4LRGA

Structure of brd4 bromodomain 1 with a dimethyl thiophene isoxazole azepine carboxamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery, Design, and Optimization of Isoxazole Azepine BET Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lrgA01
2RNYA 4TQNA 5HELA 4O78A 4NQNA 5DBMA 3LQHA 1N72A 4NRAA 2L85A 3AADA 5CQTA 4QSUA 5CQAA 4YBMA 2KTBB 3JVLA 3G0JA 5I29A 3DAIA 4PS5A 4O71A 3ZYUA 4QR4A 5C85A 4QR5A 4ALGA 5CQ3A 4QSPA 4LYSA 1ZS5A 4UYEA 4PTBA 2YQDA 5FH6A 4YABA 2H60A 4FLPA 5DYUA 4NR6A 4OGIA 4BJXA 5CQ6A 3JVJA 3MXFA 4A9KA 4OGJA 3NXBA 5KU3A 2YYNA 2DVQA 5HJCA 5I1QA 4NRBA 2YELA 3QZSA 2F6JA 3U5MA 4CUPA 5D3JA 5EV9A 4YBSA 5DFBA 3UV4A 5HLSA 4J0SA 4YAXA 3SVGA 2G4AA 5IGMA 4CURA 4Z1QA 5H1VA 4MEQA 5CUGA 3SVHA 4O70A 5CFWA 5CQ5A 4QSVA 5CUAA 4XUAA 5EISA 5EWDA 4QZSA 1E6IA 4ZQLA 3UVYA 2R10A 5EGUA 5L96A 5A5RA 4MR4A 5HCLA 5CUBA 4XYAA 4YK0A 4QC1A 5CTLA 2D82A 5H85A 5KHMA 5EU1A 5E9MA 5JI8A 4KCXA 5JWMA 5L98A 3JVMA 5LVQA 2RFJA 4MR5A 4N3WA 5DFCA 5FFYA 4TU4A 5G4SA 4A9JA 4LYIA 5LKTA 2DVSA 5DKCA 4TZ2A 5IBNA 5II2A 4J0RA 5DW1A 5D0CA 4N4FA 5FFVA 3P1CA 4LDFA 4BHWA 5C8GA 4IORA 4QC3A 5FG6A 3Q2FA 3G0LA 4Z93A 5I7XA 5EA1A 3GG3A 3O37A 4NUCA 5FE4A 4YH4A 2RNXA 4J1PA 4YY6A 3MUKA 2LSPB 5CRMA 3IU5A 5DLZA 2RNWA 4NYVA 4O7FA 5D3SA 5COIA 5IGNA 1JSPB 4UIXA 3U5OA 3DWYA 4HXSA 3MULA 5F2PA 4Y03A 5FG4A 5G4RA 5BT5A 4XUBA 5C89A 4C66A 4BW3A 5CZGA 5EP7A 5FFWA 2YEMA 4KV1A 4HXPA 2WP2A 4HXKA 3UW9A 4CFKA 5E0RA 5I83A 5HRVA 5A5QA 4YATA 4OUFA 5CP5A 3O36A 4PCIA 4ZW1A 4XY8A 4A9EA 5ENFA 4NR9A 4KV4A 5A82A 4IOOA 5I40A 5KTUA 5D26A 4LZ2A 3SVFA 5AD2A 5A83A 5DLXA 5LKZA 3JVKA 5FH8A 4TZ8A 5D24A 5E3DA 5DY7A 4O7AA 5KTXA 4YADA 5FB1A 4LR6A 2R0YA 4N4GA 4J3IA 3P5OA 5IGLA 4QBMA 5C4QA 4HBVA 4O7BA 5AMEA 5C7NA 5A5PA 5ENJA 5FE8A 5TCMA 2R0SA 4UYFA 5CUEA 4A9MA 5EWCA 4BW2A 4CUTA 4CUQA 4QEWA 5AMFA 2OO1A 5DW2A 3MQMA 4UIYA 4LYWA 2RI7A 3LQIA 4YYJA 5DX4A 4QUUA 5HEMA 5CQ8A 5H1TA 5A5OA 5IGKA 5K29A 4Q0OA 5ENIA 3O33A 3FKMX 2E3KA 4DONA 4O7CA 5FG5A 5HENA 3HMFA 2I7KA 4MR3A 2DVRA 4GPJA 4QSRA 5LUUA 5L8TA 2DVVA 5LKUA 2R0VA 5DKHA 5ENGA 5HQ6A 3U5LA 4O77A 4UIVA 3MB3A 4NR8A 3QZVA 4YBTA 3UVXA 2D9EA 5EWHA 3P1EA 5FH7A 4UIZA 4A9IA 5L99A 5F1LA 5CU8A 1EQFA 5DFDA 5EK9A 4NXJA 4TYLA 5FE1A 4QY4A 5TB6A 5CQ7A 3ONIA 5I89A 4YY4A 3QZTA 4O75A 2NXBA 4QSWA 5E9YA 5E7DA 5FE6A 4Z6IA 4QB3A 4O7EA 3S92A 3S91A 4NUEA 4TS8A 5E73A 4HBXA 3P1DA 4UYDA 4F3IA 4LZSA 5I80A 3HMHA 2WP1A 5CUDA 4A9LA 2YDWA 5EPRA 4TT4A 5F61A 4NUDA 4MEOA 4YC9A 3O35A 4NRCA 5D7XA 5EPBA 4YYKA 5LVRA 2FSAA 5F60A 5D3RA 2RS9B 3K2JA 5HRXA 5FBXA 5DYCA 4O76A 5A81A 4QSSA 4WIVA 3RCWA 4QYDA 5E9IA 4QEVA 4N4IA 5IG6A 5KO4A 4HXOA 5HRWA 3LQJA 5A5NA 5A85A 4IOQA 4A9FA 2MJVB 4YYDA 5J0DA 5E9LA 2L5EA 5CGPA 3UV2A 4O72A 5E3GA 5EWVA 4A9HA 5IIDA 2E7NA 3U5NA 4HXNA 5EI4A 5E9VA 5EQ1A 2N9GA 4IR4A 4Q0NA 4RVRA 3I3JA 2I8NA 4QSTA 5EWWA 4TU6A 5CUCA 4YYGA 2DKWA 4UITA 1WUMA 2OSSA 4NS5A 4NR5A 5HQ7A 4CL9A 2F6NA 4HXLA 4Z6HA 4UYGA 5FB0A 5C87A 5HM0A 2L84A 4CUUA 5CS8A 1JM4B 5DKDA 4QSXA 4MENA 5EPSA 2YEKA 5ENBA 5EVAA 5F63A 4QYLA 5ETBA 5KTWA 3U5KA 4YYMA 5F1HA 5LKXA 5A7CA 4CLBA 2YW5A 5LJ2A 4UIUA 4PCEA 5L97A 5CY9A 5I86A 4X2IA 4CUSA 5FE5A 5E9KA 4MR6A 4O74A 5ENEA 3U5PA 5HFQA 5I88A 4A9NA 5HFRA 4HBWA 5ENHA 2GRCA 4WHUA 4LRGA 5BT3A 4WHWA 4BW1A 4TT6A 5D3TA 4YYNA 4IR3A 3D7CA 3IU6A 2OUOA 5D25A 4BW4A 4PY6A 4IR6A 5A5SA 4LC2A 4NR7A 4ALHA 4HXRA 5FDZA 5LJ0A 5ENCA 5BT4A 4E96A 5FE0A 5EM3A 5ACYA 4QEUA 5L8UA 3LJWA 5ETDA 3HMEA 4UYFB 4NQMA 5D3LA 4NYWA 4QNSA 4Z1SA 5F36A 4YYIA 2RO1A 5CRZA 4ZC9A 5H1UA 4TTEA 4QR3A 4CFLA 4A9OA 4UIWA 1F68A 4MEPA 4C67A 4N4HA 5E74A 4HBYA 3UVDA 4QUTA 1WUGA 5AD3A 4TT2A 2E7OA 4LZRA 4UYHA 3TLPA 5II1A 5F3AA 5FE3A 5I7YA 3AQAA 3O34A 3MB4A 4HXMA 2DATA 1X0JA 5D3PA 5DYAA 5FE7A 4QSQA 5HQ5A 4YH3A 4PKLA 5LJ1A 5D3HA 4AKNA 5EICA 5F62A 4YYHA 3P1FA 5F5ZA 4NYXA 5F25A 3Q2EA 5D3NA 5DYXA 2DWWA 4IR5A 3UV5A 3LXJA 4XY9A 5CPEA 5FE2A 3UVWA 4NR4A 5CQ4A 5FE9A 3U5JA
