2I7KA

Solution structure of the bromodomain of human brd7 protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 7
publication title Solution structure of BRD7 bromodomain and its interaction with acetylated peptides from histone H3 and H4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2i7kA00
4A9FA 4XUAA 5IGKA 5C89A 4QSQA 5F61A 5H1VA 5IBNA 3UW9A 4NR6A 5ENIA 5L97A 4Z1SA 2OUOA 5HQ7A 5H1UA 3U5PA 4A9IA 4J0RA 5IGLA 2KTBB 4KV4A 3U5MA 4A9EA 5ENCA 4QSRA 4YH3A 2E7NA 3MB3A 3MXFA 5HQ5A 4TT2A 5LJ0A 4WHWA 4YYNA 3UV5A 4LYWA 5CS8A 5DYXA 5FE5A 5FG6A 5E3DA 3TLPA 3UV4A 4J1PA 2RNWA 5A82A 5LVQA 4KCXA 5IGMA 4QSPA 5CQ6A 4YYMA 4A9MA 3SVGA 2L5EA 5I1QA 5HCLA 4ZW1A 5CP5A 3UVDA 4NRCA 4UYHA 4QSTA 5EWVA 3P1FA 5LUUA 4UIXA 5JI8A 5DYAA 4YABA 3JVLA 5CQAA 5G4RA 5HEMA 4IR3A 5CUGA 4YAXA 5CQ3A 4HXNA 5HM0A 5EWCA 4XY9A 2D82A 4NR7A 4YY6A 3P1DA 1JSPB 5DLZA 5A5RA 4DONA 2E7OA 4N4HA 3UV2A 5H1TA 5BT5A 4YYIA 4QEWA 5EPRA 4UIVA 2L85A 5CQ8A 5D3LA 3LJWA 4QUUA 4UIYA 4O7CA 5E0RA 5DY7A 4QYLA 4O72A 5D3SA 4QSVA 3U5JA 4TZ2A 5IG6A 5I88A 4MEQA 4HXSA 5ACYA 4HXPA 3LQHA 4QR4A 5DFCA 4J0SA 5BT4A 3MULA 5E9YA 5ENBA 5E9KA 3U5LA 4LZSA 4O77A 4QYDA 5EPBA 4HBXA 4TU4A 5D3NA 5EPSA 3G0LA 4CFKA 5FB0A 5D3JA 5LJ1A 4QEVA 5BT3A 2YEKA 4QC1A 2R10A 5CQ7A 4YYHA 5F60A 5D3TA 3G0JA 4LRGA 5ETBA 2N9GA 4C66A 2LSPB 4YK0A 4QB3A 4TS8A 5I29A 5DBMA 4O75A 5CFWA 4CLBA 2R0YA 4LYIA 2FSAA 4TT4A 5F25A 5JWMA 4PY6A 5EISA 4MEOA 2DVVA 5HFRA 4BW3A 4NYVA 3Q2FA 5EM3A 5FH7A 5DFBA 3UVYA 4N3WA 5D26A 4TT6A 4IR4A 4A9LA 5DKHA 5A5SA 5D3PA 2RO1A 4UIZA 5TCMA 5LKUA 3IU5A 4O7BA 5CPEA 4IOQA 4NS5A 4ZC9A 3O35A 2G4AA 4O74A 5I86A 4LYSA 5HJCA 3AQAA 5E74A 4NYXA 5KTXA 2RFJA 3D7CA 4QUTA 4HXKA 4IORA 2YW5A 4QSSA 4NR5A 4C67A 3HMHA 4UYDA 2D9EA 5CUCA 1N72A 5I40A 3SVHA 4HXOA 5FG4A 2R0SA 4KV1A 4NR8A 3ZYUA 4FLPA 5ENFA 4BW4A 4YYKA 4YATA 5HRWA 3JVJA 2DWWA 4UYEA 5II2A 5CRZA 5EWWA 5E3GA 4OGIA 3S91A 5ETDA 4QY4A 5F2PA 5FE7A 4Z1QA 5FG5A 5C7NA 5FH8A 5I7YA 5LKTA 5D3RA 4YYDA 5AD2A 5D25A 5HFQA 5EWHA 3O33A 4HBYA 4IR6A 3UVWA 4O7FA 4NQNA 4YBTA 5CU8A 5A5NA 5E7DA 2YDWA 4A9JA 4NUCA 4CUPA 3LQJA 3IU6A 4QSUA 4UYFA 5C8GA 5E9LA 3DWYA 4QR5A 2I8NA 4NUDA 5AD3A 3HMEA 5A81A 5DW2A 4X2IA 4NR4A 1EQFA 3SVFA 4QC3A 5F62A 4NXJA 4UYFB 2DVQA 4NR9A 5AMEA 5CQ4A 5A5QA 5ENGA 5HRXA 2RS9B 5L99A 2RNXA 4NUEA 4QNSA 3S92A 4ALHA 5HENA 4CFLA 4LDFA 5FFWA 5LKXA 3P5OA 3Q2EA 5HRVA 5A83A 5FFYA 5DYCA 5LKZA 2NXBA 3QZSA 4YH4A 3O37A 4BW2A 5H85A 5ENJA 4Z6IA 4J3IA 4MENA 3UVXA 4UYGA 5I83A 2F6JA 3U5NA 5FB1A 5F63A 2OSSA 2DKWA 4CUUA 4ZQLA 3MUKA 5CZGA 4PCIA 5A5OA 3U5OA 4LZ2A 3LQIA 4OGJA 5EA1A 1F68A 3QZTA 5CUAA 4UIWA 5IIDA 4TYLA 5HELA 2DATA 5CRMA 5CUEA 4YYGA 2DVSA 4CUTA 1X0JA 4A9OA 5EK9A 4O78A 5L8TA 5EWDA 5D3HA 5F3AA 2RNYA 5L98A 5FE3A 5FE9A 4N4GA 5CUBA 4HXRA 3DAIA 5FE6A 2F6NA 2YELA 2WP1A 5L96A 4UIUA 5DW1A 4AKNA 2RI7A 5F36A 4TQNA 5A7CA 4OUFA 4PS5A 5EP7A 3NXBA 4Q0NA 4NQMA 4QR3A 1WUGA 5D7XA 5HQ6A 4F3IA 2R0VA 2H60A 5FBXA 4NRBA 3MQMA 5COIA 4Y03A 4NYWA 4CUSA 4O7AA 5EVAA 5F1HA 5E9MA 5I80A 4Z93A 4XY8A 4WIVA 5TB6A 5L8UA 3JVMA 4LR6A 4PKLA 5CGPA 4TU6A 4BHWA 4QBMA 5DFDA 4BW1A 4ALGA 5A5PA 5FH6A 1E6IA 4CURA 2YEMA 5FDZA 5HLSA 5EV9A 4YY4A 5LVRA 4LC2A 4BJXA 5I89A 5FE1A 4YADA 5EICA 2MJVB 4TTEA 5CY9A 5FE0A 2GRCA 4RVRA 4YC9A 5DX4A 5F5ZA 3ONIA 4O7EA 5CQ5A 3MB4A 5FE8A 5CTLA 4YBMA 5DLXA 5J0DA 3P1CA 2WP2A 5DKDA 5A85A 4O76A 4QEUA 1WUMA 4Q0OA 3K2JA 5D24A 4HXLA 3U5KA 5II1A 4QZSA 4HBVA 5LJ2A 3AADA 4UITA 5C87A 3O36A 