5I83A

Crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02773986
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords CREB-binding protein
publication title Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637).
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 114
sequence length 114
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i83A00
4OGJA 5KTXA 4XY9A 5DKHA 5L8TA 5LJ1A 4IR4A 4QEUA 5DYXA 4UYEA 5DFDA 4NQMA 5HEMA 4UIXA 5C8GA 5EWWA 5E74A 5CRMA 3O37A 5DY7A 5KTWA 4QYLA 4O76A 5EM3A 5EICA 4HXNA 2RS9B 5H1VA 5IGLA 5CU8A 5ENFA 3O35A 2DVQA 2L85A 5A5QA 5FG5A 4GPJA 4WIVA 3MB3A 4BW1A 5HCLA 5CQ8A 3G0LA 5DW2A 5EWCA 4ZC9A 4A9FA 3LQIA 4O7CA 2YEKA 4KCXA 4F3IA 4LZ2A 3JVKA 4XUBA 5L99A 4Z93A 4NR9A 5EA1A 5EPRA 5EGUA 3UVXA 4A9HA 5CUDA 4N4FA 4DONA 3O36A 5A81A 5E9IA 4A9EA 4UYHA 4QEVA 2WP1A 5D3TA 5EU1A 5FH8A 2FSAA 4UYDA 5IGMA 4QNSA 4O7FA 4MEQA 1X0JA 3O34A 4ZW1A 5HRVA 4YYGA 5C87A 5H1TA 5E3GA 1EQFA 5D24A 5KHMA 2E7NA 2R0SA 4PTBA 4ALGA 5HM0A 2OUOA 2N9GA 3U5JA 2E3KA 4WHUA 4TT2A 4YH4A 4YAXA 4UYFA 5FB1A 3U5OA 2KTBB 5F25A 5HQ7A 5D3RA 4Q0NA 4Y03A 2YYNA 4CURA 5F62A 4NS5A 4BW2A 5E9VA 3SVFA 5I7YA 5AD3A 4LZRA 5FFWA 3MULA 2R10A 4PS5A 5EV9A 5A7CA 5FBXA 5C85A 4OGIA 5LKZA 3LQJA 4YYJA 5A5SA 4CUUA 5FFVA 4MR3A 4X2IA 3O33A 2DATA 5CUAA 5ENIA 4HBYA 3UVYA 5CUCA 4A9MA 2RI7A 5FE1A 4NRCA 5EP7A 2E7OA 5IGKA 4PKLA 4YBMA 4NYVA 4CUTA 3P1FA 5TB6A 4A9OA 3D7CA 5CQ4A 3U5LA 5F61A 4N3WA 3FKMX 4A9IA 3QZSA 5E9KA 4WHWA 1JM4B 5EPBA 5CQ3A 5JI8A 2NXBA 5IIDA 2YDWA 5H85A 3P1DA 4RVRA 3S91A 5BT5A 4YYNA 4QSQA 3P1CA 4UITA 4QBMA 5F63A 5EWDA 4IOOA 4YC9A 4IOQA 3MXFA 3LJWA 4IR3A 2DWWA 5D3NA 4QY4A 5BT4A 2YW5A 4NR5A 4MEPA 5D3SA 1WUGA 3UV2A 5CP5A 2DVRA 4UYFB 4CUPA 2D9EA 5HQ5A 4UYGA 2I8NA 4O75A 5CGPA 4O7AA 5IBNA 4Z1QA 2H60A 4LYSA 4Q0OA 5EVAA 5LKXA 5A5RA 5I86A 4O78A 4HXRA 4QEWA 4J1PA 5CPEA 5EWVA 5II2A 5F2PA 4A9NA 2L84A 5HENA 4BJXA 3DAIA 3I3JA 4LYIA 5CQAA 5D3HA 5DBMA 5FG6A 3GG3A 4TTEA 5DX4A 3JVMA 4YYIA 4UIUA 5KTUA 5EWHA 4NXJA 4HXMA 4MR4A 5EK9A 5ENHA 5D26A 3LXJA 2YQDA 4NR8A 4NUDA 5FH7A 5E7DA 5HJCA 4NYWA 5I89A 5I40A 5E3DA 5CY9A 5CQ7A 5I7XA 4C66A 4QSTA 5AMFA 5D3JA 5DLXA 5A5NA 3AADA 5IG6A 4BW4A 4TYLA 5J0DA 3U5PA 3MUKA 3TLPA 4NRAA 5A82A 4A9LA 4TS8A 5D0CA 3JVLA 4TT4A 5ENGA 2G4AA 5DKCA 5HFRA 5LKTA 5F1LA 5F60A 4UIVA 3K2JA 3JVJA 4N4IA 2RNXA 4PCEA 4QSXA 5FE8A 5F1HA 2DVVA 5ENBA 4O77A 4QSPA 4XY8A 2MJVB 5E0RA 4YBSA 4ZQLA 5DFBA 3SVGA 5HFQA 4QZSA 4QSRA 4Z6IA 5F36A 1JSPB 5EISA 5KO4A 4YK0A 5ENEA 4PCIA 5BT3A 4OUFA 3U5NA 4CLBA 4NR7A 5COIA 4ALHA 5L97A 5D3PA 4YH3A 5CQ5A 5FDZA 4YYKA 2DVSA 4YADA 5CFWA 4YYHA 2I7KA 4YYDA 5L96A 4YY4A 4A9JA 5L8UA 4NR4A 4O7EA 5A5PA 3QZTA 4QUUA 4PY6A 5CRZA 5EI4A 4QC1A 1E6IA 1F68A 4QB3A 5ENJA 5DFCA 2RNWA 4J0SA 4C67A 5K29A 2OSSA 4LR6A 5AMEA 5FE9A 5C4QA 4QSSA 5E9MA 5DYAA 3NXBA 5ACYA 5FFYA 5I88A 4CUQA 4N4GA 4MENA 5FE2A 5EPSA 5CTLA 5FE3A 4O71A 4QUTA 5H1UA 5D7XA 5LVQA 1ZS5A 5HLSA 4CL9A 5FB0A 5LKUA 1WUMA 4IORA 5DW1A 4O74A 4LYWA 4TZ2A 4QSVA 4O72A 4NRBA 5ENCA 3P1EA 4O70A 4QC3A 4NUCA 4XUAA 5A83A 5A5OA 3AQAA 4HBWA 4FLPA 5HQ6A 3G0JA 2WP2A 3U5KA 4AKNA 4Z1SA 5DYCA 5II1A 5CUGA 4NUEA 4YYMA 5FG4A 4HBVA 4MR6A 5F5ZA 3UV4A 3Q2FA 4MEOA 4QR4A 5I1QA 4CFLA 3IU5A 4NQNA 3UVWA 5HRWA 3HMFA 5CS8A 4LZSA 5ETBA 4UIYA 4BHWA 5FE0A 2YEMA 5DKDA 5I80A 2F6JA 5E9YA 5L98A 3MB4A 4BW3A 4HXKA 2LSPB 5FE4A 4Z6HA 5AD2A 4QR5A 3UVDA 2OO1A 3U5MA 4UIWA 3UV5A 2GRCA 4XYAA 4KV4A 2L5EA 5DLZA 2F6NA 2RFJA 4YBTA 4NYXA 5TCMA 4HXSA 5LVRA 4HXOA 4YY6A 5CQ6A 4A9KA 4QYDA 5CZGA 5ETDA 4O7BA 3DWYA 3UW9A 3QZVA 3RCWA 5C89A 5I29A 5DYUA 5CQTA 3IU6A 3MQMA 5KU3A 4QR3A 4HBXA 5FH6A 4NR6A 5CUBA 4LRGA 2RNYA 5E73A 3Q2EA 4UIZA 5G4RA 4CFKA 3S92A 4LDFA 4J0RA 4KV1A 5C7NA 4TT6A 5D25A 4IR6A 5FE5A 3ZYUA 2D82A 4TQNA 2RO1A 5LJ0A 4HXLA 4TU6A 5D3LA 5E9LA 4IR5A 3SVHA 5JWMA 2R0YA 3LQHA 4E96A 4YABA 5LJ2A 5FE7A 5FE6A 4TU4A 4TZ8A 4QSWA 5EQ1A 2DKWA 4HXPA 4QSUA 5A85A 5IGNA 5F3AA 3P5OA 2YELA 5I83A 4CUSA 4N4HA 2R0VA 5LUUA 3HMEA 4YATA 3HMHA 4LC2A 1N72A 5HELA 5CUEA 4J3IA 5G4SA 5HRXA 4MR5A 3ONIA