chains in the Genus database with same CATH superfamily
2RNYA 4TQNA 5HELA 4O78A 4NQNA 5DBMA 3LQHA 1N72A 4AKHA 4NRAA 2L85A 3AADA 5CQTA 4QSUA 5CQAA 4YBMA 2KTBB 3JVLA 3G0JA 5I29A 3DAIA 4PS5A 4O71A 3ZYUA 4QR4A 5C85A 4QR5A 4ALGA 5CQ3A 4QSPA 4LYSA 1ZS5A 4UYEA 4PTBA 2YQDA 5FH6A 4YABA 2H60A 4FLPA 5DYUA 4NR6A 4OGIA 4BJXA 5CQ6A 3JVJA 3MXFA 4A9KA 4OGJA 3NXBA 5KU3A 2YYNA 2DVQA 5HJCA 5I1QA 4NRBA 2YELA 3QZSA 2F6JA 3U5MA 4CUPA 5D3JA 5EV9A 4YBSA 5DFBA 3UV4A 5HLSA 4J0SA 4YAXA 3SVGA 2G4AA 5IGMA 4CURA 4Z1QA 5H1VA 4MEQA 5CUGA 3SVHA 4O70A 5CFWA 5CQ5A 4QSVA 5CUAA 4XUAA 5EISA 5EWDA 4QZSA 4AI6A 1E6IA 4ZQLA 3UVYA 2R10A 5EGUA 5L96A 5A5RA 4MR4A 5HCLA 5CUBA 4XYAA 4YK0A 4QC1A 5CTLA 2D82A 5H85A 5KHMA 5EU1A 5E9MA 5JI8A 4KCXA 5JWMA 3VKGA 5L98A 3JVMA 5LVQA 2RFJA 4MR5A 4N3WA 5DFCA 5FFYA 4TU4A 5G4SA 4A9JA 4LYIA 5LKTA 2DVSA 5DKCA 4TZ2A 5IBNA 5II2A 4J0RA 5DW1A 5D0CA 4N4FA 5FFVA 3P1CA 4LDFA 4BHWA 5C8GA 4IORA 4QC3A 5FG6A 3Q2FA 3G0LA 4Z93A 5I7XA 5EA1A 3GG3A 3O37A 4NUCA 5FE4A 4YH4A 2RNXA 4J1PA 4YY6A 3MUKA 2LSPB 5CRMA 3IU5A 5DLZA 2RNWA 4NYVA 4O7FA 5D3SA 5COIA 5IGNA 1JSPB 4UIXA 3U5OA 3DWYA 4HXSA 3MULA 5F2PA 4Y03A 5FG4A 5G4RA 5BT5A 4XUBA 5C89A 4C66A 4BW3A 5CZGA 5EP7A 5FFWA 2YEMA 4KV1A 4HXPA 2EJNA 2WP2A 4HXKA 3UW9A 4CFKA 5E0RA 5I83A 5HRVA 5A5QA 4YATA 4OUFA 5CP5A 3O36A 4PCIA 4ZW1A 4XY8A 1ZKRA 4A9EA 5ENFA 4NR9A 4KV4A 5A82A 4IOOA 5I40A 5KTUA 5D26A 4LZ2A 3SVFA 5AD2A 5A83A 5DLXA 5LKZA 3JVKA 5FH8A 4TZ8A 5D24A 5E3DA 5DY7A 4O7AA 5KTXA 4YADA 5FB1A 4LR6A 2R0YA 4N4GA 4J3IA 3P5OA 5IGLA 4QBMA 5C4QA 4AKIA 4HBVA 4O7BA 5AMEA 5C7NA 5A5PA 5ENJA 5FE8A 5TCMA 2R0SA 4UYFA 5CUEA 4A9MA 5EWCA 4BW2A 4CUTA 3VKHA 4CUQA 4QEWA 5AMFA 2OO1A 5DW2A 3MQMA 4UIYA 4LYWA 2RI7A 3LQIA 4YYJA 5DX4A 4QUUA 5HEMA 5CQ8A 5H1TA 5A5OA 5IGKA 5K29A 4Q0OA 5ENIA 3O33A 3FKMX 2E3KA 4DONA 4O7CA 5FG5A 5HENA 3HMFA 2I7KA 4MR3A 2DVRA 4GPJA 4QSRA 5LUUA 5L8TA 2DVVA 5LKUA 2R0VA 5DKHA 5ENGA 5HQ6A 3U5LA 4O77A 4UIVA 3MB3A 4NR8A 3QZVA 4YBTA 3UVXA 2D9EA 5EWHA 3P1EA 5FH7A 4UIZA 4A9IA 5L99A 5F1LA 5CU8A 1EQFA 5DFDA 5EK9A 4NXJA 4TYLA 5FE1A 4QY4A 5TB6A 5CQ7A 3ONIA 5I89A 4YY4A 3D1BA 3QZTA 4O75A 3ERRA 2NXBA 4QSWA 5E9YA 5E7DA 5FE6A 4Z6IA 4QB3A 4O7EA 3S92A 3S91A 4NUEA 4TS8A 5E73A 4HBXA 3P1DA 4UYDA 4F3IA 4LZSA 5I80A 3HMHA 2WP1A 5CUDA 4A9LA 2YDWA 1PUOA 4TT4A 5EPRA 5F61A 4NUDA 4MEOA 4YC9A 3O35A 4NRCA 5D7XA 5EPBA 4YYKA 5LVRA 2FSAA 5F60A 5D3RA 2RS9B 3K2JA 5HRXA 5FBXA 5DYCA 4O76A 5A81A 4QSSA 4WIVA 3RCWA 4QYDA 5E9IA 4QEVA 4N4IA 5IG6A 5KO4A 4HXOA 5HRWA 3LQJA 5A5NA 5A85A 4IOQA 4A9FA 2MJVB 4YYDA 5J0DA 5E9LA 2L5EA 5CGPA 3UV2A 4O72A 5E3GA 5EWVA 4A9HA 5IIDA 2E7NA 3U5NA 4HXNA 5EI4A 5E9VA 5EQ1A 2N9GA 4IR4A 4Q0NA 4RVRA 3I3JA 2I8NA 4QSTA 5EWWA 4TU6A 5CUCA 4YYGA 2DKWA 4UITA 1WUMA 2OSSA 4NS5A 4NR5A 5HQ7A 4CL9A 2F6NA 4HXLA 4Z6HA 4UYGA 5FB0A 5C87A 5HM0A 2L84A 4AKGA 4CUUA 5CS8A 1JM4B 5DKDA 4QSXA 4MENA 5EPSA 2YEKA 5ENBA 5EVAA 5F63A 4QYLA 5ETBA 5KTWA 3U5KA 4YYMA 5F1HA 5LKXA 5A7CA 4CLBA 2YW5A 5LJ2A 4UIUA 4PCEA 5L97A 5CY9A 5I86A 4X2IA 4CUSA 5FE5A 5E9KA 4MR6A 4O74A 5ENEA 3U5PA 5HFQA 5I88A 4A9NA 5HFRA 4HBWA 5ENHA 2GRCA 4WHUA 4LRGA 5BT3A 4WHWA 