4PCEA 5KHMA 3JVKA 4A9KA 4Z6HA 4IOOA 5EU1A 4YBSA 3FKMX 5CUDA 4O70A 5AMFA 4QSXA 5EQ1A 4O71A 5KTUA 2E3KA 1JM4B 2I7KA 5FE4A 5FFVA 2OO1A 4XYAA 5E9IA 5EGUA 3HMFA 1ZS5A 5KTWA 4MEPA 4QSWA 4TZ8A 4A9HA 5DKCA 5K29A 5DYUA 4CL9A 5KO4A 4MR4A 5D0CA 4YYJA 4MR3A 4PTBA 4GPJA 2YQDA 5E9VA 3P1EA 5ENHA 3QZVA 5C85A 3I3JA 4HBWA 4N4FA 4CUQA 5CQTA 2DVRA 4XUBA 2YYNA 4MR5A 5C4QA 4HXMA 5ENEA 5IGNA 4MR6A 5G4SA 5KU3A 4A9NA 4IR5A 4LZRA 5EI4A 5I7XA 5F1LA 4N4IA 2L84A 3O34A 3RCWA 5FE2A 4WHUA 5E73A 3LXJA 4NRAA 3GG3A 4E96A
chains in the Genus database with same CATH superfamily
4A9FA 4XUAA 5IGKA 5C89A 4QSQA 5F61A 5H1VA 5IBNA 3UW9A 4NR6A 5ENIA 5L97A 4Z1SA 2OUOA 5HQ7A 5H1UA 3U5PA 4A9IA 4J0RA 5IGLA 2KTBB 4KV4A 3U5MA 4A9EA 5ENCA 4QSRA 4YH3A 2E7NA 3MB3A 3MXFA 5HQ5A 4TT2A 5LJ0A 4WHWA 4YYNA 3UV5A 4LYWA 5CS8A 5DYXA 5FE5A 5FG6A 5E3DA 3TLPA 3UV4A 4J1PA 2RNWA 5A82A 5LVQA 4KCXA 5IGMA 4QSPA 5CQ6A 4YYMA 4A9MA 3SVGA 2L5EA 5I1QA 5HCLA 4ZW1A 5CP5A 3UVDA 4NRCA 4UYHA 4QSTA 5EWVA 3P1FA 5LUUA 4UIXA 5JI8A 5DYAA 1ZKRA 4YABA 3D1BA 3JVLA 5CQAA 5G4RA 5HEMA 4IR3A 5CUGA 4YAXA 5CQ3A 4HXNA 5HM0A 5EWCA 4XY9A 2D82A 4NR7A 4YY6A 3P1DA 1JSPB 5DLZA 5A5RA 4DONA 2E7OA 4N4HA 3UV2A 5H1TA 5BT5A 4YYIA 4QEWA 5EPRA 4UIVA 2L85A 5CQ8A 5D3LA 3LJWA 4QUUA 4UIYA 4O7CA 5E0RA 5DY7A 4QYLA 4O72A 5D3SA 4QSVA 3U5JA 4TZ2A 5IG6A 5I88A 4MEQA 4HXSA 5ACYA 4HXPA 3LQHA 4QR4A 5DFCA 4J0SA 5BT4A 3MULA 5E9YA 5ENBA 5E9KA 3U5LA 4LZSA 4O77A 4QYDA 5EPBA 4HBXA 4TU4A 5D3NA 5EPSA 3G0LA 4CFKA 5FB0A 5D3JA 5LJ1A 3VKHA 4QEVA 5BT3A 2YEKA 4QC1A 2R10A 5CQ7A 4YYHA 5F60A 5D3TA 3G0JA 4LRGA 5ETBA 2N9GA 4C66A 2LSPB 4YK0A 4QB3A 4TS8A 5I29A 5DBMA 4O75A 5CFWA 4CLBA 2R0YA 4LYIA 2FSAA 4TT4A 5F25A 5JWMA 4PY6A 5EISA 4MEOA 2DVVA 5HFRA 4BW3A 4NYVA 3Q2FA 5EM3A 5FH7A 5DFBA 3UVYA 4N3WA 5D26A 4TT6A 4IR4A 4A9LA 5DKHA 5A5SA 5D3PA 2RO1A 4UIZA 5TCMA 5LKUA 3IU5A 4O7BA 5CPEA 4IOQA 4NS5A 4ZC9A 3O35A 2G4AA 4O74A 5I86A 4LYSA 5HJCA 3VKGA 3AQAA 5E74A 4NYXA 5KTXA 2RFJA 3D7CA 4QUTA 4HXKA 4IORA 2YW5A 4QSSA 4NR5A 4C67A 3HMHA 4UYDA 2D9EA 5CUCA 1N72A 3ERRA 5I40A 3SVHA 4HXOA 5FG4A 2R0SA 4KV1A 4NR8A 3ZYUA 4FLPA 5ENFA 4BW4A 4YYKA 4YATA 5HRWA 3JVJA 2DWWA 4UYEA 5II2A 5CRZA 5EWWA 5E3GA 4OGIA 3S91A 5ETDA 4QY4A 5F2PA 5FE7A 4Z1QA 5FG5A 5C7NA 5FH8A 5I7YA 5LKTA 5D3RA 4YYDA 5AD2A 5D25A 5HFQA 5EWHA 3O33A 4HBYA 4IR6A 3UVWA 4O7FA 4NQNA 4YBTA 5CU8A 5A5NA 5E7DA 2YDWA 4A9JA 4NUCA 4CUPA 3LQJA 3IU6A 4QSUA 4UYFA 5C8GA 5E9LA 3DWYA 2EJNA 4QR5A 2I8NA 4NUDA 5AD3A 3HMEA 4AI6A 5A81A 5DW2A 4X2IA 4NR4A 1EQFA 3SVFA 4QC3A 5F62A 4NXJA 4UYFB 2DVQA 4NR9A 5AMEA 5CQ4A 5A5QA 4AKGA 4AKIA 5ENGA 5HRXA 2RS9B 5L99A 4AKHA 2RNXA 4NUEA 4QNSA 3S92A 4ALHA 5HENA 4CFLA 4LDFA 5FFWA 5LKXA 3P5OA 3Q2EA 5HRVA 5A83A 5FFYA 5DYCA 5LKZA 2NXBA 3QZSA 4YH4A 3O37A 4BW2A 5H85A 5ENJA 4Z6IA 4J3IA 4MENA 3UVXA 4UYGA 5I83A 2F6JA 3U5NA 5FB1A 5F63A 2OSSA 2DKWA 4CUUA 4ZQLA 3MUKA 5CZGA 4PCIA 5A5OA 3U5OA 4LZ2A 3LQIA 4OGJA 5EA1A 1F68A 3QZTA 5CUAA 4UIWA 5IIDA 4TYLA 5HELA 2DATA 5CRMA 5CUEA 4YYGA 2DVSA 4CUTA 1X0JA 4A9OA 5EK9A 4O78A 5L8TA 5EWDA 5D3HA 5F3AA 2RNYA 5L98A 5FE3A 5FE9A 4N4GA 5CUBA 4HXRA 3DAIA 5FE6A 2F6NA 2YELA 2WP1A 5L96A 4UIUA 5DW1A 4AKNA 2RI7A 5F36A 4TQNA 3D1DA 5A7CA 4OUFA 4PS5A 5EP7A 3NXBA 4Q0NA 4NQMA 4QR3A 1WUGA 5D7XA 5HQ6A 4F3IA 2R0VA 2H60A 5FBXA 4NRBA 3MQMA 5COIA 4Y03A 4NYWA 4CUSA 4O7AA 5EVAA 5F1HA 5E9MA 5I80A 4Z93A 4XY8A 4WIVA 5TB6A 5L8UA 3JVMA 4LR6A 4PKLA 5CGPA 4TU6A 4BHWA 4QBMA 5DFDA 4BW1A 4ALGA 5A5PA 5FH6A 