chains in the Genus database with same CATH superfamily
4OGJA 5KTXA 4XY9A 5DKHA 5L8TA 5LJ1A 4IR4A 4QEUA 5DYXA 4UYEA 5DFDA 4NQMA 5HEMA 4UIXA 5C8GA 5EWWA 5E74A 5CRMA 3O37A 5DY7A 5KTWA 4QYLA 4O76A 5EM3A 5EICA 4HXNA 2RS9B 5H1VA 5IGLA 5CU8A 5ENFA 3O35A 3VKGA 2DVQA 2L85A 5A5QA 5FG5A 4GPJA 4WIVA 3MB3A 4BW1A 5HCLA 5CQ8A 3G0LA 5DW2A 5EWCA 4ZC9A 4A9FA 3LQIA 4O7CA 2YEKA 4KCXA 4AKIA 4F3IA 3ERRA 4LZ2A 3JVKA 4XUBA 5L99A 4Z93A 1PUOA 4NR9A 5EA1A 5EGUA 5EPRA 3UVXA 4A9HA 5CUDA 4N4FA 4DONA 3O36A 5A81A 5E9IA 4A9EA 4UYHA 4QEVA 2WP1A 5D3TA 5EU1A 5FH8A 2FSAA 4UYDA 5IGMA 4QNSA 4O7FA 4MEQA 1X0JA 3O34A 4ZW1A 5HRVA 4YYGA 5C87A 5H1TA 5E3GA 1EQFA 5D24A 5KHMA 2E7NA 2R0SA 4PTBA 4ALGA 5HM0A 2OUOA 2N9GA 3U5JA 2E3KA 4WHUA 4TT2A 4YH4A 4YAXA 4UYFA 5FB1A 3U5OA 2KTBB 5F25A 5HQ7A 5D3RA 4Q0NA 4Y03A 2YYNA 4CURA 5F62A 4NS5A 4BW2A 5E9VA 3SVFA 5I7YA 5AD3A 4LZRA 5FFWA 3MULA 2R10A 4PS5A 5EV9A 5A7CA 5FBXA 5C85A 4OGIA 5LKZA 3LQJA 4YYJA 5A5SA 4CUUA 5FFVA 4MR3A 4X2IA 3O33A 2DATA 5CUAA 5ENIA 4HBYA 3UVYA 5CUCA 4A9MA 2RI7A 5FE1A 4NRCA 5EP7A 2E7OA 5IGKA 4PKLA 4YBMA 4NYVA 4CUTA 3P1FA 5TB6A 4A9OA 3D7CA 5CQ4A 3U5LA 5F61A 4N3WA 4AKGA 3FKMX 4A9IA 3QZSA 5E9KA 4WHWA 1JM4B 5EPBA 5CQ3A 5JI8A 2NXBA 5IIDA 2YDWA 5H85A 3P1DA 4RVRA 3S91A 5BT5A 4YYNA 4QSQA 3P1CA 4UITA 4QBMA 5F63A 5EWDA 4IOOA 4YC9A 4IOQA 3MXFA 3LJWA 4IR3A 2DWWA 5D3NA 4QY4A 5BT4A 2YW5A 4NR5A 4MEPA 5D3SA 1WUGA 3UV2A 5CP5A 2DVRA 4UYFB 4CUPA 2D9EA 5HQ5A 4UYGA 2I8NA 4O75A 5CGPA 4O7AA 5IBNA 4Z1QA 2H60A 4LYSA 4Q0OA 5EVAA 5LKXA 5A5RA 5I86A 4O78A 4HXRA 4QEWA 4J1PA 5CPEA 5EWVA 5II2A 5F2PA 4A9NA 2L84A 5HENA 4BJXA 3DAIA 3I3JA 4LYIA 5CQAA 5D3HA 5DBMA 5FG6A 3GG3A 4AKHA 4TTEA 5DX4A 3JVMA 4YYIA 4UIUA 5KTUA 5EWHA 4NXJA 4HXMA 4MR4A 5EK9A 5ENHA 5D26A 3LXJA 2YQDA 4NR8A 4NUDA 5FH7A 5E7DA 5HJCA 4NYWA 5I89A 5I40A 5E3DA 5CY9A 5CQ7A 5I7XA 4C66A 4QSTA 3D1DA 5AMFA 5D3JA 2EJNA 5DLXA 5A5NA 3AADA 5IG6A 4BW4A 4TYLA 5J0DA 3U5PA 3MUKA 3TLPA 4NRAA 4AI6A 5A82A 4A9LA 4TS8A 5D0CA 3JVLA 4TT4A 5ENGA 2G4AA 5DKCA 5HFRA 5LKTA 5F1LA 5F60A 4UIVA 3K2JA 3JVJA 4N4IA 2RNXA 4PCEA 4QSXA 5FE8A 5F1HA 2DVVA 5ENBA 4O77A 4QSPA 4XY8A 2MJVB 5E0RA 4YBSA 4ZQLA 5DFBA 3SVGA 5HFQA 4QZSA 4QSRA 4Z6IA 5F36A 1JSPB 5EISA 5KO4A 4YK0A 5ENEA 4PCIA 5BT3A 4OUFA 3U5NA 4CLBA 4NR7A 5COIA 4ALHA 5L97A 5D3PA 4YH3A 5CQ5A 5FDZA 4YYKA 2DVSA 4YADA 5CFWA 4YYHA 2I7KA 4YYDA 5L96A 4YY4A 4A9JA 5L8UA 4NR4A 4O7EA 5A5PA 3QZTA 4QUUA 4PY6A 5CRZA 5EI4A 4QC1A 1E6IA 1F68A 4QB3A 5ENJA 2RNWA 5DFCA 4J0SA 4C67A 5K29A 2OSSA 4LR6A 5AMEA 5FE9A 5C4QA 4QSSA 5E9MA 5DYAA 3NXBA 5ACYA 5FFYA 5I88A 4CUQA 4N4GA 4MENA 5FE2A 5EPSA 5CTLA 5FE3A 4O71A 4QUTA 5H1UA 5D7XA 5LVQA 1ZS5A 5HLSA 4CL9A 5FB0A 5LKUA 1WUMA 4IORA 5DW1A 4O74A 4LYWA 1ZKRA 4TZ2A 4QSVA 4O72A 4NRBA 5ENCA 3P1EA 4O70A 4QC3A 4NUCA 4XUAA 5A83A 5A5OA 3AQAA 4HBWA 4FLPA 5HQ6A 3G0JA 2WP2A 3U5KA 4AKNA 4Z1SA 5DYCA 5II1A 5CUGA 4NUEA 4YYMA 5FG4A 4HBVA 4MR6A 5F5ZA 3UV4A 3Q2FA 4MEOA 4QR4A 5I1QA 4CFLA 3IU5A 4NQNA 3UVWA 5HRWA 3HMFA 5CS8A 4LZSA 5ETBA 4UIYA 4BHWA 5FE0A 2YEMA 5DKDA 5I80A 