  5CUE A;  4CUR A;  4QYL A;  5E9Y A;  4ZW1 A;  5G4R A;  5EPR A;  3IU6 A;  3HME A;  5C87 A;  2RNY A;  4QSP A;  5FE1 A;  3U5K A;  3VKH A;  4N4G A;  4QR3 A;  4YH4 A;  5L97 A;  2R0V A;  5DYX A;  5HQ5 A;  4AKG A;  4QY4 A;  4PS5 A;  5CP5 A;  4N4I A;  4Z1Q A;  5F1L A;  4KV4 A;  5F61 A;  5FG4 A;  4O74 A;  5I29 A;  5E9M A;  5CQ7 A;  4NUE A;  4UIW A;  4KCX A;  4A9E A;  5FE2 A;  5C8G A;  4TS8 A;  5F36 A;  3U5N A;  2KTB B;  2YQD A;  4UYE A;  5CY9 A;  5EV9 A;  3O35 A;  5I7Y A;  4XUA A;  3QZV A;  5EWW A;  4AKH A;  3QZT A;  5F1H A;  2DVR A;  4UIV A;  5C85 A;  5D3P A;  5CQ5 A;  5E9V A;  5CGP A;  5EPS A;  5IG6 A;  5CS8 A;  4IR6 A;  5HEM A;  5L8U A;  4TU4 A;  5H85 A;  4O78 A;  4ALH A;  5F62 A;  4YY4 A;  3Q2F A;  4QYD A;  5ENF A;  3O37 A;  4QEW A;  4WHW A;  4PCI A;  2YEK A;  4YY6 A;  5D3S A;  3LXJ A;  1E6I A;  4HXL A;  5H1U A;  5LKT A;  4YAD A;  4NUD A;  4NR8 A;  5LVR A;  5HRV A;  4RVR A;  2WP1 A;  4N4F A;  5I88 A;  4XY9 A;  4A9I A;  4TZ8 A;  2D82 A;  5HRW A;  5IGN A;  4A9K A;  2R10 A;  4CUS A;  5F60 A;  5BT3 A;  2E3K A;  5CQ8 A;  4XYA A;  3QZS A;  3MUK A;  5CUC A;  4QUU A;  4YYD A;  3LQJ A;  5IBN A;  4YBT A;  5LKX A;  4QSQ A;  5EM3 A;  5A5Q A;  3JVL A;  4TZ2 A;  4QR5 A;  1JSP B;  4F3I A;  5DLX A;  5HM0 A;  3RCW A;  4UIU A;  4C67 A;  5HFQ A;  4Z1S A;  4Q0O A;  1F68 A;  5FE4 A;  4LYS A;  5FH8 A;  5DW2 A;  5DBM A;  4A9N A;  5DKH A;  2GRC A;  4MEQ A;  5CTL A;  5H1V A;  4CFL A;  4Y03 A;  4J1P A;  3MB4 A;  3P1D A;  4NYV A;  5HCL A;  4YAX A;  3U5J A;  5ENB A;  4OUF A; 
#chains in the Genus database with same CATH homology
 4A9F A;  4QB3 A;  5EWC A;  3ONI A;  4QUT A;  5FFY A;  4YBM A;  4NR4 A;  4O7E A;  4A9M A;  4N3W A;  5CQA A;  4WHU A;  5CQ6 A;  5E7D A;  5A81 A;  4QC3 A;  5DLZ A;  4QSU A;  5E9K A;  5KHM A;  4O76 A;  4YYM A;  4QBM A;  5TCM A;  4NR6 A;  3UVX A;  2L84 A;  4MR6 A;  5DFD A;  4HXR A;  4J0S A;  4O7F A;  5TB6 A;  4YYK A;  5D3J A;  5IGK A;  4QEU A;  5ENJ A;  5CZG A;  5AME A;  4HXO A;  2F6J A;  5E9I A;  3HMH A;  2E7N A;  4HBW A;  4BHW A;  2DVS A;  4ALG A;  4YC9 A;  5F25 A;  4UYD A;  5II2 A;  4YAT A;  5KTW A;  2DVQ A;  4UYH A;  5D25 A;  5DYC A;  5D3R A;  3P5O A;  4IOR A;  1X0J A;  2DKW A;  4HXP A;  1JM4 B;  5I86 A;  3GG3 A;  4BW2 A;  3U5P A;  5HRX A;  5CUD A;  5E3D A;  4NYW A;  4WIV A;  5FH7 A;  2FSA A;  4HBX A;  5CPE A;  4BW1 