4BW1A 4TT6A 5D3TA 4YYNA 4IR3A 3D7CA 3IU6A 2OUOA 5D25A 4BW4A 4PY6A 4IR6A 5A5SA 4LC2A 4NR7A 4ALHA 4HXRA 5FDZA 5LJ0A 5ENCA 5BT4A 4E96A 5FE0A 5EM3A 5ACYA 4QEUA 5L8UA 3LJWA 5ETDA 3HMEA 4UYFB 4NQMA 5D3LA 4NYWA 4QNSA 4Z1SA 5F36A 4YYIA 2RO1A 5CRZA 4ZC9A 5H1UA 4TTEA 4QR3A 4CFLA 4A9OA 4UIWA 1F68A 4MEPA 4C67A 4N4HA 5E74A 4HBYA 3UVDA 4QUTA 1WUGA 5AD3A 4TT2A 2E7OA 4LZRA 4UYHA 3TLPA 5II1A 5F3AA 5FE3A 5I7YA 3AQAA 3O34A 3MB4A 4HXMA 2DATA 1X0JA 5D3PA 5DYAA 5FE7A 4QSQA 5HQ5A 4YH3A 4PKLA 5LJ1A 5D3HA 4AKNA 5EICA 5F62A 4YYHA 3P1FA 5F5ZA 4NYXA 5F25A 3Q2EA 5D3NA 5DYXA 2DWWA 4IR5A 3UV5A 3LXJA 4XY9A 3D1DA 5CPEA 5FE2A 3UVWA 4NR4A 5CQ4A 5FE9A 3U5JA
chains in the Genus database with same CATH topology
2RNYA 4TQNA 5HELA 4O78A 4NQNA 5DBMA 3LQHA 1N72A 4NRAA 2L85A 3AADA 5CQTA 4QSUA 5CQAA 4YBMA 2KTBB 3JVLA 3G0JA 5I29A 3DAIA 4PS5A 4O71A 3ZYUA 4QR4A 5C85A 4QR5A 4ALGA 5CQ3A 4QSPA 4LYSA 1ZS5A 4UYEA 4PTBA 2YQDA 5FH6A 4YABA 2H60A 4FLPA 5DYUA 4NR6A 4OGIA 4BJXA 5CQ6A 3JVJA 3MXFA 4A9KA 4OGJA 3NXBA 5KU3A 2YYNA 2DVQA 5HJCA 5I1QA 4NRBA 2YELA 3QZSA 2F6JA 3U5MA 4CUPA 5D3JA 5EV9A 4YBSA 5DFBA 3UV4A 5HLSA 4J0SA 4YAXA 3SVGA 2G4AA 5IGMA 4CURA 4Z1QA 5H1VA 4MEQA 5CUGA 3SVHA 4O70A 5CFWA 5CQ5A 4QSVA 5CUAA 4XUAA 5EISA 5EWDA 4QZSA 1E6IA 4ZQLA 3UVYA 2R10A 5EGUA 5L96A 5A5RA 4MR4A 5HCLA 5CUBA 4XYAA 4YK0A 4QC1A 5CTLA 2D82A 5H85A 5KHMA 5EU1A 5E9MA 5JI8A 4KCXA 5JWMA 5L98A 3JVMA 5LVQA 2RFJA 4MR5A 4N3WA 5DFCA 5FFYA 4TU4A 5G4SA 4A9JA 4LYIA 5LKTA 2DVSA 5DKCA 4TZ2A 5IBNA 5II2A 4J0RA 5DW1A 5D0CA 4N4FA 5FFVA 3P1CA 4LDFA 4BHWA 5C8GA 4IORA 4QC3A 5FG6A 3Q2FA 3G0LA 4Z93A 5I7XA 5EA1A 3GG3A 3O37A 4NUCA 5FE4A 4YH4A 2RNXA 4J1PA 4YY6A 3MUKA 2LSPB 5CRMA 3IU5A 5DLZA 2RNWA 4NYVA 4O7FA 5D3SA 5COIA 5IGNA 1JSPB 4UIXA 3U5OA 3DWYA 4HXSA 3MULA 5F2PA 4Y03A 5FG4A 5G4RA 5BT5A 4XUBA 5C89A 4C66A 4BW3A 5CZGA 5EP7A 5FFWA 2YEMA 4KV1A 4HXPA 2WP2A 4HXKA 3UW9A 4CFKA 5E0RA 5I83A 5HRVA 5A5QA 4YATA 4OUFA 5CP5A 3O36A 4PCIA 4ZW1A 4XY8A 4A9EA 5ENFA 4NR9A 4KV4A 5A82A 4IOOA 5I40A 5KTUA 5D26A 4LZ2A 3SVFA 5AD2A 5A83A 5DLXA 5LKZA 3JVKA 5FH8A 4TZ8A 5D24A 5E3DA 5DY7A 4O7AA 5KTXA 4YADA 5FB1A 4LR6A 2R0YA 4N4GA 4J3IA 3P5OA 5IGLA 4QBMA 5C4QA 4HBVA 4O7BA 5AMEA 5C7NA 5A5PA 5ENJA 5FE8A 5TCMA 2R0SA 4UYFA 5CUEA 4A9MA 5EWCA 4BW2A 4CUTA 4CUQA 4QEWA 5AMFA 2OO1A 5DW2A 3MQMA 4UIYA 4LYWA 2RI7A 3LQIA 4YYJA 5DX4A 4QUUA 5HEMA 5CQ8A 5H1TA 5A5OA 5IGKA 5K29A 4Q0OA 5ENIA 3O33A 3FKMX 2E3KA 4DONA 4O7CA 5FG5A 5HENA 3HMFA 2I7KA 4MR3A 2DVRA 4GPJA 4QSRA 5LUUA 5L8TA 2DVVA 5LKUA 2R0VA 5DKHA 5ENGA 5HQ6A 3U5LA 4O77A 4UIVA 3MB3A 4NR8A 3QZVA 4YBTA 3UVXA 2D9EA 5EWHA 3P1EA 5FH7A 4UIZA 4A9IA 5L99A 5F1LA 5CU8A 1EQFA 5DFDA 5EK9A 4NXJA 4TYLA 5FE1A 4QY4A 5TB6A 5CQ7A 3ONIA 5I89A 4YY4A 3QZTA 4O75A 2NXBA 4QSWA 5E9YA 5E7DA 5FE6A 4Z6IA 4QB3A 4O7EA 3S92A 3S91A 4NUEA 4TS8A 5E73A 4HBXA 3P1DA 4UYDA 4F3IA 4LZSA 5I80A 3HMHA 2WP1A 5CUDA 4A9LA 2YDWA 5EPRA 4TT4A 5F61A 4NUDA 4MEOA 4YC9A 3O35A 4NRCA 5D7XA 5EPBA 4YYKA 5LVRA 2FSAA 5F60A 5D3RA 2RS9B 3K2JA 5HRXA 5FBXA 5DYCA 4O76A 5A81A 4QSSA 4WIVA 3RCWA 4QYDA 5E9IA 4QEVA 4N4IA 5IG6A 5KO4A 4HXOA 5HRWA 3LQJA 5A5NA 5A85A 4IOQA 4A9FA 2MJVB 4YYDA 5J0DA 5E9LA 2L5EA 5CGPA 3UV2A 4O72A 5E3GA 5EWVA 4A9HA 5IIDA 2E7NA 3U5NA 4HXNA 5EI4A 5E9VA 5EQ1A 2N9GA 4IR4A 4Q0NA 4RVRA 3I3JA 2I8NA 4QSTA 5EWWA 4TU6A 5CUCA 4YYGA 2DKWA 4UITA 1WUMA 2OSSA 4NS5A 4NR5A 5HQ7A 4CL9A 2F6NA 4HXLA 4Z6HA 4UYGA 5FB0A 5C87A 5HM0A 2L84A 4CUUA 5CS8A 1JM4B 5DKDA 4QSXA 4MENA 5EPSA 2YEKA 5ENBA 5EVAA 5F63A 4QYLA 5ETBA 5KTWA 3U5KA 4YYMA 