2F6JA 5E9YA 5L98A 3MB4A 3D1BA 4BW3A 4HXKA 2LSPB 5FE4A 4Z6HA 5AD2A 4QR5A 3UVDA 2OO1A 3U5MA 4UIWA 3UV5A 2GRCA 4XYAA 4KV4A 2L5EA 5DLZA 2F6NA 2RFJA 4YBTA 4NYXA 5TCMA 4HXSA 5LVRA 4HXOA 4YY6A 5CQ6A 4A9KA 4QYDA 5CZGA 5ETDA 4O7BA 3DWYA 3UW9A 3QZVA 3RCWA 5C89A 5I29A 5DYUA 5CQTA 3IU6A 3MQMA 5KU3A 4QR3A 4HBXA 5FH6A 4NR6A 5CUBA 4LRGA 2RNYA 5E73A 3Q2EA 4UIZA 5G4RA 4CFKA 3S92A 4LDFA 4J0RA 4KV1A 5C7NA 4TT6A 5D25A 4IR6A 5FE5A 3ZYUA 2D82A 4TQNA 2RO1A 5LJ0A 4HXLA 4TU6A 5D3LA 5E9LA 4IR5A 3SVHA 5JWMA 2R0YA 3LQHA 4E96A 4YABA 5LJ2A 5FE7A 5FE6A 4TU4A 4TZ8A 4QSWA 5EQ1A 2DKWA 4HXPA 3VKHA 4QSUA 5A85A 5IGNA 5F3AA 3P5OA 2YELA 5I83A 4CUSA 4N4HA 2R0VA 5LUUA 3HMEA 4YATA 3HMHA 4LC2A 1N72A 5HELA 5CUEA 4J3IA 5G4SA 5HRXA 4MR5A 3ONIA
chains in the Genus database with same CATH topology
4OGJA 5KTXA 4XY9A 5DKHA 5L8TA 5LJ1A 4IR4A 4QEUA 5DYXA 4UYEA 5DFDA 4NQMA 5HEMA 4UIXA 5C8GA 5EWWA 5E74A 5CRMA 3O37A 5DY7A 5KTWA 4QYLA 4O76A 5EM3A 5EICA 4HXNA 2RS9B 5H1VA 5IGLA 5CU8A 5ENFA 3O35A 2DVQA 2L85A 5A5QA 5FG5A 4GPJA 4WIVA 3MB3A 4BW1A 5HCLA 5CQ8A 3G0LA 5DW2A 5EWCA 4ZC9A 4A9FA 3LQIA 4O7CA 2YEKA 4KCXA 4F3IA 4LZ2A 3JVKA 4XUBA 5L99A 4Z93A 4NR9A 5EA1A 5EPRA 5EGUA 3UVXA 4A9HA 5CUDA 4N4FA 4DONA 3O36A 5A81A 5E9IA 4A9EA 4UYHA 4QEVA 2WP1A 5D3TA 5EU1A 5FH8A 2FSAA 4UYDA 5IGMA 4QNSA 4O7FA 4MEQA 1X0JA 3O34A 4ZW1A 5HRVA 4YYGA 5C87A 5H1TA 5E3GA 1EQFA 5D24A 5KHMA 2E7NA 2R0SA 4PTBA 4ALGA 5HM0A 2OUOA 2N9GA 3U5JA 2E3KA 4WHUA 4TT2A 4YH4A 4YAXA 4UYFA 5FB1A 3U5OA 2KTBB 5F25A 5HQ7A 5D3RA 4Q0NA 4Y03A 2YYNA 4CURA 5F62A 4NS5A 4BW2A 5E9VA 3SVFA 5I7YA 5AD3A 4LZRA 5FFWA 3MULA 2R10A 4PS5A 5EV9A 5A7CA 5FBXA 5C85A 4OGIA 5LKZA 3LQJA 4YYJA 5A5SA 4CUUA 5FFVA 4MR3A 4X2IA 3O33A 2DATA 5CUAA 5ENIA 4HBYA 3UVYA 5CUCA 4A9MA 2RI7A 5FE1A 4NRCA 5EP7A 2E7OA 5IGKA 4PKLA 4YBMA 4NYVA 4CUTA 3P1FA 5TB6A 4A9OA 3D7CA 5CQ4A 3U5LA 5F61A 4N3WA 3FKMX 4A9IA 3QZSA 5E9KA 4WHWA 1JM4B 5EPBA 5CQ3A 5JI8A 2NXBA 5IIDA 2YDWA 5H85A 3P1DA 4RVRA 3S91A 5BT5A 4YYNA 4QSQA 3P1CA 4UITA 4QBMA 5F63A 5EWDA 4IOOA 4YC9A 4IOQA 3MXFA 3LJWA 4IR3A 2DWWA 5D3NA 4QY4A 5BT4A 2YW5A 4NR5A 4MEPA 5D3SA 1WUGA 3UV2A 5CP5A 2DVRA 4UYFB 4CUPA 2D9EA 5HQ5A 4UYGA 2I8NA 4O75A 5CGPA 4O7AA 5IBNA 4Z1QA 2H60A 4LYSA 4Q0OA 5EVAA 5LKXA 5A5RA 5I86A 4O78A 4HXRA 4QEWA 4J1PA 5CPEA 5EWVA 5II2A 5F2PA 4A9NA 2L84A 5HENA 4BJXA 3DAIA 3I3JA 4LYIA 5CQAA 5D3HA 5DBMA 5FG6A 3GG3A 4TTEA 5DX4A 3JVMA 4YYIA 4UIUA 5KTUA 5EWHA 4NXJA 4HXMA 4MR4A 5EK9A 5ENHA 5D26A 3LXJA 2YQDA 4NR8A 4NUDA 5FH7A 5E7DA 5HJCA 4NYWA 5I89A 5I40A 5E3DA 5CY9A 5CQ7A 5I7XA 4C66A 4QSTA 5AMFA 5D3JA 5DLXA 5A5NA 3AADA 5IG6A 4BW4A 4TYLA 5J0DA 3U5PA 3MUKA 3TLPA 4NRAA 5A82A 4A9LA 4TS8A 5D0CA 3JVLA 4TT4A 5ENGA 2G4AA 5DKCA 5HFRA 5LKTA 5F1LA 5F60A 4UIVA 3K2JA 3JVJA 4N4IA 2RNXA 4PCEA 4QSXA 5FE8A 5F1HA 2DVVA 5ENBA 4O77A 4QSPA 4XY8A 2MJVB 5E0RA 4YBSA 4ZQLA 5DFBA 3SVGA 5HFQA 4QZSA 4QSRA 4Z6IA 5F36A 1JSPB 5EISA 5KO4A 4YK0A 5ENEA 4PCIA 5BT3A 4OUFA 3U5NA 4CLBA 4NR7A 5COIA 4ALHA 5L97A 5D3PA 4YH3A 5CQ5A 5FDZA 4YYKA 2DVSA 4YADA 5CFWA 4YYHA 2I7KA 4YYDA 5L96A 4YY4A 4A9JA 5L8UA 4NR4A 4O7EA 5A5PA 3QZTA 4QUUA 4PY6A 5CRZA 5EI4A 4QC1A 1E6IA 1F68A 4QB3A 5ENJA 5DFCA 2RNWA 4J0SA 4C67A 5K29A 2OSSA 4LR6A 5AMEA 5FE9A 5C4QA 4QSSA 5E9MA 5DYAA 3NXBA 5ACYA 5FFYA 5I88A 4CUQA 4N4GA 4MENA 5FE2A 5EPSA 5CTLA 5FE3A 4O71A 4QUTA 5H1UA 5D7XA 5LVQA 1ZS5A 5HLSA 4CL9A 5FB0A 5LKUA 1WUMA 4IORA 5DW1A 4O74A 4LYWA 4TZ2A 4QSVA 4O72A 4NRBA 5ENCA 3P1EA 4O70A 4QC3A 4NUCA 4XUAA 5A83A 5A5OA 3AQAA 4HBWA 4FLPA 5HQ6A 3G0JA 2WP2A 3U5KA 4AKNA 4Z1SA 