A;  1ZS5 A;  4QSS A;  5ETB A;  2LSP B;  3TLP A;  3SVH A;  5FB0 A;  2WP2 A;  4CUU A;  4UIZ A;  5CQT A;  4QSV A;  5D3T A;  5I89 A;  4IOQ A;  3NXB A;  4CUQ A;  5L98 A;  4NQM A;  5I40 A;  4CUP A;  3HMF A;  4LYW A;  5ENH A;  4E96 A;  2RNW A;  2MJV B;  5E0R A;  4QSW A;  5D3L A;  4NR9 A;  4O71 A;  3UV4 A;  4IR3 A;  4DON A;  5A85 A;  3LQI A;  5FE5 A;  4TYL A;  5ENC A;  2E7O A;  4HXN A;  3U5L A;  4XUB A;  3AAD A;  5C89 A;  5FFW A;  3U5O A;  5ENG A;  5CRM A;  2I7K A;  5FFV A;  3DAI A;  3SVF A;  5F63 A;  3JVM A;  4QST A;  4O7B A;  5KTU A;  4HXS A;  4O75 A;  4NQN A;  4CUT A;  5D24 A;  5E3G A;  4J3I A;  4MR3 A;  5EU1 A;  5A5R A;  5FE8 A;  5A5P A;  4IR4 A;  5EP7 A;  4Q0N A;  4Z93 A;  2D9E A;  4UYG A;  4AKN A;  5JI8 A;  4NYX A;  5CQ3 A;  4NR5 A;  5I1Q A;  3S91 A;  5IGM A;  4FLP A;  4YYI A;  4HXM A;  5D26 A;  4QSX A;  5EVA A;  4CLB A;  2NXB A;  5AMF A;  4QR4 A;  4J0R A;  4C66 A;  5KTX A;  4UIX A;  5FG5 A;  3JVK A;  3MQM A;  5AD2 A;  5FBX A;  4LZ2 A;  2RO1 A;  5CUG A;  2YW5 A;  2RI7 A;  4NRA A;  3IU5 A;  4A9H A;  4NR7 A;  4NS5 A;  2DAT A;  5A5S A;  4UIY A;  4O72 A;  4XY8 A;  4O77 A;  2YEM A;  5I80 A;  2YDW A;  4X2I A;  5ENE A;  3MB3 A;  4UYF B;  4MEO A;  4TT2 A;  5A5N A;  5FE3 A;  3UV2 A;  4HXK A;  4QC1 A;  5IGL A;  5FE9 A;  3ZYU A;  5DKD A;  5FH6 A;  5DYU A;  3O36 A;  4TQN A;  2F6N A;  5FE7 A;  2R0Y A;  4OGJ A;  4QZS A;  2OO1 A;  5HLS A;  4NRC A;  5EIC A;  3MUL A;  3AQA A;  5E9L A;  4LZS A;  5II1 A;  5K29 A;  2N9G A;  2G4A A;  2OUO A;  4LYI A;  4LRG A;  5HEN A;  3LJW A;  5CU8 A;  5HQ7 A;  4YAB A;  5DYA A;  5IID A;  5D3H A;  2L5E A;  5EIS A;  3UV5 A;  4BJX A;  5FB1 A;  5J0D A;  5L8T A;  4O70 A;  4TT4 A;  3MXF A;  4PCE A;  4LZR A;  3FKM X;  3JVJ A;  4LC2 A;  5D0C A;  3G0J A;  3U5M A;  3K2J A;  1EQF A;  4QEV A;  3UVD A;  4TU6 A;  4YYJ A;  5JWM A;  5E74 A;  5L96 A;  5AD3 A;  3G0L A;  4MR5 A;  5DX4 A;  4Z6I A;  5KO4 A;  3Q2E A;  5EI4 A;  5EWD A;  5LUU A;  2RNX A;  4OGI A;  5DFB A;  3P1E A;  4LR6 A;  4PTB A;  3D7C A;  5EPB A;  3UVW A;  5CUB A;  5HQ6 A;  3LQH A;  4O7A A;  4YYH A;  5LJ1 A;  5CRZ A;  4YBS A;  5F3A A;  5LVQ A;  5DFC A;  5FE6 A;  4QNS A;  4PY6 A;  5G4S A;  5LKU A;  4HBY A;  5LJ0 A;  4QSR A;  5C7N A;  2L85 A;  4ZQL A;  1WUG A;  5EA1 A;  4A9O A;  5A5O A;  1N72 A;  4UIT A;  4UYF A;  5D7X A;  5DY7 A;  5EWV A;  5F2P A;  5BT5 