5F1HA 5LKXA 5A7CA 4CLBA 2YW5A 5LJ2A 4UIUA 4PCEA 5L97A 5CY9A 5I86A 4X2IA 4CUSA 5FE5A 5E9KA 4MR6A 4O74A 5ENEA 3U5PA 5HFQA 5I88A 4A9NA 5HFRA 4HBWA 5ENHA 2GRCA 4WHUA 4LRGA 5BT3A 4WHWA 4BW1A 4TT6A 5D3TA 4YYNA 4IR3A 3D7CA 3IU6A 2OUOA 5D25A 4BW4A 4PY6A 4IR6A 5A5SA 4LC2A 4NR7A 4ALHA 4HXRA 5FDZA 5LJ0A 5ENCA 5BT4A 4E96A 5FE0A 5EM3A 5ACYA 4QEUA 5L8UA 3LJWA 5ETDA 3HMEA 4UYFB 4NQMA 5D3LA 4NYWA 4QNSA 4Z1SA 5F36A 4YYIA 2RO1A 5CRZA 4ZC9A 5H1UA 4TTEA 4QR3A 4CFLA 4A9OA 4UIWA 1F68A 4MEPA 4C67A 4N4HA 5E74A 4HBYA 3UVDA 4QUTA 1WUGA 5AD3A 4TT2A 2E7OA 4LZRA 4UYHA 3TLPA 5II1A 5F3AA 5FE3A 5I7YA 3AQAA 3O34A 3MB4A 4HXMA 2DATA 1X0JA 5D3PA 5DYAA 5FE7A 4QSQA 5HQ5A 4YH3A 4PKLA 5LJ1A 5D3HA 4AKNA 5EICA 5F62A 4YYHA 3P1FA 5F5ZA 4NYXA 5F25A 3Q2EA 5D3NA 5DYXA 2DWWA 4IR5A 3UV5A 3LXJA 4XY9A 5CPEA 5FE2A 3UVWA 4NR4A 5CQ4A 5FE9A 3U5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNY A;  4TQN A;  5HEL A;  4O78 A;  4NQN A;  5DBM A;  3LQH A;  1N72 A;  4NRA A;  2L85 A;  3AAD A;  5CQT A;  4QSU A;  5CQA A;  4YBM A;  2KTB B;  3JVL A;  3G0J A;  5I29 A;  3DAI A;  4PS5 A;  4O71 A;  3ZYU A;  4QR4 A;  5C85 A;  4QR5 A;  4ALG A;  5CQ3 A;  4QSP A;  4LYS A;  1ZS5 A;  4UYE A;  4PTB A;  2YQD A;  5FH6 A;  4YAB A;  2H60 A;  4FLP A;  5DYU A;  4NR6 A;  4OGI A;  4BJX A;  5CQ6 A;  3JVJ A;  3MXF A;  4A9K A;  4OGJ A;  3NXB A;  5KU3 A;  2YYN A;  2DVQ A;  5HJC A;  5I1Q A;  4NRB A;  2YEL A;  3QZS A;  2F6J A;  3U5M A;  4CUP A;  5D3J A;  5EV9 A;  4YBS A;  5DFB A;  3UV4 A;  5HLS A;  4J0S A;  4YAX A;  3SVG A;  2G4A A;  5IGM A;  4CUR A;  4Z1Q A;  5H1V A;  4MEQ A;  5CUG A;  3SVH A;  4O70 A;  5CFW A;  5CQ5 A;  4QSV A;  5CUA A;  4XUA A;  5EIS A;  5EWD A;  4QZS A;  1E6I A;  4ZQL A;  3UVY A;  2R10 A;  5EGU A;  5L96 A;  5A5R A;  4MR4 A;  5HCL A;  5CUB A;  4XYA A;  4YK0 A;  4QC1 A;  5CTL A;  2D82 A;  5H85 A;  5KHM A;  5EU1 A;  5E9M A;  5JI8 A;  4KCX A;  5JWM A;  5L98 A;  3JVM A;  5LVQ A;  2RFJ A;  4MR5 A;  4N3W A;  5DFC A;  5FFY A;  4TU4 A;  5G4S A;  4A9J A;  4LYI A;  5LKT A;  2DVS A;  5DKC A;  4TZ2 A;  5IBN A;  5II2 A;  4J0R A;  5DW1 A;  5D0C A;  4N4F A;  5FFV A;  3P1C A;  4LDF A;  4BHW A;  5C8G A;  4IOR A;  4QC3 A;  5FG6 A;  3Q2F A;  3G0L A;  4Z93 A;  5I7X A;  5EA1 A;  3GG3 A;  3O37 A;  4NUC A;  5FE4 A;  4YH4 A;  2RNX A;  4J1P A;  4YY6 A;  3MUK A;  2LSP B;  5CRM A;  3IU5 A;  5DLZ A;  2RNW A;  4NYV A;  4O7F A;  5D3S A;  5COI A;  5IGN A;  1JSP B;  4UIX A;  3U5O A;  3DWY A;  4HXS A;  3MUL A;  5F2P A;  4Y03 A;  5FG4 A;  5G4R A;  5BT5 A;  4XUB A;  5C89 A;  4C66 A;  4BW3 A;  5CZG A;  5EP7 A;  5FFW A;  2YEM A;  4KV1 A;  4HXP A;  2WP2 A;  4HXK A;  3UW9 A;  4CFK A;  5E0R A;  5I83 A;  5HRV A;  5A5Q A;  4YAT A;  4OUF A;  5CP5 A;  3O36 A;  4PCI A;  4ZW1 A;  4XY8 A;  4A9E A;  5ENF A;  4NR9 A;  4KV4 A;  5A82 A;  4IOO A;  5I40 A;  5KTU A;  5D26 A;  4LZ2 A;  3SVF A;  5AD2 A;  5A83 A;  5DLX A;  5LKZ A;  3JVK A;  5FH8 A;  4TZ8 A;  5D24 A;  5E3D A;  5DY7 A;  4O7A A;  5KTX A;  4YAD A;  5FB1 A;  4LR6 A;  2R0Y A;  4N4G A;  4J3I A;  3P5O A;  5IGL A;  4QBM A;  5C4Q A;  4HBV A;  4O7B A;  5AME A;  5C7N A;  5A5P A;  5ENJ A;  5FE8 A;  5TCM A;  2R0S A;  4UYF A;  5CUE A;  4A9M A;  5EWC A;  4BW2 A;  4CUT A;  4CUQ A;  4QEW A;  5AMF A;  2OO1 A;  5DW2 A;  3MQM A;  4UIY A;  4LYW A;  2RI7 A;  3LQI A;  4YYJ A;  5DX4 A;  4QUU A;  5HEM A;  5CQ8 A;  5H1T A;  5A5O A;  5IGK A;  5K29 A;  4Q0O A;  5ENI A;  3O33 A;  3FKM X;  2E3K A;  4DON A;  4O7C A;  5FG5 A;  5HEN A;  3HMF A;  2I7K A;  4MR3 