5DYCA 5II1A 5CUGA 4NUEA 4YYMA 5FG4A 4HBVA 4MR6A 5F5ZA 3UV4A 3Q2FA 4MEOA 4QR4A 5I1QA 4CFLA 3IU5A 4NQNA 3UVWA 5HRWA 3HMFA 5CS8A 4LZSA 5ETBA 4UIYA 4BHWA 5FE0A 2YEMA 5DKDA 5I80A 2F6JA 5E9YA 5L98A 3MB4A 4BW3A 4HXKA 2LSPB 5FE4A 4Z6HA 5AD2A 4QR5A 3UVDA 2OO1A 3U5MA 4UIWA 3UV5A 2GRCA 4XYAA 4KV4A 2L5EA 5DLZA 2F6NA 2RFJA 4YBTA 4NYXA 5TCMA 4HXSA 5LVRA 4HXOA 4YY6A 5CQ6A 4A9KA 4QYDA 5CZGA 5ETDA 4O7BA 3DWYA 3UW9A 3QZVA 3RCWA 5C89A 5I29A 5DYUA 5CQTA 3IU6A 3MQMA 5KU3A 4QR3A 4HBXA 5FH6A 4NR6A 5CUBA 4LRGA 2RNYA 5E73A 3Q2EA 4UIZA 5G4RA 4CFKA 3S92A 4LDFA 4J0RA 4KV1A 5C7NA 4TT6A 5D25A 4IR6A 5FE5A 3ZYUA 2D82A 4TQNA 2RO1A 5LJ0A 4HXLA 4TU6A 5D3LA 5E9LA 4IR5A 3SVHA 5JWMA 2R0YA 3LQHA 4E96A 4YABA 5LJ2A 5FE7A 5FE6A 4TU4A 4TZ8A 4QSWA 5EQ1A 2DKWA 4HXPA 4QSUA 5A85A 5IGNA 5F3AA 3P5OA 2YELA 5I83A 4CUSA 4N4HA 2R0VA 5LUUA 3HMEA 4YATA 3HMHA 4LC2A 1N72A 5HELA 5CUEA 4J3IA 5G4SA 5HRXA 4MR5A 3ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGJ A;  5KTX A;  4XY9 A;  5DKH A;  5L8T A;  5LJ1 A;  4IR4 A;  4QEU A;  5DYX A;  4UYE A;  5DFD A;  4NQM A;  5HEM A;  4UIX A;  5C8G A;  5EWW A;  5E74 A;  5CRM A;  3O37 A;  5DY7 A;  5KTW A;  4QYL A;  4O76 A;  5EM3 A;  5EIC A;  4HXN A;  2RS9 B;  5H1V A;  5IGL A;  5CU8 A;  5ENF A;  3O35 A;  2DVQ A;  2L85 A;  5A5Q A;  5FG5 A;  4GPJ A;  4WIV A;  3MB3 A;  4BW1 A;  5HCL A;  5CQ8 A;  3G0L A;  5DW2 A;  5EWC A;  4ZC9 A;  4A9F A;  3LQI A;  4O7C A;  2YEK A;  4KCX A;  4F3I A;  4LZ2 A;  3JVK A;  4XUB A;  5L99 A;  4Z93 A;  4NR9 A;  5EA1 A;  5EPR A;  5EGU A;  3UVX A;  4A9H A;  5CUD A;  4N4F A;  4DON A;  3O36 A;  5A81 A;  5E9I A;  4A9E A;  4UYH A;  4QEV A;  2WP1 A;  5D3T A;  5EU1 A;  5FH8 A;  2FSA A;  4UYD A;  5IGM A;  4QNS A;  4O7F A;  4MEQ A;  1X0J A;  3O34 A;  4ZW1 A;  5HRV A;  4YYG A;  5C87 A;  5H1T A;  5E3G A;  1EQF A;  5D24 A;  5KHM A;  2E7N A;  2R0S A;  4PTB A;  4ALG A;  5HM0 A;  2OUO A;  2N9G A;  3U5J A;  2E3K A;  4WHU A;  4TT2 A;  4YH4 A;  4YAX A;  4UYF A;  5FB1 A;  3U5O A;  2KTB B;  5F25 A;  5HQ7 A;  5D3R A;  4Q0N A;  4Y03 A;  2YYN A;  4CUR A;  5F62 A;  4NS5 A;  4BW2 A;  5E9V A;  3SVF A;  5I7Y A;  5AD3 A;  4LZR A;  5FFW A;  3MUL A;  2R10 A;  4PS5 A;  5EV9 A;  5A7C A;  5FBX A;  5C85 A;  4OGI A;  5LKZ A;  3LQJ A;  4YYJ A;  5A5S A;  4CUU A;  5FFV A;  4MR3 A;  4X2I A;  3O33 A;  2DAT A;  5CUA A;  5ENI A;  4HBY A;  3UVY A;  5CUC A;  4A9M A;  2RI7 A;  5FE1 A;  4NRC A;  5EP7 A;  2E7O A;  5IGK A;  4PKL A;  4YBM A;  4NYV A;  4CUT A;  3P1F A;  5TB6 A;  4A9O A;  3D7C A;  5CQ4 A;  3U5L A;  5F61 A;  4N3W A;  3FKM X;  4A9I A;  3QZS A;  5E9K A;  4WHW A;  1JM4 B;  5EPB A;  5CQ3 A;  5JI8 A;  2NXB A;  5IID A;  2YDW A;  5H85 A;  3P1D A;  4RVR A;  3S91 A;  5BT5 A;  4YYN A;  4QSQ A;  3P1C A;  4UIT A;  4QBM A;  5F63 A;  5EWD A;  4IOO A;  4YC9 A;  4IOQ A;  3MXF A;  3LJW A;  4IR3 A;  2DWW A;  5D3N A;  4QY4 A;  5BT4 A;  2YW5 A;  4NR5 A;  4MEP A;  5D3S A;  1WUG A;  3UV2 A;  5CP5 A;  2DVR A;  4UYF B;  4CUP A;  2D9E A;  5HQ5 A;  4UYG A;  2I8N A;  4O75 A;  5CGP A;  4O7A A;  5IBN A;  4Z1Q A;  2H60 A;  4LYS A;  4Q0O A;  5EVA A;  5LKX A;  5A5R A;  5I86 A;  4O78 A;  4HXR A;  4QEW A;  4J1P A;  5CPE A;  5EWV A;  5II2 A;  5F2P A;  4A9N A;  2L84 A;  5HEN A;  4BJX A;  3DAI A;  3I3J A;  4LYI A;  5CQA A;  5D3H A;  5DBM A;  5FG6 A;  3GG3 A;  4TTE A;  5DX4 A;  3JVM A;  4YYI A;  4UIU A;  5KTU A;  5EWH A;  4NXJ A;  4HXM A;  4MR4 A;  5EK9 A;  5ENH A;  5D26 A;  3LXJ A;  2YQD A;  4NR8 A;  4NUD A;  5FH7 A;  5E7D A;  5HJC A;  4NYW A;  5I89 