1E6IA 4CURA 2YEMA 5FDZA 5HLSA 5EV9A 4YY4A 5LVRA 4LC2A 4BJXA 5I89A 5FE1A 4YADA 5EICA 2MJVB 4TTEA 5CY9A 5FE0A 2GRCA 4RVRA 4YC9A 5DX4A 5F5ZA 3ONIA 4O7EA 5CQ5A 3MB4A 5FE8A 5CTLA 4YBMA 5DLXA 5J0DA 3P1CA 2WP2A 5DKDA 5A85A 4O76A 4QEUA 1WUMA 4Q0OA 3K2JA 5D24A 4HXLA 3U5KA 5II1A 4QZSA 4HBVA 5LJ2A 3AADA 4UITA 5C87A 3O36A 4PCEA 5KHMA 3JVKA 4A9KA 4Z6HA 4IOOA 5EU1A 4YBSA 3FKMX 5CUDA 4O70A 5AMFA 4QSXA 5EQ1A 4O71A 5KTUA 2E3KA 1JM4B 2I7KA 5FE4A 5FFVA 2OO1A 4XYAA 5E9IA 5EGUA 3HMFA 1ZS5A 1PUOA 5KTWA 4MEPA 4QSWA 4TZ8A 4A9HA 5DKCA 5K29A 5DYUA 4CL9A 5KO4A 4MR4A 5D0CA 4YYJA 4MR3A 4PTBA 4GPJA 2YQDA 5E9VA 3P1EA 5ENHA 3QZVA 5C85A 3I3JA 4HBWA 4N4FA 4CUQA 5CQTA 2DVRA 4XUBA 2YYNA 4MR5A 5C4QA 4HXMA 5ENEA 5IGNA 4MR6A 5G4SA 5KU3A 4A9NA 4IR5A 4LZRA 5EI4A 5I7XA 5F1LA 4N4IA 2L84A 3O34A 3RCWA 5FE2A 4WHUA 5E73A 3LXJA 4NRAA 3GG3A 4E96A
chains in the Genus database with same CATH topology
4A9FA 4XUAA 5IGKA 5C89A 4QSQA 5F61A 5H1VA 5IBNA 3UW9A 4NR6A 5ENIA 5L97A 4Z1SA 2OUOA 5HQ7A 5H1UA 3U5PA 4A9IA 4J0RA 5IGLA 2KTBB 4KV4A 3U5MA 4A9EA 5ENCA 4QSRA 4YH3A 2E7NA 3MB3A 3MXFA 5HQ5A 4TT2A 5LJ0A 4WHWA 4YYNA 3UV5A 4LYWA 5CS8A 5DYXA 5FE5A 5FG6A 5E3DA 3TLPA 3UV4A 4J1PA 2RNWA 5A82A 5LVQA 4KCXA 5IGMA 4QSPA 5CQ6A 4YYMA 4A9MA 3SVGA 2L5EA 5I1QA 5HCLA 4ZW1A 5CP5A 3UVDA 4NRCA 4UYHA 4QSTA 5EWVA 3P1FA 5LUUA 4UIXA 5JI8A 5DYAA 4YABA 3JVLA 5CQAA 5G4RA 5HEMA 4IR3A 5CUGA 4YAXA 5CQ3A 4HXNA 5HM0A 5EWCA 4XY9A 2D82A 4NR7A 4YY6A 3P1DA 1JSPB 5DLZA 5A5RA 4DONA 2E7OA 4N4HA 3UV2A 5H1TA 5BT5A 4YYIA 4QEWA 5EPRA 4UIVA 2L85A 5CQ8A 5D3LA 3LJWA 4QUUA 4UIYA 4O7CA 5E0RA 5DY7A 4QYLA 4O72A 5D3SA 4QSVA 3U5JA 4TZ2A 5IG6A 5I88A 4MEQA 4HXSA 5ACYA 4HXPA 3LQHA 4QR4A 5DFCA 4J0SA 5BT4A 3MULA 5E9YA 5ENBA 5E9KA 3U5LA 4LZSA 4O77A 4QYDA 5EPBA 4HBXA 4TU4A 5D3NA 5EPSA 3G0LA 4CFKA 5FB0A 5D3JA 5LJ1A 4QEVA 5BT3A 2YEKA 4QC1A 2R10A 5CQ7A 4YYHA 5F60A 5D3TA 3G0JA 4LRGA 5ETBA 2N9GA 4C66A 2LSPB 4YK0A 4QB3A 4TS8A 5I29A 5DBMA 4O75A 5CFWA 4CLBA 2R0YA 4LYIA 2FSAA 4TT4A 5F25A 5JWMA 4PY6A 5EISA 4MEOA 2DVVA 5HFRA 4BW3A 4NYVA 3Q2FA 5EM3A 5FH7A 5DFBA 3UVYA 4N3WA 5D26A 4TT6A 4IR4A 4A9LA 5DKHA 5A5SA 5D3PA 2RO1A 4UIZA 5TCMA 5LKUA 3IU5A 4O7BA 5CPEA 4IOQA 4NS5A 4ZC9A 3O35A 2G4AA 4O74A 5I86A 4LYSA 5HJCA 3AQAA 5E74A 4NYXA 5KTXA 2RFJA 3D7CA 4QUTA 4HXKA 4IORA 2YW5A 4QSSA 4NR5A 4C67A 3HMHA 4UYDA 2D9EA 5CUCA 1N72A 5I40A 3SVHA 4HXOA 5FG4A 2R0SA 4KV1A 4NR8A 3ZYUA 4FLPA 5ENFA 4BW4A 4YYKA 4YATA 5HRWA 3JVJA 2DWWA 4UYEA 5II2A 5CRZA 5EWWA 5E3GA 4OGIA 3S91A 5ETDA 4QY4A 5F2PA 5FE7A 4Z1QA 5FG5A 5C7NA 5FH8A 5I7YA 5LKTA 5D3RA 4YYDA 5AD2A 5D25A 5HFQA 5EWHA 3O33A 4HBYA 4IR6A 3UVWA 4O7FA 4NQNA 4YBTA 5CU8A 5A5NA 5E7DA 2YDWA 4A9JA 4NUCA 4CUPA 3LQJA 3IU6A 4QSUA 4UYFA 5C8GA 5E9LA 3DWYA 4QR5A 2I8NA 4NUDA 5AD3A 3HMEA 5A81A 5DW2A 4X2IA 4NR4A 1EQFA 3SVFA 4QC3A 5F62A 4NXJA 4UYFB 2DVQA 4NR9A 5AMEA 5CQ4A 5A5QA 5ENGA 5HRXA 2RS9B 5L99A 2RNXA 4NUEA 4QNSA 3S92A 4ALHA 5HENA 4CFLA 4LDFA 5FFWA 5LKXA 3P5OA 3Q2EA 5HRVA 5A83A 5FFYA 5DYCA 5LKZA 2NXBA 3QZSA 4YH4A 3O37A 4BW2A 5H85A 5ENJA 4Z6IA 4J3IA 4MENA 3UVXA 4UYGA 5I83A 2F6JA 3U5NA 5FB1A 5F63A 2OSSA 2DKWA 4CUUA 4ZQLA 3MUKA 5CZGA 4PCIA 5A5OA 3U5OA 4LZ2A 3LQIA 4OGJA 5EA1A 1F68A 3QZTA 5CUAA 4UIWA 5IIDA 4TYLA 5HELA 2DATA 5CRMA 5CUEA 4YYGA 2DVSA 4CUTA 1X0JA 4A9OA 5EK9A 4O78A 5L8TA 5EWDA 5D3HA 5F3AA 2RNYA 5L98A 5FE3A 5FE9A 4N4GA 5CUBA 4HXRA 3DAIA 5FE6A 2F6NA 2YELA 2WP1A 5L96A 4UIUA 5DW1A 4AKNA 2RI7A 5F36A 4TQNA 5A7CA 