A;  2RS9 B;  3O33 A;  5FDZ A;  5I7X A;  5KU3 A;  5A7C A;  5BT4 A;  3P1C A;  4TT6 A;  2YEL A;  5HFR A;  5CFW A;  4A9J A;  4Z6H A;  5A82 A;  5DW1 A;  4YK0 A;  4IR5 A;  3O34 A;  4O7C A;  4HBV A;  4LDF A;  5CUA A;  2OSS A;  3I3J A;  5A83 A;  5EK9 A;  4IOO A;  5DKC A;  4A9L A;  5ENI A;  3DWY A;  4YH3 A;  2YYN A;  2H60 A;  5HJC A;  4CL9 A;  5D3N A;  3SVG A;  5H1T A;  4MEP A;  4MEN A;  4NRB A;  5ETD A;  4CFK A;  5FG6 A;  3UVY A;  4BW3 A;  4PKL A;  5LJ2 A;  5EGU A;  2I8N A;  5F5Z A;  5C4Q A;  4NXJ A;  2RFJ A;  5EWH A;  4ZC9 A;  4BW4 A;  4NUC A;  4N4H A;  3S92 A;  4GPJ A;  3P1F A;  4YYG A;  3UW9 A;  5I83 A;  4YYN A;  1WUM A;  5ACY A;  4KV1 A;  5FE0 A;  2R0S A;  5HEL A;  5COI A;  5L99 A;  5LKZ A;  5E73 A;  5EQ1 A;  5CQ4 A;  4MR4 A;  4TTE A;  2DWW A;  2DVV A;  5CUE A;  4CUR A;  4QYL A;  5E9Y A;  4ZW1 A;  5G4R A;  5EPR A;  3IU6 A;  3HME A;  5C87 A;  2RNY A;  4QSP A;  5FE1 A;  3U5K A;  4N4G A;  4QR3 A;  4YH4 A;  5L97 A;  2R0V A;  5DYX A;  5HQ5 A;  4QY4 A;  4PS5 A;  5CP5 A;  4N4I A;  4Z1Q A;  5F1L A;  4KV4 A;  5F61 A;  5FG4 A;  4O74 A;  5I29 A;  5E9M A;  5CQ7 A;  4NUE A;  4UIW A;  4KCX A;  4A9E A;  5FE2 A;  5C8G A;  4TS8 A;  5F36 A;  3U5N A;  2KTB B;  2YQD A;  4UYE A;  5CY9 A;  5EV9 A;  3O35 A;  5I7Y A;  4XUA A;  3QZV A;  5EWW A;  3QZT A;  5F1H A;  2DVR A;  4UIV A;  5C85 A;  5D3P A;  5CQ5 A;  5E9V A;  5CGP A;  5EPS A;  5IG6 A;  5CS8 A;  4IR6 A;  5HEM A;  5L8U A;  4TU4 A;  5H85 A;  4O78 A;  4ALH A;  5F62 A;  4YY4 A;  3Q2F A;  4QYD A;  5ENF A;  3O37 A;  4QEW A;  4WHW A;  4PCI A;  2YEK A;  4YY6 A;  5D3S A;  3LXJ A;  1E6I A;  4HXL A;  5H1U A;  5LKT A;  4YAD A;  4NUD A;  4NR8 A;  5LVR A;  5HRV A;  4RVR A;  2WP1 A;  4N4F A;  5I88 A;  4XY9 A;  4A9I A;  4TZ8 A;  2D82 A;  5HRW A;  5IGN A;  4A9K A;  2R10 A;  4CUS A;  5F60 A;  5BT3 A;  2E3K A;  5CQ8 A;  4XYA A;  3QZS A;  3MUK A;  5CUC A;  4QUU A;  4YYD A;  3LQJ A;  5IBN A;  4YBT A;  5LKX A;  4QSQ A;  5EM3 A;  5A5Q A;  3JVL A;  4TZ2 A;  4QR5 A;  1JSP B;  4F3I A;  5DLX A;  5HM0 A;  3RCW A;  4UIU A;  4C67 A;  5HFQ A;  4Z1S A;  4Q0O A;  1F68 A;  5FE4 A;  4LYS A;  5FH8 A;  5DW2 A;  5DBM A;  4A9N A;  5DKH A;  2GRC A;  4MEQ A;  5CTL A;  5H1V A;  4CFL A;  4Y03 A;  4J1P A;  3MB4 A;  3P1D A;  4NYV A;  5HCL A;  4YAX A;  3U5J A;  5ENB A;  4OUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...