A;  5I40 A;  5E3D A;  5CY9 A;  5CQ7 A;  5I7X A;  4C66 A;  4QST A;  5AMF A;  5D3J A;  5DLX A;  5A5N A;  3AAD A;  5IG6 A;  4BW4 A;  4TYL A;  5J0D A;  3U5P A;  3MUK A;  3TLP A;  4NRA A;  5A82 A;  4A9L A;  4TS8 A;  5D0C A;  3JVL A;  4TT4 A;  5ENG A;  2G4A A;  5DKC A;  5HFR A;  5LKT A;  5F1L A;  5F60 A;  4UIV A;  3K2J A;  3JVJ A;  4N4I A;  2RNX A;  4PCE A;  4QSX A;  5FE8 A;  5F1H A;  2DVV A;  5ENB A;  4O77 A;  4QSP A;  4XY8 A;  2MJV B;  5E0R A;  4YBS A;  4ZQL A;  5DFB A;  3SVG A;  5HFQ A;  4QZS A;  4QSR A;  4Z6I A;  5F36 A;  1JSP B;  5EIS A;  5KO4 A;  4YK0 A;  5ENE A;  4PCI A;  5BT3 A;  4OUF A;  3U5N A;  4CLB A;  4NR7 A;  5COI A;  4ALH A;  5L97 A;  5D3P A;  4YH3 A;  5CQ5 A;  5FDZ A;  4YYK A;  2DVS A;  4YAD A;  5CFW A;  4YYH A;  2I7K A;  4YYD A;  5L96 A;  4YY4 A;  4A9J A;  5L8U A;  4NR4 A;  4O7E A;  5A5P A;  3QZT A;  4QUU A;  4PY6 A;  5CRZ A;  5EI4 A;  4QC1 A;  1E6I A;  1F68 A;  4QB3 A;  5ENJ A;  5DFC A;  2RNW A;  4J0S A;  4C67 A;  5K29 A;  2OSS A;  4LR6 A;  5AME A;  5FE9 A;  5C4Q A;  4QSS A;  5E9M A;  5DYA A;  3NXB A;  5ACY A;  5FFY A;  5I88 A;  4CUQ A;  4N4G A;  4MEN A;  5FE2 A;  5EPS A;  5CTL A;  5FE3 A;  4O71 A;  4QUT A;  5H1U A;  5D7X A;  5LVQ A;  1ZS5 A;  5HLS A;  4CL9 A;  5FB0 A;  5LKU A;  1WUM A;  4IOR A;  5DW1 A;  4O74 A;  4LYW A;  4TZ2 A;  4QSV A;  4O72 A;  4NRB A;  5ENC A;  3P1E A;  4O70 A;  4QC3 A;  4NUC A;  4XUA A;  5A83 A;  5A5O A;  3AQA A;  4HBW A;  4FLP A;  5HQ6 A;  3G0J A;  2WP2 A;  3U5K A;  4AKN A;  4Z1S A;  5DYC A;  5II1 A;  5CUG A;  4NUE A;  4YYM A;  5FG4 A;  4HBV A;  4MR6 A;  5F5Z A;  3UV4 A;  3Q2F A;  4MEO A;  4QR4 A;  5I1Q A;  4CFL A;  3IU5 A;  4NQN A;  3UVW A;  5HRW A;  3HMF A;  5CS8 A;  4LZS A;  5ETB A;  4UIY A;  4BHW A;  5FE0 A;  2YEM A;  5DKD A;  5I80 A;  2F6J A;  5E9Y A;  5L98 A;  3MB4 A;  4BW3 A;  4HXK A;  2LSP B;  5FE4 A;  4Z6H A;  5AD2 A;  4QR5 A;  3UVD A;  2OO1 A;  3U5M A;  4UIW A;  3UV5 A;  2GRC A;  4XYA A;  4KV4 A;  2L5E A;  5DLZ A;  2F6N A;  2RFJ A;  4YBT A;  4NYX A;  5TCM A;  4HXS A;  5LVR A;  4HXO A;  4YY6 A;  5CQ6 A;  4A9K A;  4QYD A;  5CZG A;  5ETD A;  4O7B A;  3DWY A;  3UW9 A;  3QZV A;  3RCW A;  5C89 A;  5I29 A;  5DYU A;  5CQT A;  3IU6 A;  3MQM A;  5KU3 A;  4QR3 A;  4HBX A;  5FH6 A;  4NR6 A;  5CUB A;  4LRG A;  2RNY A;  5E73 A;  3Q2E A;  4UIZ A;  5G4R A;  4CFK A;  3S92 A;  4LDF A;  4J0R A;  4KV1 A;  5C7N A;  4TT6 A;  5D25 A;  4IR6 A;  5FE5 A;  3ZYU A;  2D82 A;  4TQN A;  2RO1 A;  5LJ0 A;  4HXL A;  4TU6 A;  5D3L A;  5E9L A;  4IR5 A;  3SVH A;  5JWM A;  2R0Y A;  3LQH A;  4E96 A;  4YAB A;  5LJ2 A;  5FE7 A;  5FE6 A;  4TU4 A;  4TZ8 A;  4QSW A;  5EQ1 A;  2DKW A;  4HXP A;  4QSU A;  5A85 A;  5IGN A;  5F3A A;  3P5O A;  2YEL A;  5I83 A;  4CUS A;  4N4H A;  2R0V A;  5LUU A;  3HME A;  4YAT A;  3HMH A;  4LC2 A;  1N72 A;  5HEL A;  5CUE A;  4J3I A;  5G4S A;  5HRX A;  4MR5 A;  3ONI A; 
#chains in the Genus database with same CATH topology
 4OGJ A;  5KTX A;  4XY9 A;  5DKH A;  5L8T A;  5LJ1 A;  4IR4 A;  4QEU A;  5DYX A;  4UYE A;  5DFD A;  4NQM A;  5HEM A;  4UIX A;  5C8G A;  5EWW A;  5E74 A;  5CRM A;  3O37 A;  5DY7 A;  5KTW A;  4QYL A;  4O76 A;  5EM3 A;  5EIC A;  4HXN A;  2RS9 B;  5H1V A;  5IGL A;  5CU8 A;  5ENF A;  3O35 A;  3VKG A;  2DVQ A;  2L85 A;  5A5Q A;  5FG5 A;  4GPJ A;  4WIV A;  3MB3 A;  4BW1 A;  5HCL A;  5CQ8 A;  3G0L A;  5DW2 A;  5EWC A;  4ZC9 A;  4A9F A;  3LQI A;  4O7C A;  2YEK A;  4KCX A;  4AKI A;  4F3I A;  3ERR A;  4LZ2 A;  3JVK A;  4XUB A;  5L99 A;  4Z93 