4OUFA 4PS5A 5EP7A 3NXBA 4Q0NA 4NQMA 4QR3A 1WUGA 5D7XA 5HQ6A 4F3IA 2R0VA 2H60A 5FBXA 4NRBA 3MQMA 5COIA 4Y03A 4NYWA 4CUSA 4O7AA 5EVAA 5F1HA 5E9MA 5I80A 4Z93A 4XY8A 4WIVA 5TB6A 5L8UA 3JVMA 4LR6A 4PKLA 5CGPA 4TU6A 4BHWA 4QBMA 5DFDA 4BW1A 4ALGA 5A5PA 5FH6A 1E6IA 4CURA 2YEMA 5FDZA 5HLSA 5EV9A 4YY4A 5LVRA 4LC2A 4BJXA 5I89A 5FE1A 4YADA 5EICA 2MJVB 4TTEA 5CY9A 5FE0A 2GRCA 4RVRA 4YC9A 5DX4A 5F5ZA 3ONIA 4O7EA 5CQ5A 3MB4A 5FE8A 5CTLA 4YBMA 5DLXA 5J0DA 3P1CA 2WP2A 5DKDA 5A85A 4O76A 4QEUA 1WUMA 4Q0OA 3K2JA 5D24A 4HXLA 3U5KA 5II1A 4QZSA 4HBVA 5LJ2A 3AADA 4UITA 5C87A 3O36A 4PCEA 5KHMA 3JVKA 4A9KA 4Z6HA 4IOOA 5EU1A 4YBSA 3FKMX 5CUDA 4O70A 5AMFA 4QSXA 5EQ1A 4O71A 5KTUA 2E3KA 1JM4B 2I7KA 5FE4A 5FFVA 2OO1A 4XYAA 5E9IA 5EGUA 3HMFA 1ZS5A 5KTWA 4MEPA 4QSWA 4TZ8A 4A9HA 5DKCA 5K29A 5DYUA 4CL9A 5KO4A 4MR4A 5D0CA 4YYJA 4MR3A 4PTBA 4GPJA 2YQDA 5E9VA 3P1EA 5ENHA 3QZVA 5C85A 3I3JA 4HBWA 4N4FA 4CUQA 5CQTA 2DVRA 4XUBA 2YYNA 4MR5A 5C4QA 4HXMA 5ENEA 5IGNA 4MR6A 5G4SA 5KU3A 4A9NA 4IR5A 4LZRA 5EI4A 5I7XA 5F1LA 4N4IA 2L84A 3O34A 3RCWA 5FE2A 4WHUA 5E73A 3LXJA 4NRAA 3GG3A 4E96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9F A;  4XUA A;  5IGK A;  5C89 A;  4QSQ A;  5F61 A;  5H1V A;  5IBN A;  3UW9 A;  4NR6 A;  5ENI A;  5L97 A;  4Z1S A;  2OUO A;  5HQ7 A;  5H1U A;  3U5P A;  4A9I A;  4J0R A;  5IGL A;  2KTB B;  4KV4 A;  3U5M A;  4A9E A;  5ENC A;  4QSR A;  4YH3 A;  2E7N A;  3MB3 A;  3MXF A;  5HQ5 A;  4TT2 A;  5LJ0 A;  4WHW A;  4YYN A;  3UV5 A;  4LYW A;  5CS8 A;  5DYX A;  5FE5 A;  5FG6 A;  5E3D A;  3TLP A;  3UV4 A;  4J1P A;  2RNW A;  5A82 A;  5LVQ A;  4KCX A;  5IGM A;  4QSP A;  5CQ6 A;  4YYM A;  4A9M A;  3SVG A;  2L5E A;  5I1Q A;  5HCL A;  4ZW1 A;  5CP5 A;  3UVD A;  4NRC A;  4UYH A;  4QST A;  5EWV A;  3P1F A;  5LUU A;  4UIX A;  5JI8 A;  5DYA A;  4YAB A;  3JVL A;  5CQA A;  5G4R A;  5HEM A;  4IR3 A;  5CUG A;  4YAX A;  5CQ3 A;  4HXN A;  5HM0 A;  5EWC A;  4XY9 A;  2D82 A;  4NR7 A;  4YY6 A;  3P1D A;  1JSP B;  5DLZ A;  5A5R A;  4DON A;  2E7O A;  4N4H A;  3UV2 A;  5H1T A;  5BT5 A;  4YYI A;  4QEW A;  5EPR A;  4UIV A;  2L85 A;  5CQ8 A;  5D3L A;  3LJW A;  4QUU A;  4UIY A;  4O7C A;  5E0R A;  5DY7 A;  4QYL A;  4O72 A;  5D3S A;  4QSV A;  3U5J A;  4TZ2 A;  5IG6 A;  5I88 A;  4MEQ A;  4HXS A;  5ACY A;  4HXP A;  3LQH A;  4QR4 A;  5DFC A;  4J0S A;  5BT4 A;  3MUL A;  5E9Y A;  5ENB A;  5E9K A;  3U5L A;  4LZS A;  4O77 A;  4QYD A;  5EPB A;  4HBX A;  4TU4 A;  5D3N A;  5EPS A;  3G0L A;  4CFK A;  5FB0 A;  5D3J A;  5LJ1 A;  4QEV A;  5BT3 A;  2YEK A;  4QC1 A;  2R10 A;  5CQ7 A;  4YYH A;  5F60 A;  5D3T A;  3G0J A;  4LRG A;  5ETB A;  2N9G A;  4C66 A;  2LSP B;  4YK0 A;  4QB3 A;  4TS8 A;  5I29 A;  5DBM A;  4O75 A;  5CFW A;  4CLB A;  2R0Y A;  4LYI A;  2FSA A;  4TT4 A;  5F25 A;  5JWM A;  4PY6 A;  5EIS A;  4MEO A;  2DVV A;  5HFR A;  4BW3 A;  4NYV A;  3Q2F A;  5EM3 A;  5FH7 A;  5DFB A;  3UVY A;  4N3W A;  5D26 A;  4TT6 A;  4IR4 A;  4A9L A;  5DKH A;  5A5S A;  5D3P A;  2RO1 A;  4UIZ A;  5TCM A;  5LKU A;  3IU5 A;  4O7B A;  5CPE A;  4IOQ A;  4NS5 A;  4ZC9 A;  3O35 A;  2G4A A;  4O74 A;  5I86 A;  4LYS A;  5HJC A;  3AQA A;  5E74 A;  4NYX A;  5KTX A;  2RFJ A;  3D7C A;  4QUT A;  4HXK A;  4IOR A;  2YW5 A;  4QSS A;  4NR5 A;  4C67 A;  3HMH A;  4UYD A;  2D9E A;  5CUC A;  1N72 A;  5I40 A;  3SVH A;  4HXO A;  5FG4 A;  2R0S A;  4KV1 A;  4NR8 A;  3ZYU A;  4FLP A;  5ENF A;  4BW4 A;  4YYK A;  4YAT