A;  2DVR A;  4GPJ A;  4QSR A;  5LUU A;  5L8T A;  2DVV A;  5LKU A;  2R0V A;  5DKH A;  5ENG A;  5HQ6 A;  3U5L A;  4O77 A;  4UIV A;  3MB3 A;  4NR8 A;  3QZV A;  4YBT A;  3UVX A;  2D9E A;  5EWH A;  3P1E A;  5FH7 A;  4UIZ A;  4A9I A;  5L99 A;  5F1L A;  5CU8 A;  1EQF A;  5DFD A;  5EK9 A;  4NXJ A;  4TYL A;  5FE1 A;  4QY4 A;  5TB6 A;  5CQ7 A;  3ONI A;  5I89 A;  4YY4 A;  3QZT A;  4O75 A;  2NXB A;  4QSW A;  5E9Y A;  5E7D A;  5FE6 A;  4Z6I A;  4QB3 A;  4O7E A;  3S92 A;  3S91 A;  4NUE A;  4TS8 A;  5E73 A;  4HBX A;  3P1D A;  4UYD A;  4F3I A;  4LZS A;  5I80 A;  3HMH A;  2WP1 A;  5CUD A;  4A9L A;  2YDW A;  5EPR A;  4TT4 A;  5F61 A;  4NUD A;  4MEO A;  4YC9 A;  3O35 A;  4NRC A;  5D7X A;  5EPB A;  4YYK A;  5LVR A;  2FSA A;  5F60 A;  5D3R A;  2RS9 B;  3K2J A;  5HRX A;  5FBX A;  5DYC A;  4O76 A;  5A81 A;  4QSS A;  4WIV A;  3RCW A;  4QYD A;  5E9I A;  4QEV A;  4N4I A;  5IG6 A;  5KO4 A;  4HXO A;  5HRW A;  3LQJ A;  5A5N A;  5A85 A;  4IOQ A;  4A9F A;  2MJV B;  4YYD A;  5J0D A;  5E9L A;  2L5E A;  5CGP A;  3UV2 A;  4O72 A;  5E3G A;  5EWV A;  4A9H A;  5IID A;  2E7N A;  3U5N A;  4HXN A;  5EI4 A;  5E9V A;  5EQ1 A;  2N9G A;  4IR4 A;  4Q0N A;  4RVR A;  3I3J A;  2I8N A;  4QST A;  5EWW A;  4TU6 A;  5CUC A;  4YYG A;  2DKW A;  4UIT A;  1WUM A;  2OSS A;  4NS5 A;  4NR5 A;  5HQ7 A;  4CL9 A;  2F6N A;  4HXL A;  4Z6H A;  4UYG A;  5FB0 A;  5C87 A;  5HM0 A;  2L84 A;  4CUU A;  5CS8 A;  1JM4 B;  5DKD A;  4QSX A;  4MEN A;  5EPS A;  2YEK A;  5ENB A;  5EVA A;  5F63 A;  4QYL A;  5ETB A;  5KTW A;  3U5K A;  4YYM A;  5F1H A;  5LKX A;  5A7C A;  4CLB A;  2YW5 A;  5LJ2 A;  4UIU A;  4PCE A;  5L97 A;  5CY9 A;  5I86 A;  4X2I A;  4CUS A;  5FE5 A;  5E9K A;  4MR6 A;  4O74 A;  5ENE A;  3U5P A;  5HFQ A;  5I88 A;  4A9N A;  5HFR A;  4HBW A;  5ENH A;  2GRC A;  4WHU A;  4LRG A;  5BT3 A;  4WHW A;  4BW1 A;  4TT6 A;  5D3T A;  4YYN A;  4IR3 A;  3D7C A;  3IU6 A;  2OUO A;  5D25 A;  4BW4 A;  4PY6 A;  4IR6 A;  5A5S A;  4LC2 A;  4NR7 A;  4ALH A;  4HXR A;  5FDZ A;  5LJ0 A;  5ENC A;  5BT4 A;  4E96 A;  5FE0 A;  5EM3 A;  5ACY A;  4QEU A;  5L8U A;  3LJW A;  5ETD A;  3HME A;  4UYF B;  4NQM A;  5D3L A;  4NYW A;  4QNS A;  4Z1S A;  5F36 A;  4YYI A;  2RO1 A;  5CRZ A;  4ZC9 A;  5H1U A;  4TTE A;  4QR3 A;  4CFL A;  4A9O A;  4UIW A;  1F68 A;  4MEP A;  4C67 A;  4N4H A;  5E74 A;  4HBY A;  3UVD A;  4QUT A;  1WUG A;  5AD3 A;  4TT2 A;  2E7O A;  4LZR A;  4UYH A;  3TLP A;  5II1 A;  5F3A A;  5FE3 A;  5I7Y A;  3AQA A;  3O34 A;  3MB4 A;  4HXM A;  2DAT A;  1X0J A;  5D3P A;  5DYA A;  5FE7 A;  4QSQ A;  5HQ5 A;  4YH3 A;  4PKL A;  5LJ1 A;  5D3H A;  4AKN A;  5EIC A;  5F62 A;  4YYH A;  3P1F A;  5F5Z A;  4NYX A;  5F25 A;  3Q2E A;  5D3N A;  5DYX A;  2DWW A;  4IR5 A;  3UV5 A;  3LXJ A;  4XY9 A;  5CPE A;  5FE2 A;  3UVW A;  4NR4 A;  5CQ4 A;  5FE9 A;  3U5J A; 
#chains in the Genus database with same CATH topology
 2RNY A;  4TQN A;  5HEL A;  4O78 A;  4NQN A;  5DBM A;  3LQH A;  1N72 A;  4AKH A;  4NRA A;  2L85 A;  3AAD A;  5CQT A;  4QSU A;  5CQA A;  4YBM A;  2KTB B;  3JVL A;  3G0J A;  5I29 A;  3DAI A;  4PS5 A;  4O71 A;  3ZYU A;  4QR4 A;  5C85 A;  4QR5 A;  4ALG A;  5CQ3 A;  4QSP A;  4LYS A;  1ZS5 A;  4UYE A;  4PTB A;  2YQD A;  5FH6 A;  4YAB A;  2H60 A;  4FLP A;  5DYU A;  4NR6 A;  4OGI A;  4BJX A;  5CQ6 A;  3JVJ A;  3MXF A;  4A9K A;  4OGJ A;  3NXB A;  5KU3 A;  2YYN A;  2DVQ A;  5HJC A;  5I1Q A;  4NRB A;  2YEL A;  3QZS A;  2F6J A;  3U5M A;  4CUP A;  5D3J A;  5EV9 A;  4YBS A;  5DFB A;  