A;  1PUO A;  4NR9 A;  5EA1 A;  5EGU A;  5EPR A;  3UVX A;  4A9H A;  5CUD A;  4N4F A;  4DON A;  3O36 A;  5A81 A;  5E9I A;  4A9E A;  4UYH A;  4QEV A;  2WP1 A;  5D3T A;  5EU1 A;  5FH8 A;  2FSA A;  4UYD A;  5IGM A;  4QNS A;  4O7F A;  4MEQ A;  1X0J A;  3O34 A;  4ZW1 A;  5HRV A;  4YYG A;  5C87 A;  5H1T A;  5E3G A;  1EQF A;  5D24 A;  5KHM A;  2E7N A;  2R0S A;  4PTB A;  4ALG A;  5HM0 A;  2OUO A;  2N9G A;  3U5J A;  2E3K A;  4WHU A;  4TT2 A;  4YH4 A;  4YAX A;  4UYF A;  5FB1 A;  3U5O A;  2KTB B;  5F25 A;  5HQ7 A;  5D3R A;  4Q0N A;  4Y03 A;  2YYN A;  4CUR A;  5F62 A;  4NS5 A;  4BW2 A;  5E9V A;  3SVF A;  5I7Y A;  5AD3 A;  4LZR A;  5FFW A;  3MUL A;  2R10 A;  4PS5 A;  5EV9 A;  5A7C A;  5FBX A;  5C85 A;  4OGI A;  5LKZ A;  3LQJ A;  4YYJ A;  5A5S A;  4CUU A;  5FFV A;  4MR3 A;  4X2I A;  3O33 A;  2DAT A;  5CUA A;  5ENI A;  4HBY A;  3UVY A;  5CUC A;  4A9M A;  2RI7 A;  5FE1 A;  4NRC A;  5EP7 A;  2E7O A;  5IGK A;  4PKL A;  4YBM A;  4NYV A;  4CUT A;  3P1F A;  5TB6 A;  4A9O A;  3D7C A;  5CQ4 A;  3U5L A;  5F61 A;  4N3W A;  4AKG A;  3FKM X;  4A9I A;  3QZS A;  5E9K A;  4WHW A;  1JM4 B;  5EPB A;  5CQ3 A;  5JI8 A;  2NXB A;  5IID A;  2YDW A;  5H85 A;  3P1D A;  4RVR A;  3S91 A;  5BT5 A;  4YYN A;  4QSQ A;  3P1C A;  4UIT A;  4QBM A;  5F63 A;  5EWD A;  4IOO A;  4YC9 A;  4IOQ A;  3MXF A;  3LJW A;  4IR3 A;  2DWW A;  5D3N A;  4QY4 A;  5BT4 A;  2YW5 A;  4NR5 A;  4MEP A;  5D3S A;  1WUG A;  3UV2 A;  5CP5 A;  2DVR A;  4UYF B;  4CUP A;  2D9E A;  5HQ5 A;  4UYG A;  2I8N A;  4O75 A;  5CGP A;  4O7A A;  5IBN A;  4Z1Q A;  2H60 A;  4LYS A;  4Q0O A;  5EVA A;  5LKX A;  5A5R A;  5I86 A;  4O78 A;  4HXR A;  4QEW A;  4J1P A;  5CPE A;  5EWV A;  5II2 A;  5F2P A;  4A9N A;  2L84 A;  5HEN A;  4BJX A;  3DAI A;  3I3J A;  4LYI A;  5CQA A;  5D3H A;  5DBM A;  5FG6 A;  3GG3 A;  4AKH A;  4TTE A;  5DX4 A;  3JVM A;  4YYI A;  4UIU A;  5KTU A;  5EWH A;  4NXJ A;  4HXM A;  4MR4 A;  5EK9 A;  5ENH A;  5D26 A;  3LXJ A;  2YQD A;  4NR8 A;  4NUD A;  5FH7 A;  5E7D A;  5HJC A;  4NYW A;  5I89 A;  5I40 A;  5E3D A;  5CY9 A;  5CQ7 A;  5I7X A;  4C66 A;  4QST A;  3D1D A;  5AMF A;  5D3J A;  2EJN A;  5DLX A;  5A5N A;  3AAD A;  5IG6 A;  4BW4 A;  4TYL A;  5J0D A;  3U5P A;  3MUK A;  3TLP A;  4NRA A;  4AI6 A;  5A82 A;  4A9L A;  4TS8 A;  5D0C A;  3JVL A;  4TT4 A;  5ENG A;  2G4A A;  5DKC A;  5HFR A;  5LKT A;  5F1L A;  5F60 A;  4UIV A;  3K2J A;  3JVJ A;  4N4I A;  2RNX A;  4PCE A;  4QSX A;  5FE8 A;  5F1H A;  2DVV A;  5ENB A;  4O77 A;  4QSP A;  4XY8 A;  2MJV B;  5E0R A;  4YBS A;  4ZQL A;  5DFB A;  3SVG A;  5HFQ A;  4QZS A;  4QSR A;  4Z6I A;  5F36 A;  1JSP B;  5EIS A;  5KO4 A;  4YK0 A;  5ENE A;  4PCI A;  5BT3 A;  4OUF A;  3U5N A;  4CLB A;  4NR7 A;  5COI A;  4ALH A;  5L97 A;  5D3P A;  4YH3 A;  5CQ5 A;  5FDZ A;  4YYK A;  2DVS A;  4YAD A;  5CFW A;  4YYH A;  2I7K A;  4YYD A;  5L96 A;  4YY4 A;  4A9J A;  5L8U A;  4NR4 A;  4O7E A;  5A5P A;  3QZT A;  4QUU A;  4PY6 A;  5CRZ A;  5EI4 A;  4QC1 A;  1E6I A;  1F68 A;  4QB3 A;  5ENJ A;  2RNW A;  5DFC A;  4J0S A;  4C67 A;  5K29 A;  2OSS A;  4LR6 A;  5AME A;  5FE9 A;  5C4Q A;  4QSS A;  5E9M A;  5DYA A;  3NXB A;  5ACY A;  5FFY A;  5I88 A;  4CUQ A;  4N4G A;  4MEN A;  5FE2 A;  5EPS A;  5CTL A;  5FE3 A;  4O71 A;  4QUT A;  5H1U A;  5D7X A;  5LVQ A;  1ZS5 A;  5HLS A;  4CL9 A;  5FB0 A;  5LKU A;  1WUM A;  4IOR A;  5DW1 A;  4O74 A;  4LYW A;  1ZKR A;  4TZ2 A;  4QSV A;  4O72 A;  4NRB A;  5ENC A;  3P1E A;  4O70 A;  4QC3 A;  4NUC A;  4XUA A;  5A83 A;  5A5O A;  