A;  5HRW A;  3JVJ A;  2DWW A;  4UYE A;  5II2 A;  5CRZ A;  5EWW A;  5E3G A;  4OGI A;  3S91 A;  5ETD A;  4QY4 A;  5F2P A;  5FE7 A;  4Z1Q A;  5FG5 A;  5C7N A;  5FH8 A;  5I7Y A;  5LKT A;  5D3R A;  4YYD A;  5AD2 A;  5D25 A;  5HFQ A;  5EWH A;  3O33 A;  4HBY A;  4IR6 A;  3UVW A;  4O7F A;  4NQN A;  4YBT A;  5CU8 A;  5A5N A;  5E7D A;  2YDW A;  4A9J A;  4NUC A;  4CUP A;  3LQJ A;  3IU6 A;  4QSU A;  4UYF A;  5C8G A;  5E9L A;  3DWY A;  4QR5 A;  2I8N A;  4NUD A;  5AD3 A;  3HME A;  5A81 A;  5DW2 A;  4X2I A;  4NR4 A;  1EQF A;  3SVF A;  4QC3 A;  5F62 A;  4NXJ A;  4UYF B;  2DVQ A;  4NR9 A;  5AME A;  5CQ4 A;  5A5Q A;  5ENG A;  5HRX A;  2RS9 B;  5L99 A;  2RNX A;  4NUE A;  4QNS A;  3S92 A;  4ALH A;  5HEN A;  4CFL A;  4LDF A;  5FFW A;  5LKX A;  3P5O A;  3Q2E A;  5HRV A;  5A83 A;  5FFY A;  5DYC A;  5LKZ A;  2NXB A;  3QZS A;  4YH4 A;  3O37 A;  4BW2 A;  5H85 A;  5ENJ A;  4Z6I A;  4J3I A;  4MEN A;  3UVX A;  4UYG A;  5I83 A;  2F6J A;  3U5N A;  5FB1 A;  5F63 A;  2OSS A;  2DKW A;  4CUU A;  4ZQL A;  3MUK A;  5CZG A;  4PCI A;  5A5O A;  3U5O A;  4LZ2 A;  3LQI A;  4OGJ A;  5EA1 A;  1F68 A;  3QZT A;  5CUA A;  4UIW A;  5IID A;  4TYL A;  5HEL A;  2DAT A;  5CRM A;  5CUE A;  4YYG A;  2DVS A;  4CUT A;  1X0J A;  4A9O A;  5EK9 A;  4O78 A;  5L8T A;  5EWD A;  5D3H A;  5F3A A;  2RNY A;  5L98 A;  5FE3 A;  5FE9 A;  4N4G A;  5CUB A;  4HXR A;  3DAI A;  5FE6 A;  2F6N A;  2YEL A;  2WP1 A;  5L96 A;  4UIU A;  5DW1 A;  4AKN A;  2RI7 A;  5F36 A;  4TQN A;  5A7C A;  4OUF A;  4PS5 A;  5EP7 A;  3NXB A;  4Q0N A;  4NQM A;  4QR3 A;  1WUG A;  5D7X A;  5HQ6 A;  4F3I A;  2R0V A;  2H60 A;  5FBX A;  4NRB A;  3MQM A;  5COI A;  4Y03 A;  4NYW A;  4CUS A;  4O7A A;  5EVA A;  5F1H A;  5E9M A;  5I80 A;  4Z93 A;  4XY8 A;  4WIV A;  5TB6 A;  5L8U A;  3JVM A;  4LR6 A;  4PKL A;  5CGP A;  4TU6 A;  4BHW A;  4QBM A;  5DFD A;  4BW1 A;  4ALG A;  5A5P A;  5FH6 A;  1E6I A;  4CUR A;  2YEM A;  5FDZ A;  5HLS A;  5EV9 A;  4YY4 A;  5LVR A;  4LC2 A;  4BJX A;  5I89 A;  5FE1 A;  4YAD A;  5EIC A;  2MJV B;  4TTE A;  5CY9 A;  5FE0 A;  2GRC A;  4RVR A;  4YC9 A;  5DX4 A;  5F5Z A;  3ONI A;  4O7E A;  5CQ5 A;  3MB4 A;  5FE8 A;  5CTL A;  4YBM A;  5DLX A;  5J0D A;  3P1C A;  2WP2 A;  5DKD A;  5A85 A;  4O76 A;  4QEU A;  1WUM A;  4Q0O A;  3K2J A;  5D24 A;  4HXL A;  3U5K A;  5II1 A;  4QZS A;  4HBV A;  5LJ2 A;  3AAD A;  4UIT A;  5C87 A;  3O36 A;  4PCE A;  5KHM A;  3JVK A;  4A9K A;  4Z6H A;  4IOO A;  5EU1 A;  4YBS A;  3FKM X;  5CUD A;  4O70 A;  5AMF A;  4QSX A;  5EQ1 A;  4O71 A;  5KTU A;  2E3K A;  1JM4 B;  2I7K A;  5FE4 A;  5FFV A;  2OO1 A;  4XYA A;  5E9I A;  5EGU A;  3HMF A;  1ZS5 A;  5KTW A;  4MEP A;  4QSW A;  4TZ8 A;  4A9H A;  5DKC A;  5K29 A;  5DYU A;  4CL9 A;  5KO4 A;  4MR4 A;  5D0C A;  4YYJ A;  4MR3 A;  4PTB A;  4GPJ A;  2YQD A;  5E9V A;  3P1E A;  5ENH A;  3QZV A;  5C85 A;  3I3J A;  4HBW A;  4N4F A;  4CUQ A;  5CQT A;  2DVR A;  4XUB A;  2YYN A;  4MR5 A;  5C4Q A;  4HXM A;  5ENE A;  5IGN A;  4MR6 A;  5G4S A;  5KU3 A;  4A9N A;  4IR5 A;  4LZR A;  5EI4 A;  5I7X A;  5F1L A;  4N4I A;  2L84 A;  3O34 A;  3RCW A;  5FE2 A;  4WHU A;  5E73 A;  3LXJ A;  4NRA A;  3GG3 A;  4E96 A; 
#chains in the Genus database with same CATH topology