3UV4 A;  5HLS A;  4J0S A;  4YAX A;  3SVG A;  2G4A A;  5IGM A;  4CUR A;  4Z1Q A;  5H1V A;  4MEQ A;  5CUG A;  3SVH A;  4O70 A;  5CFW A;  5CQ5 A;  4QSV A;  5CUA A;  4XUA A;  5EIS A;  5EWD A;  4QZS A;  4AI6 A;  1E6I A;  4ZQL A;  3UVY A;  2R10 A;  5EGU A;  5L96 A;  5A5R A;  4MR4 A;  5HCL A;  5CUB A;  4XYA A;  4YK0 A;  4QC1 A;  5CTL A;  2D82 A;  5H85 A;  5KHM A;  5EU1 A;  5E9M A;  5JI8 A;  4KCX A;  5JWM A;  3VKG A;  5L98 A;  3JVM A;  5LVQ A;  2RFJ A;  4MR5 A;  4N3W A;  5DFC A;  5FFY A;  4TU4 A;  5G4S A;  4A9J A;  4LYI A;  5LKT A;  2DVS A;  5DKC A;  4TZ2 A;  5IBN A;  5II2 A;  4J0R A;  5DW1 A;  5D0C A;  4N4F A;  5FFV A;  3P1C A;  4LDF A;  4BHW A;  5C8G A;  4IOR A;  4QC3 A;  5FG6 A;  3Q2F A;  3G0L A;  4Z93 A;  5I7X A;  5EA1 A;  3GG3 A;  3O37 A;  4NUC A;  5FE4 A;  4YH4 A;  2RNX A;  4J1P A;  4YY6 A;  3MUK A;  2LSP B;  5CRM A;  3IU5 A;  5DLZ A;  2RNW A;  4NYV A;  4O7F A;  5D3S A;  5COI A;  5IGN A;  1JSP B;  4UIX A;  3U5O A;  3DWY A;  4HXS A;  3MUL A;  5F2P A;  4Y03 A;  5FG4 A;  5G4R A;  5BT5 A;  4XUB A;  5C89 A;  4C66 A;  4BW3 A;  5CZG A;  5EP7 A;  5FFW A;  2YEM A;  4KV1 A;  4HXP A;  2EJN A;  2WP2 A;  4HXK A;  3UW9 A;  4CFK A;  5E0R A;  5I83 A;  5HRV A;  5A5Q A;  4YAT A;  4OUF A;  5CP5 A;  3O36 A;  4PCI A;  4ZW1 A;  4XY8 A;  1ZKR A;  4A9E A;  5ENF A;  4NR9 A;  4KV4 A;  5A82 A;  4IOO A;  5I40 A;  5KTU A;  5D26 A;  4LZ2 A;  3SVF A;  5AD2 A;  5A83 A;  5DLX A;  5LKZ A;  3JVK A;  5FH8 A;  4TZ8 A;  5D24 A;  5E3D A;  5DY7 A;  4O7A A;  5KTX A;  4YAD A;  5FB1 A;  4LR6 A;  2R0Y A;  4N4G A;  4J3I A;  3P5O A;  5IGL A;  4QBM A;  5C4Q A;  4AKI A;  4HBV A;  4O7B A;  5AME A;  5C7N A;  5A5P A;  5ENJ A;  5FE8 A;  5TCM A;  2R0S A;  4UYF A;  5CUE A;  4A9M A;  5EWC A;  4BW2 A;  4CUT A;  3VKH A;  4CUQ A;  4QEW A;  5AMF A;  2OO1 A;  5DW2 A;  3MQM A;  4UIY A;  4LYW A;  2RI7 A;  3LQI A;  4YYJ A;  5DX4 A;  4QUU A;  5HEM A;  5CQ8 A;  5H1T A;  5A5O A;  5IGK A;  5K29 A;  4Q0O A;  5ENI A;  3O33 A;  3FKM X;  2E3K A;  4DON A;  4O7C A;  5FG5 A;  5HEN A;  3HMF A;  2I7K A;  4MR3 A;  2DVR A;  4GPJ A;  4QSR A;  5LUU A;  5L8T A;  2DVV A;  5LKU A;  2R0V A;  5DKH A;  5ENG A;  5HQ6 A;  3U5L A;  4O77 A;  4UIV A;  3MB3 A;  4NR8 A;  3QZV A;  4YBT A;  3UVX A;  2D9E A;  5EWH A;  3P1E A;  5FH7 A;  4UIZ A;  4A9I A;  5L99 A;  5F1L A;  5CU8 A;  1EQF A;  5DFD A;  5EK9 A;  4NXJ A;  4TYL A;  5FE1 A;  4QY4 A;  5TB6 A;  5CQ7 A;  3ONI A;  5I89 A;  4YY4 A;  3D1B A;  3QZT A;  4O75 A;  3ERR A;  2NXB A;  4QSW A;  5E9Y A;  5E7D A;  5FE6 A;  4Z6I A;  4QB3 A;  4O7E A;  3S92 A;  3S91 A;  4NUE A;  4TS8 A;  5E73 A;  4HBX A;  3P1D A;  4UYD A;  4F3I A;  4LZS A;  5I80 A;  3HMH A;  2WP1 A;  5CUD A;  4A9L A;  2YDW A;  1PUO A;  4TT4 A;  5EPR A;  5F61 A;  4NUD A;  4MEO A;  4YC9 A;  3O35 A;  4NRC A;  5D7X A;  5EPB A;  4YYK A;  5LVR A;  2FSA A;  5F60 A;  5D3R A;  2RS9 B;  3K2J A;  5HRX A;  5FBX A;  5DYC A;  4O76 A;  5A81 A;  4QSS A;  4WIV A;  3RCW A;  4QYD A;  5E9I A;  4QEV A;  4N4I A;  5IG6 A;  5KO4 A;  4HXO A;  5HRW A;  3LQJ A;  5A5N A;  5A85 A;  4IOQ A;  4A9F A;  2MJV B;  4YYD A;  5J0D A;  5E9L A;  2L5E A;  5CGP A;  3UV2 A;  4O72 A;  5E3G A;  5EWV A;  4A9H A;  5IID A;  2E7N A;  3U5N A;  4HXN A;  5EI4 A;  5E9V A;  5EQ1 A;  2N9G A;  4IR4 A;  4Q0N A;  4RVR A;  3I3J A;  2I8N A;  4QST A;  5EWW A;  4TU6 A;  5CUC A;  4YYG A;  2DKW A;  4UIT A;  1WUM A;  2OSS A;  4NS5 A;  4NR5 A;  5HQ7 A;  4CL9 A;  2F6N A;  4HXL A;  4Z6H A;  4UYG A;  5FB0 A;  5C87 A;  5HM0 A;  