3AQA A;  4HBW A;  4FLP A;  5HQ6 A;  3G0J A;  2WP2 A;  3U5K A;  4AKN A;  4Z1S A;  5DYC A;  5II1 A;  5CUG A;  4NUE A;  4YYM A;  5FG4 A;  4HBV A;  4MR6 A;  5F5Z A;  3UV4 A;  3Q2F A;  4MEO A;  4QR4 A;  5I1Q A;  4CFL A;  3IU5 A;  4NQN A;  3UVW A;  5HRW A;  3HMF A;  5CS8 A;  4LZS A;  5ETB A;  4UIY A;  4BHW A;  5FE0 A;  2YEM A;  5DKD A;  5I80 A;  2F6J A;  5E9Y A;  5L98 A;  3MB4 A;  3D1B A;  4BW3 A;  4HXK A;  2LSP B;  5FE4 A;  4Z6H A;  5AD2 A;  4QR5 A;  3UVD A;  2OO1 A;  3U5M A;  4UIW A;  3UV5 A;  2GRC A;  4XYA A;  4KV4 A;  2L5E A;  5DLZ A;  2F6N A;  2RFJ A;  4YBT A;  4NYX A;  5TCM A;  4HXS A;  5LVR A;  4HXO A;  4YY6 A;  5CQ6 A;  4A9K A;  4QYD A;  5CZG A;  5ETD A;  4O7B A;  3DWY A;  3UW9 A;  3QZV A;  3RCW A;  5C89 A;  5I29 A;  5DYU A;  5CQT A;  3IU6 A;  3MQM A;  5KU3 A;  4QR3 A;  4HBX A;  5FH6 A;  4NR6 A;  5CUB A;  4LRG A;  2RNY A;  5E73 A;  3Q2E A;  4UIZ A;  5G4R A;  4CFK A;  3S92 A;  4LDF A;  4J0R A;  4KV1 A;  5C7N A;  4TT6 A;  5D25 A;  4IR6 A;  5FE5 A;  3ZYU A;  2D82 A;  4TQN A;  2RO1 A;  5LJ0 A;  4HXL A;  4TU6 A;  5D3L A;  5E9L A;  4IR5 A;  3SVH A;  5JWM A;  2R0Y A;  3LQH A;  4E96 A;  4YAB A;  5LJ2 A;  5FE7 A;  5FE6 A;  4TU4 A;  4TZ8 A;  4QSW A;  5EQ1 A;  2DKW A;  4HXP A;  3VKH A;  4QSU A;  5A85 A;  5IGN A;  5F3A A;  3P5O A;  2YEL A;  5I83 A;  4CUS A;  4N4H A;  2R0V A;  5LUU A;  3HME A;  4YAT A;  3HMH A;  4LC2 A;  1N72 A;  5HEL A;  5CUE A;  4J3I A;  5G4S A;  5HRX A;  4MR5 A;  3ONI A; 
#chains in the Genus database with same CATH homology
 4OGJ A;  5KTX A;  4XY9 A;  5DKH A;  5L8T A;  5LJ1 A;  4IR4 A;  4QEU A;  5DYX A;  4UYE A;  5DFD A;  4NQM A;  5HEM A;  4UIX A;  5C8G A;  5EWW A;  5E74 A;  5CRM A;  3O37 A;  5DY7 A;  5KTW A;  4QYL A;  4O76 A;  5EM3 A;  5EIC A;  4HXN A;  2RS9 B;  5H1V A;  5IGL A;  5CU8 A;  5ENF A;  3O35 A;  2DVQ A;  2L85 A;  5A5Q A;  5FG5 A;  4GPJ A;  4WIV A;  3MB3 A;  4BW1 A;  5HCL A;  5CQ8 A;  3G0L A;  5DW2 A;  5EWC A;  4ZC9 A;  4A9F A;  3LQI A;  4O7C A;  2YEK A;  4KCX A;  4F3I A;  4LZ2 A;  3JVK A;  4XUB A;  5L99 A;  4Z93 A;  4NR9 A;  5EA1 A;  5EPR A;  5EGU A;  3UVX A;  4A9H A;  5CUD A;  4N4F A;  4DON A;  3O36 A;  5A81 A;  5E9I A;  4A9E A;  4UYH A;  4QEV A;  2WP1 A;  5D3T A;  5EU1 A;  5FH8 A;  2FSA A;  4UYD A;  5IGM A;  4QNS A;  4O7F A;  4MEQ A;  1X0J A;  3O34 A;  4ZW1 A;  5HRV A;  4YYG A;  5C87 A;  5H1T A;  5E3G A;  1EQF A;  5D24 A;  5KHM A;  2E7N A;  2R0S A;  4PTB A;  4ALG A;  5HM0 A;  2OUO A;  2N9G A;  3U5J A;  2E3K A;  4WHU A;  4TT2 A;  4YH4 A;  4YAX A;  4UYF A;  5FB1 A;  3U5O A;  2KTB B;  5F25 A;  5HQ7 A;  5D3R A;  4Q0N A;  4Y03 A;  2YYN A;  4CUR A;  5F62 A;  4NS5 A;  4BW2 A;  5E9V A;  3SVF A;  5I7Y A;  5AD3 A;  4LZR A;  5FFW A;  3MUL A;  2R10 A;  4PS5 A;  5EV9 A;  5A7C A;  5FBX A;  5C85 A;  4OGI A;  5LKZ A;  3LQJ A;  4YYJ A;  5A5S A;  4CUU A;  5FFV A;  4MR3 A;  4X2I A;  3O33 A;  2DAT A;  5CUA A;  5ENI A;  4HBY A;  3UVY A;  5CUC A;  4A9M A;  2RI7 A;  5FE1 A;  4NRC A;  5EP7 A;  2E7O A;  5IGK A;  4PKL A;  4YBM A;  4NYV A;  4CUT A;  3P1F A;  5TB6 A;  4A9O A;  3D7C A;  5CQ4 A;  3U5L A;  5F61 A;  4N3W A;  3FKM X;  4A9I A;  3QZS A;  5E9K A;  4WHW A;  1JM4 B;  5EPB A;  5CQ3 A;  5JI8 A;  2NXB A;  5IID A;  2YDW A;  5H85 A;  3P1D A;  4RVR A;  3S91 A;  5BT5 A;  4YYN A;  4QSQ A;  3P1C A;  4UIT A;  4QBM A;  5F63 A;  5EWD A;  4IOO A;  4YC9 A;  4IOQ A;  3MXF A;  3LJW A;  4IR3 A;  2DWW A;  5D3N A;  4QY4 A;  5BT4 A;  2YW5 A;  4NR5 A;  4MEP A;  5D3S A;  1WUG A;  3UV2 A;  5CP5 A;  