 4A9F A;  4XUA A;  5IGK A;  5C89 A;  4QSQ A;  5F61 A;  5H1V A;  5IBN A;  3UW9 A;  4NR6 A;  5ENI A;  5L97 A;  4Z1S A;  2OUO A;  5HQ7 A;  5H1U A;  3U5P A;  4A9I A;  4J0R A;  5IGL A;  2KTB B;  4KV4 A;  3U5M A;  4A9E A;  5ENC A;  4QSR A;  4YH3 A;  2E7N A;  3MB3 A;  3MXF A;  5HQ5 A;  4TT2 A;  5LJ0 A;  4WHW A;  4YYN A;  3UV5 A;  4LYW A;  5CS8 A;  5DYX A;  5FE5 A;  5FG6 A;  5E3D A;  3TLP A;  3UV4 A;  4J1P A;  2RNW A;  5A82 A;  5LVQ A;  4KCX A;  5IGM A;  4QSP A;  5CQ6 A;  4YYM A;  4A9M A;  3SVG A;  2L5E A;  5I1Q A;  5HCL A;  4ZW1 A;  5CP5 A;  3UVD A;  4NRC A;  4UYH A;  4QST A;  5EWV A;  3P1F A;  5LUU A;  4UIX A;  5JI8 A;  5DYA A;  1ZKR A;  4YAB A;  3D1B A;  3JVL A;  5CQA A;  5G4R A;  5HEM A;  4IR3 A;  5CUG A;  4YAX A;  5CQ3 A;  4HXN A;  5HM0 A;  5EWC A;  4XY9 A;  2D82 A;  4NR7 A;  4YY6 A;  3P1D A;  1JSP B;  5DLZ A;  5A5R A;  4DON A;  2E7O A;  4N4H A;  3UV2 A;  5H1T A;  5BT5 A;  4YYI A;  4QEW A;  5EPR A;  4UIV A;  2L85 A;  5CQ8 A;  5D3L A;  3LJW A;  4QUU A;  4UIY A;  4O7C A;  5E0R A;  5DY7 A;  4QYL A;  4O72 A;  5D3S A;  4QSV A;  3U5J A;  4TZ2 A;  5IG6 A;  5I88 A;  4MEQ A;  4HXS A;  5ACY A;  4HXP A;  3LQH A;  4QR4 A;  5DFC A;  4J0S A;  5BT4 A;  3MUL A;  5E9Y A;  5ENB A;  5E9K A;  3U5L A;  4LZS A;  4O77 A;  4QYD A;  5EPB A;  4HBX A;  4TU4 A;  5D3N A;  5EPS A;  3G0L A;  4CFK A;  5FB0 A;  5D3J A;  5LJ1 A;  3VKH A;  4QEV A;  5BT3 A;  2YEK A;  4QC1 A;  2R10 A;  5CQ7 A;  4YYH A;  5F60 A;  5D3T A;  3G0J A;  4LRG A;  5ETB A;  2N9G A;  4C66 A;  2LSP B;  4YK0 A;  4QB3 A;  4TS8 A;  5I29 A;  5DBM A;  4O75 A;  5CFW A;  4CLB A;  2R0Y A;  4LYI A;  2FSA A;  4TT4 A;  5F25 A;  5JWM A;  4PY6 A;  5EIS A;  4MEO A;  2DVV A;  5HFR A;  4BW3 A;  4NYV A;  3Q2F A;  5EM3 A;  5FH7 A;  5DFB A;  3UVY A;  4N3W A;  5D26 A;  4TT6 A;  4IR4 A;  4A9L A;  5DKH A;  5A5S A;  5D3P A;  2RO1 A;  4UIZ A;  5TCM A;  5LKU A;  3IU5 A;  4O7B A;  5CPE A;  4IOQ A;  4NS5 A;  4ZC9 A;  3O35 A;  2G4A A;  4O74 A;  5I86 A;  4LYS A;  5HJC A;  3VKG A;  3AQA A;  5E74 A;  4NYX A;  5KTX A;  2RFJ A;  3D7C A;  4QUT A;  4HXK A;  4IOR A;  2YW5 A;  4QSS A;  4NR5 A;  4C67 A;  3HMH A;  4UYD A;  2D9E A;  5CUC A;  1N72 A;  3ERR A;  5I40 A;  3SVH A;  4HXO A;  5FG4 A;  2R0S A;  4KV1 A;  4NR8 A;  3ZYU A;  4FLP A;  5ENF A;  4BW4 A;  4YYK A;  4YAT A;  5HRW A;  3JVJ A;  2DWW A;  4UYE A;  5II2 A;  5CRZ A;  5EWW A;  5E3G A;  4OGI A;  3S91 A;  5ETD A;  4QY4 A;  5F2P A;  5FE7 A;  4Z1Q A;  5FG5 A;  5C7N A;  5FH8 A;  5I7Y A;  5LKT A;  5D3R A;  4YYD A;  5AD2 A;  5D25 A;  5HFQ A;  5EWH A;  3O33 A;  4HBY A;  4IR6 A;  3UVW A;  4O7F A;  4NQN A;  4YBT A;  5CU8 A;  5A5N A;  5E7D A;  2YDW A;  4A9J A;  4NUC A;  4CUP A;  3LQJ A;  3IU6 A;  4QSU A;  4UYF A;  5C8G A;  5E9L A;  3DWY A;  2EJN A;  4QR5 A;  2I8N A;  4NUD A;  5AD3 A;  3HME A;  4AI6 A;  5A81 A;  5DW2 A;  4X2I A;  4NR4 A;  1EQF A;  3SVF A;  4QC3 A;  5F62 A;  4NXJ A;  4UYF B;  2DVQ A;  4NR9 A;  5AME A;  5CQ4 A;  5A5Q A;  4AKG A;  4AKI A;  5ENG A;  5HRX A;  2RS9 B;  5L99 A;  4AKH A;  2RNX A;  4NUE A;  4QNS A;  3S92 A;  4ALH A;  5HEN A;  4CFL A;  4LDF A;  5FFW A;  5LKX A;  3P5O A;  3Q2E A;  5HRV A;  5A83 A;  5FFY A;  5DYC A;  5LKZ A;  2NXB A;  3QZS A;  4YH4 A;  3O37 A;  4BW2 A;  5H85 A;  5ENJ A;  4Z6I A;  4J3I A;  4MEN A;  3UVX A;  4UYG A;  5I83 A;  2F6J A;  3U5N A;  5FB1 A;  5F63 A;  2OSS A;  2DKW A;  4CUU A;  4ZQL A;  3MUK A;  5CZG A;  4PCI A;  5A5O A;  3U5O A;  4LZ2 A;  3LQI A;  4OGJ A;  5EA1 A;  1F68 A;  3QZT A;  5CUA A;  4UIW A;  5IID A;  4TYL A;  5HEL A;  2DAT A;  5CRM A;  5CUE A;  4YYG A;  2DVS A;  4CUT A;  1X0J A;  4A9O A;  