2L84 A;  4AKG A;  4CUU A;  5CS8 A;  1JM4 B;  5DKD A;  4QSX A;  4MEN A;  5EPS A;  2YEK A;  5ENB A;  5EVA A;  5F63 A;  4QYL A;  5ETB A;  5KTW A;  3U5K A;  4YYM A;  5F1H A;  5LKX A;  5A7C A;  4CLB A;  2YW5 A;  5LJ2 A;  4UIU A;  4PCE A;  5L97 A;  5CY9 A;  5I86 A;  4X2I A;  4CUS A;  5FE5 A;  5E9K A;  4MR6 A;  4O74 A;  5ENE A;  3U5P A;  5HFQ A;  5I88 A;  4A9N A;  5HFR A;  4HBW A;  5ENH A;  2GRC A;  4WHU A;  4LRG A;  5BT3 A;  4WHW A;  4BW1 A;  4TT6 A;  5D3T A;  4YYN A;  4IR3 A;  3D7C A;  3IU6 A;  2OUO A;  5D25 A;  4BW4 A;  4PY6 A;  4IR6 A;  5A5S A;  4LC2 A;  4NR7 A;  4ALH A;  4HXR A;  5FDZ A;  5LJ0 A;  5ENC A;  5BT4 A;  4E96 A;  5FE0 A;  5EM3 A;  5ACY A;  4QEU A;  5L8U A;  3LJW A;  5ETD A;  3HME A;  4UYF B;  4NQM A;  5D3L A;  4NYW A;  4QNS A;  4Z1S A;  5F36 A;  4YYI A;  2RO1 A;  5CRZ A;  4ZC9 A;  5H1U A;  4TTE A;  4QR3 A;  4CFL A;  4A9O A;  4UIW A;  1F68 A;  4MEP A;  4C67 A;  4N4H A;  5E74 A;  4HBY A;  3UVD A;  4QUT A;  1WUG A;  5AD3 A;  4TT2 A;  2E7O A;  4LZR A;  4UYH A;  3TLP A;  5II1 A;  5F3A A;  5FE3 A;  5I7Y A;  3AQA A;  3O34 A;  3MB4 A;  4HXM A;  2DAT A;  1X0J A;  5D3P A;  5DYA A;  5FE7 A;  4QSQ A;  5HQ5 A;  4YH3 A;  4PKL A;  5LJ1 A;  5D3H A;  4AKN A;  5EIC A;  5F62 A;  4YYH A;  3P1F A;  5F5Z A;  4NYX A;  5F25 A;  3Q2E A;  5D3N A;  5DYX A;  2DWW A;  4IR5 A;  3UV5 A;  3LXJ A;  4XY9 A;  3D1D A;  5CPE A;  5FE2 A;  3UVW A;  4NR4 A;  5CQ4 A;  5FE9 A;  3U5J A; 
#chains in the Genus database with same CATH homology
 2RNY A;  4TQN A;  5HEL A;  4O78 A;  4NQN A;  5DBM A;  3LQH A;  1N72 A;  4NRA A;  2L85 A;  3AAD A;  5CQT A;  4QSU A;  5CQA A;  4YBM A;  2KTB B;  3JVL A;  3G0J A;  5I29 A;  3DAI A;  4PS5 A;  4O71 A;  3ZYU A;  4QR4 A;  5C85 A;  4QR5 A;  4ALG A;  5CQ3 A;  4QSP A;  4LYS A;  1ZS5 A;  4UYE A;  4PTB A;  2YQD A;  5FH6 A;  4YAB A;  2H60 A;  4FLP A;  5DYU A;  4NR6 A;  4OGI A;  4BJX A;  5CQ6 A;  3JVJ A;  3MXF A;  4A9K A;  4OGJ A;  3NXB A;  5KU3 A;  2YYN A;  2DVQ A;  5HJC A;  5I1Q A;  4NRB A;  2YEL A;  3QZS A;  2F6J A;  3U5M A;  4CUP A;  5D3J A;  5EV9 A;  4YBS A;  5DFB A;  3UV4 A;  5HLS A;  4J0S A;  4YAX A;  3SVG A;  2G4A A;  5IGM A;  4CUR A;  4Z1Q A;  5H1V A;  4MEQ A;  5CUG A;  3SVH A;  4O70 A;  5CFW A;  5CQ5 A;  4QSV A;  5CUA A;  4XUA A;  5EIS A;  5EWD A;  4QZS A;  1E6I A;  4ZQL A;  3UVY A;  2R10 A;  5EGU A;  5L96 A;  5A5R A;  4MR4 A;  5HCL A;  5CUB A;  4XYA A;  4YK0 A;  4QC1 A;  5CTL A;  2D82 A;  5H85 A;  5KHM A;  5EU1 A;  5E9M A;  5JI8 A;  4KCX A;  5JWM A;  5L98 A;  3JVM A;  5LVQ A;  2RFJ A;  4MR5 A;  4N3W A;  5DFC A;  5FFY A;  4TU4 A;  5G4S A;  4A9J A;  4LYI A;  5LKT A;  2DVS A;  5DKC A;  4TZ2 A;  5IBN A;  5II2 A;  4J0R A;  5DW1 A;  5D0C A;  4N4F A;  5FFV A;  3P1C A;  4LDF A;  4BHW A;  5C8G A;  4IOR A;  4QC3 A;  5FG6 A;  3Q2F A;  3G0L A;  4Z93 A;  5I7X A;  5EA1 A;  3GG3 A;  3O37 A;  4NUC A;  5FE4 A;  4YH4 A;  2RNX A;  4J1P A;  4YY6 A;  3MUK A;  2LSP B;  5CRM A;  3IU5 A;  5DLZ A;  2RNW A;  4NYV A;  4O7F A;  5D3S A;  5COI A;  5IGN A;  1JSP B;  4UIX A;  3U5O A;  3DWY A;  4HXS A;  3MUL A;  5F2P A;  4Y03 A;  5FG4 A;  5G4R A;  5BT5 A;  4XUB A;  5C89 A;  4C66 A;  4BW3 A;  5CZG A;  5EP7 A;  5FFW A;  2YEM A;  4KV1 A;  4HXP A;  2WP2 A;  4HXK A;  3UW9 A;  4CFK A;  5E0R A;  5I83 A;  5HRV A;  5A5Q A;  4YAT A;  4OUF A;  5CP5 A;  3O36 A;  4PCI A;  4ZW1 A;  4XY8 A;  4A9E A;  5ENF A;  4NR9 A;  4KV4 A;  5A82 A;  4IOO A;  5I40 A;  5KTU A;  5D26 A;  4LZ2 A;  3SVF A;  5AD2 A;  5A83 A;  5DLX