2DVR A;  4UYF B;  4CUP A;  2D9E A;  5HQ5 A;  4UYG A;  2I8N A;  4O75 A;  5CGP A;  4O7A A;  5IBN A;  4Z1Q A;  2H60 A;  4LYS A;  4Q0O A;  5EVA A;  5LKX A;  5A5R A;  5I86 A;  4O78 A;  4HXR A;  4QEW A;  4J1P A;  5CPE A;  5EWV A;  5II2 A;  5F2P A;  4A9N A;  2L84 A;  5HEN A;  4BJX A;  3DAI A;  3I3J A;  4LYI A;  5CQA A;  5D3H A;  5DBM A;  5FG6 A;  3GG3 A;  4TTE A;  5DX4 A;  3JVM A;  4YYI A;  4UIU A;  5KTU A;  5EWH A;  4NXJ A;  4HXM A;  4MR4 A;  5EK9 A;  5ENH A;  5D26 A;  3LXJ A;  2YQD A;  4NR8 A;  4NUD A;  5FH7 A;  5E7D A;  5HJC A;  4NYW A;  5I89 A;  5I40 A;  5E3D A;  5CY9 A;  5CQ7 A;  5I7X A;  4C66 A;  4QST A;  5AMF A;  5D3J A;  5DLX A;  5A5N A;  3AAD A;  5IG6 A;  4BW4 A;  4TYL A;  5J0D A;  3U5P A;  3MUK A;  3TLP A;  4NRA A;  5A82 A;  4A9L A;  4TS8 A;  5D0C A;  3JVL A;  4TT4 A;  5ENG A;  2G4A A;  5DKC A;  5HFR A;  5LKT A;  5F1L A;  5F60 A;  4UIV A;  3K2J A;  3JVJ A;  4N4I A;  2RNX A;  4PCE A;  4QSX A;  5FE8 A;  5F1H A;  2DVV A;  5ENB A;  4O77 A;  4QSP A;  4XY8 A;  2MJV B;  5E0R A;  4YBS A;  4ZQL A;  5DFB A;  3SVG A;  5HFQ A;  4QZS A;  4QSR A;  4Z6I A;  5F36 A;  1JSP B;  5EIS A;  5KO4 A;  4YK0 A;  5ENE A;  4PCI A;  5BT3 A;  4OUF A;  3U5N A;  4CLB A;  4NR7 A;  5COI A;  4ALH A;  5L97 A;  5D3P A;  4YH3 A;  5CQ5 A;  5FDZ A;  4YYK A;  2DVS A;  4YAD A;  5CFW A;  4YYH A;  2I7K A;  4YYD A;  5L96 A;  4YY4 A;  4A9J A;  5L8U A;  4NR4 A;  4O7E A;  5A5P A;  3QZT A;  4QUU A;  4PY6 A;  5CRZ A;  5EI4 A;  4QC1 A;  1E6I A;  1F68 A;  4QB3 A;  5ENJ A;  5DFC A;  2RNW A;  4J0S A;  4C67 A;  5K29 A;  2OSS A;  4LR6 A;  5AME A;  5FE9 A;  5C4Q A;  4QSS A;  5E9M A;  5DYA A;  3NXB A;  5ACY A;  5FFY A;  5I88 A;  4CUQ A;  4N4G A;  4MEN A;  5FE2 A;  5EPS A;  5CTL A;  5FE3 A;  4O71 A;  4QUT A;  5H1U A;  5D7X A;  5LVQ A;  1ZS5 A;  5HLS A;  4CL9 A;  5FB0 A;  5LKU A;  1WUM A;  4IOR A;  5DW1 A;  4O74 A;  4LYW A;  4TZ2 A;  4QSV A;  4O72 A;  4NRB A;  5ENC A;  3P1E A;  4O70 A;  4QC3 A;  4NUC A;  4XUA A;  5A83 A;  5A5O A;  3AQA A;  4HBW A;  4FLP A;  5HQ6 A;  3G0J A;  2WP2 A;  3U5K A;  4AKN A;  4Z1S A;  5DYC A;  5II1 A;  5CUG A;  4NUE A;  4YYM A;  5FG4 A;  4HBV A;  4MR6 A;  5F5Z A;  3UV4 A;  3Q2F A;  4MEO A;  4QR4 A;  5I1Q A;  4CFL A;  3IU5 A;  4NQN A;  3UVW A;  5HRW A;  3HMF A;  5CS8 A;  4LZS A;  5ETB A;  4UIY A;  4BHW A;  5FE0 A;  2YEM A;  5DKD A;  5I80 A;  2F6J A;  5E9Y A;  5L98 A;  3MB4 A;  4BW3 A;  4HXK A;  2LSP B;  5FE4 A;  4Z6H A;  5AD2 A;  4QR5 A;  3UVD A;  2OO1 A;  3U5M A;  4UIW A;  3UV5 A;  2GRC A;  4XYA A;  4KV4 A;  2L5E A;  5DLZ A;  2F6N A;  2RFJ A;  4YBT A;  4NYX A;  5TCM A;  4HXS A;  5LVR A;  4HXO A;  4YY6 A;  5CQ6 A;  4A9K A;  4QYD A;  5CZG A;  5ETD A;  4O7B A;  3DWY A;  3UW9 A;  3QZV A;  3RCW A;  5C89 A;  5I29 A;  5DYU A;  5CQT A;  3IU6 A;  3MQM A;  5KU3 A;  4QR3 A;  4HBX A;  5FH6 A;  4NR6 A;  5CUB A;  4LRG A;  2RNY A;  5E73 A;  3Q2E A;  4UIZ A;  5G4R A;  4CFK A;  3S92 A;  4LDF A;  4J0R A;  4KV1 A;  5C7N A;  4TT6 A;  5D25 A;  4IR6 A;  5FE5 A;  3ZYU A;  2D82 A;  4TQN A;  2RO1 A;  5LJ0 A;  4HXL A;  4TU6 A;  5D3L A;  5E9L A;  4IR5 A;  3SVH A;  5JWM A;  2R0Y A;  3LQH A;  4E96 A;  4YAB A;  5LJ2 A;  5FE7 A;  5FE6 A;  4TU4 A;  4TZ8 A;  4QSW A;  5EQ1 A;  2DKW A;  4HXP A;  4QSU A;  5A85 A;  5IGN A;  5F3A A;  3P5O A;  2YEL A;  5I83 A;  4CUS A;  4N4H A;  2R0V A;  5LUU A;  3HME A;  4YAT A;  3HMH A;  4LC2 A;  1N72 A;  5HEL A;  5CUE A;  4J3I A;  5G4S A;  5HRX A;  4MR5 A;  3ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...