5EK9 A;  4O78 A;  5L8T A;  5EWD A;  5D3H A;  5F3A A;  2RNY A;  5L98 A;  5FE3 A;  5FE9 A;  4N4G A;  5CUB A;  4HXR A;  3DAI A;  5FE6 A;  2F6N A;  2YEL A;  2WP1 A;  5L96 A;  4UIU A;  5DW1 A;  4AKN A;  2RI7 A;  5F36 A;  4TQN A;  3D1D A;  5A7C A;  4OUF A;  4PS5 A;  5EP7 A;  3NXB A;  4Q0N A;  4NQM A;  4QR3 A;  1WUG A;  5D7X A;  5HQ6 A;  4F3I A;  2R0V A;  2H60 A;  5FBX A;  4NRB A;  3MQM A;  5COI A;  4Y03 A;  4NYW A;  4CUS A;  4O7A A;  5EVA A;  5F1H A;  5E9M A;  5I80 A;  4Z93 A;  4XY8 A;  4WIV A;  5TB6 A;  5L8U A;  3JVM A;  4LR6 A;  4PKL A;  5CGP A;  4TU6 A;  4BHW A;  4QBM A;  5DFD A;  4BW1 A;  4ALG A;  5A5P A;  5FH6 A;  1E6I A;  4CUR A;  2YEM A;  5FDZ A;  5HLS A;  5EV9 A;  4YY4 A;  5LVR A;  4LC2 A;  4BJX A;  5I89 A;  5FE1 A;  4YAD A;  5EIC A;  2MJV B;  4TTE A;  5CY9 A;  5FE0 A;  2GRC A;  4RVR A;  4YC9 A;  5DX4 A;  5F5Z A;  3ONI A;  4O7E A;  5CQ5 A;  3MB4 A;  5FE8 A;  5CTL A;  4YBM A;  5DLX A;  5J0D A;  3P1C A;  2WP2 A;  5DKD A;  5A85 A;  4O76 A;  4QEU A;  1WUM A;  4Q0O A;  3K2J A;  5D24 A;  4HXL A;  3U5K A;  5II1 A;  4QZS A;  4HBV A;  5LJ2 A;  3AAD A;  4UIT A;  5C87 A;  3O36 A;  4PCE A;  5KHM A;  3JVK A;  4A9K A;  4Z6H A;  4IOO A;  5EU1 A;  4YBS A;  3FKM X;  5CUD A;  4O70 A;  5AMF A;  4QSX A;  5EQ1 A;  4O71 A;  5KTU A;  2E3K A;  1JM4 B;  2I7K A;  5FE4 A;  5FFV A;  2OO1 A;  4XYA A;  5E9I A;  5EGU A;  3HMF A;  1ZS5 A;  1PUO A;  5KTW A;  4MEP A;  4QSW A;  4TZ8 A;  4A9H A;  5DKC A;  5K29 A;  5DYU A;  4CL9 A;  5KO4 A;  4MR4 A;  5D0C A;  4YYJ A;  4MR3 A;  4PTB A;  4GPJ A;  2YQD A;  5E9V A;  3P1E A;  5ENH A;  3QZV A;  5C85 A;  3I3J A;  4HBW A;  4N4F A;  4CUQ A;  5CQT A;  2DVR A;  4XUB A;  2YYN A;  4MR5 A;  5C4Q A;  4HXM A;  5ENE A;  5IGN A;  4MR6 A;  5G4S A;  5KU3 A;  4A9N A;  4IR5 A;  4LZR A;  5EI4 A;  5I7X A;  5F1L A;  4N4I A;  2L84 A;  3O34 A;  3RCW A;  5FE2 A;  4WHU A;  5E73 A;  3LXJ A;  4NRA A;  3GG3 A;  4E96 A; 
#chains in the Genus database with same CATH homology
 4A9F A;  4XUA A;  5IGK A;  5C89 A;  4QSQ A;  5F61 A;  5H1V A;  5IBN A;  3UW9 A;  4NR6 A;  5ENI A;  5L97 A;  4Z1S A;  2OUO A;  5HQ7 A;  5H1U A;  3U5P A;  4A9I A;  4J0R A;  5IGL A;  2KTB B;  4KV4 A;  3U5M A;  4A9E A;  5ENC A;  4QSR A;  4YH3 A;  2E7N A;  3MB3 A;  3MXF A;  5HQ5 A;  4TT2 A;  5LJ0 A;  4WHW A;  4YYN A;  3UV5 A;  4LYW A;  5CS8 A;  5DYX A;  5FE5 A;  5FG6 A;  5E3D A;  3TLP A;  3UV4 A;  4J1P A;  2RNW A;  5A82 A;  5LVQ A;  4KCX A;  5IGM A;  4QSP A;  5CQ6 A;  4YYM A;  4A9M A;  3SVG A;  2L5E A;  5I1Q A;  5HCL A;  4ZW1 A;  5CP5 A;  3UVD A;  4NRC A;  4UYH A;  4QST A;  5EWV A;  3P1F A;  5LUU A;  4UIX A;  5JI8 A;  5DYA A;  4YAB A;  3JVL A;  5CQA A;  5G4R A;  5HEM A;  4IR3 A;  5CUG A;  4YAX A;  5CQ3 A;  4HXN A;  5HM0 A;  5EWC A;  4XY9 A;  2D82 A;  4NR7 A;  4YY6 A;  3P1D A;  1JSP B;  5DLZ A;  5A5R A;  4DON A;  2E7O A;  4N4H A;  3UV2 A;  5H1T A;  5BT5 A;  4YYI A;  4QEW A;  5EPR A;  4UIV A;  2L85 A;  5CQ8 A;  5D3L A;  3LJW A;  4QUU A;  4UIY A;  4O7C A;  5E0R A;  5DY7 A;  4QYL A;  4O72 A;  5D3S A;  4QSV A;  3U5J A;  4TZ2 A;  5IG6 A;  5I88 A;  4MEQ A;  4HXS A;  5ACY A;  4HXP A;  3LQH A;  4QR4 A;  5DFC A;  4J0S A;  5BT4 A;  3MUL A;  5E9Y A;  5ENB A;  5E9K A;  3U5L A;  4LZS A;  4O77 A;  4QYD A;  5EPB A;  4HBX A;  4TU4 A;  5D3N A;  5EPS A;  3G0L A;  4CFK A;  5FB0 A;  5D3J A;  5LJ1 A;  4QEV A;  5BT3 A;  2YEK A;  4QC1 A;  2R10 A;  5CQ7 A;  4YYH A;  5F60 A;  