A;  5LKZ A;  3JVK A;  5FH8 A;  4TZ8 A;  5D24 A;  5E3D A;  5DY7 A;  4O7A A;  5KTX A;  4YAD A;  5FB1 A;  4LR6 A;  2R0Y A;  4N4G A;  4J3I A;  3P5O A;  5IGL A;  4QBM A;  5C4Q A;  4HBV A;  4O7B A;  5AME A;  5C7N A;  5A5P A;  5ENJ A;  5FE8 A;  5TCM A;  2R0S A;  4UYF A;  5CUE A;  4A9M A;  5EWC A;  4BW2 A;  4CUT A;  4CUQ A;  4QEW A;  5AMF A;  2OO1 A;  5DW2 A;  3MQM A;  4UIY A;  4LYW A;  2RI7 A;  3LQI A;  4YYJ A;  5DX4 A;  4QUU A;  5HEM A;  5CQ8 A;  5H1T A;  5A5O A;  5IGK A;  5K29 A;  4Q0O A;  5ENI A;  3O33 A;  3FKM X;  2E3K A;  4DON A;  4O7C A;  5FG5 A;  5HEN A;  3HMF A;  2I7K A;  4MR3 A;  2DVR A;  4GPJ A;  4QSR A;  5LUU A;  5L8T A;  2DVV A;  5LKU A;  2R0V A;  5DKH A;  5ENG A;  5HQ6 A;  3U5L A;  4O77 A;  4UIV A;  3MB3 A;  4NR8 A;  3QZV A;  4YBT A;  3UVX A;  2D9E A;  5EWH A;  3P1E A;  5FH7 A;  4UIZ A;  4A9I A;  5L99 A;  5F1L A;  5CU8 A;  1EQF A;  5DFD A;  5EK9 A;  4NXJ A;  4TYL A;  5FE1 A;  4QY4 A;  5TB6 A;  5CQ7 A;  3ONI A;  5I89 A;  4YY4 A;  3QZT A;  4O75 A;  2NXB A;  4QSW A;  5E9Y A;  5E7D A;  5FE6 A;  4Z6I A;  4QB3 A;  4O7E A;  3S92 A;  3S91 A;  4NUE A;  4TS8 A;  5E73 A;  4HBX A;  3P1D A;  4UYD A;  4F3I A;  4LZS A;  5I80 A;  3HMH A;  2WP1 A;  5CUD A;  4A9L A;  2YDW A;  5EPR A;  4TT4 A;  5F61 A;  4NUD A;  4MEO A;  4YC9 A;  3O35 A;  4NRC A;  5D7X A;  5EPB A;  4YYK A;  5LVR A;  2FSA A;  5F60 A;  5D3R A;  2RS9 B;  3K2J A;  5HRX A;  5FBX A;  5DYC A;  4O76 A;  5A81 A;  4QSS A;  4WIV A;  3RCW A;  4QYD A;  5E9I A;  4QEV A;  4N4I A;  5IG6 A;  5KO4 A;  4HXO A;  5HRW A;  3LQJ A;  5A5N A;  5A85 A;  4IOQ A;  4A9F A;  2MJV B;  4YYD A;  5J0D A;  5E9L A;  2L5E A;  5CGP A;  3UV2 A;  4O72 A;  5E3G A;  5EWV A;  4A9H A;  5IID A;  2E7N A;  3U5N A;  4HXN A;  5EI4 A;  5E9V A;  5EQ1 A;  2N9G A;  4IR4 A;  4Q0N A;  4RVR A;  3I3J A;  2I8N A;  4QST A;  5EWW A;  4TU6 A;  5CUC A;  4YYG A;  2DKW A;  4UIT A;  1WUM A;  2OSS A;  4NS5 A;  4NR5 A;  5HQ7 A;  4CL9 A;  2F6N A;  4HXL A;  4Z6H A;  4UYG A;  5FB0 A;  5C87 A;  5HM0 A;  2L84 A;  4CUU A;  5CS8 A;  1JM4 B;  5DKD A;  4QSX A;  4MEN A;  5EPS A;  2YEK A;  5ENB A;  5EVA A;  5F63 A;  4QYL A;  5ETB A;  5KTW A;  3U5K A;  4YYM A;  5F1H A;  5LKX A;  5A7C A;  4CLB A;  2YW5 A;  5LJ2 A;  4UIU A;  4PCE A;  5L97 A;  5CY9 A;  5I86 A;  4X2I A;  4CUS A;  5FE5 A;  5E9K A;  4MR6 A;  4O74 A;  5ENE A;  3U5P A;  5HFQ A;  5I88 A;  4A9N A;  5HFR A;  4HBW A;  5ENH A;  2GRC A;  4WHU A;  4LRG A;  5BT3 A;  4WHW A;  4BW1 A;  4TT6 A;  5D3T A;  4YYN A;  4IR3 A;  3D7C A;  3IU6 A;  2OUO A;  5D25 A;  4BW4 A;  4PY6 A;  4IR6 A;  5A5S A;  4LC2 A;  4NR7 A;  4ALH A;  4HXR A;  5FDZ A;  5LJ0 A;  5ENC A;  5BT4 A;  4E96 A;  5FE0 A;  5EM3 A;  5ACY A;  4QEU A;  5L8U A;  3LJW A;  5ETD A;  3HME A;  4UYF B;  4NQM A;  5D3L A;  4NYW A;  4QNS A;  4Z1S A;  5F36 A;  4YYI A;  2RO1 A;  5CRZ A;  4ZC9 A;  5H1U A;  4TTE A;  4QR3 A;  4CFL A;  4A9O A;  4UIW A;  1F68 A;  4MEP A;  4C67 A;  4N4H A;  5E74 A;  4HBY A;  3UVD A;  4QUT A;  1WUG A;  5AD3 A;  4TT2 A;  2E7O A;  4LZR A;  4UYH A;  3TLP A;  5II1 A;  5F3A A;  5FE3 A;  5I7Y A;  3AQA A;  3O34 A;  3MB4 A;  4HXM A;  2DAT A;  1X0J A;  5D3P A;  5DYA A;  5FE7 A;  4QSQ A;  5HQ5 A;  4YH3 A;  4PKL A;  5LJ1 A;  5D3H A;  4AKN A;  5EIC A;  5F62 A;  4YYH A;  3P1F A;  5F5Z A;  4NYX A;  5F25 A;  3Q2E A;  5D3N A;  5DYX A;  2DWW A;  4IR5 A;  3UV5 A;  3LXJ A;  4XY9 A;  5CPE A;  5FE2 A;  3UVW A;  4NR4 A;  5CQ4 A;  5FE9 A;  3U5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...