5D3T A;  3G0J A;  4LRG A;  5ETB A;  2N9G A;  4C66 A;  2LSP B;  4YK0 A;  4QB3 A;  4TS8 A;  5I29 A;  5DBM A;  4O75 A;  5CFW A;  4CLB A;  2R0Y A;  4LYI A;  2FSA A;  4TT4 A;  5F25 A;  5JWM A;  4PY6 A;  5EIS A;  4MEO A;  2DVV A;  5HFR A;  4BW3 A;  4NYV A;  3Q2F A;  5EM3 A;  5FH7 A;  5DFB A;  3UVY A;  4N3W A;  5D26 A;  4TT6 A;  4IR4 A;  4A9L A;  5DKH A;  5A5S A;  5D3P A;  2RO1 A;  4UIZ A;  5TCM A;  5LKU A;  3IU5 A;  4O7B A;  5CPE A;  4IOQ A;  4NS5 A;  4ZC9 A;  3O35 A;  2G4A A;  4O74 A;  5I86 A;  4LYS A;  5HJC A;  3AQA A;  5E74 A;  4NYX A;  5KTX A;  2RFJ A;  3D7C A;  4QUT A;  4HXK A;  4IOR A;  2YW5 A;  4QSS A;  4NR5 A;  4C67 A;  3HMH A;  4UYD A;  2D9E A;  5CUC A;  1N72 A;  5I40 A;  3SVH A;  4HXO A;  5FG4 A;  2R0S A;  4KV1 A;  4NR8 A;  3ZYU A;  4FLP A;  5ENF A;  4BW4 A;  4YYK A;  4YAT A;  5HRW A;  3JVJ A;  2DWW A;  4UYE A;  5II2 A;  5CRZ A;  5EWW A;  5E3G A;  4OGI A;  3S91 A;  5ETD A;  4QY4 A;  5F2P A;  5FE7 A;  4Z1Q A;  5FG5 A;  5C7N A;  5FH8 A;  5I7Y A;  5LKT A;  5D3R A;  4YYD A;  5AD2 A;  5D25 A;  5HFQ A;  5EWH A;  3O33 A;  4HBY A;  4IR6 A;  3UVW A;  4O7F A;  4NQN A;  4YBT A;  5CU8 A;  5A5N A;  5E7D A;  2YDW A;  4A9J A;  4NUC A;  4CUP A;  3LQJ A;  3IU6 A;  4QSU A;  4UYF A;  5C8G A;  5E9L A;  3DWY A;  4QR5 A;  2I8N A;  4NUD A;  5AD3 A;  3HME A;  5A81 A;  5DW2 A;  4X2I A;  4NR4 A;  1EQF A;  3SVF A;  4QC3 A;  5F62 A;  4NXJ A;  4UYF B;  2DVQ A;  4NR9 A;  5AME A;  5CQ4 A;  5A5Q A;  5ENG A;  5HRX A;  2RS9 B;  5L99 A;  2RNX A;  4NUE A;  4QNS A;  3S92 A;  4ALH A;  5HEN A;  4CFL A;  4LDF A;  5FFW A;  5LKX A;  3P5O A;  3Q2E A;  5HRV A;  5A83 A;  5FFY A;  5DYC A;  5LKZ A;  2NXB A;  3QZS A;  4YH4 A;  3O37 A;  4BW2 A;  5H85 A;  5ENJ A;  4Z6I A;  4J3I A;  4MEN A;  3UVX A;  4UYG A;  5I83 A;  2F6J A;  3U5N A;  5FB1 A;  5F63 A;  2OSS A;  2DKW A;  4CUU A;  4ZQL A;  3MUK A;  5CZG A;  4PCI A;  5A5O A;  3U5O A;  4LZ2 A;  3LQI A;  4OGJ A;  5EA1 A;  1F68 A;  3QZT A;  5CUA A;  4UIW A;  5IID A;  4TYL A;  5HEL A;  2DAT A;  5CRM A;  5CUE A;  4YYG A;  2DVS A;  4CUT A;  1X0J A;  4A9O A;  5EK9 A;  4O78 A;  5L8T A;  5EWD A;  5D3H A;  5F3A A;  2RNY A;  5L98 A;  5FE3 A;  5FE9 A;  4N4G A;  5CUB A;  4HXR A;  3DAI A;  5FE6 A;  2F6N A;  2YEL A;  2WP1 A;  5L96 A;  4UIU A;  5DW1 A;  4AKN A;  2RI7 A;  5F36 A;  4TQN A;  5A7C A;  4OUF A;  4PS5 A;  5EP7 A;  3NXB A;  4Q0N A;  4NQM A;  4QR3 A;  1WUG A;  5D7X A;  5HQ6 A;  4F3I A;  2R0V A;  2H60 A;  5FBX A;  4NRB A;  3MQM A;  5COI A;  4Y03 A;  4NYW A;  4CUS A;  4O7A A;  5EVA A;  5F1H A;  5E9M A;  5I80 A;  4Z93 A;  4XY8 A;  4WIV A;  5TB6 A;  5L8U A;  3JVM A;  4LR6 A;  4PKL A;  5CGP A;  4TU6 A;  4BHW A;  4QBM A;  5DFD A;  4BW1 A;  4ALG A;  5A5P A;  5FH6 A;  1E6I A;  4CUR A;  2YEM A;  5FDZ A;  5HLS A;  5EV9 A;  4YY4 A;  5LVR A;  4LC2 A;  4BJX A;  5I89 A;  5FE1 A;  4YAD A;  5EIC A;  2MJV B;  4TTE A;  5CY9 A;  5FE0 A;  2GRC A;  4RVR A;  4YC9 A;  5DX4 A;  5F5Z A;  3ONI A;  4O7E A;  5CQ5 A;  3MB4 A;  5FE8 A;  5CTL A;  4YBM A;  5DLX A;  5J0D A;  3P1C A;  2WP2 A;  5DKD A;  5A85 A;  4O76 A;  4QEU A;  1WUM A;  4Q0O A;  3K2J A;  5D24 A;  4HXL A;  3U5K A;  5II1 A;  4QZS A;  4HBV A;  5LJ2 A;  3AAD A;  4UIT A;  5C87 A;  3O36 A;  4PCE A;  5KHM A;  3JVK A;  4A9K A;  4Z6H A;  4IOO A;  5EU1 A;  4YBS A;  3FKM X;  5CUD A;  4O70 A;  5AMF A;  4QSX A;  5EQ1 A;  4O71 A;  5KTU A;  2E3K A;  1JM4 B;  2I7K A;  5FE4 A;  5FFV A;  2OO1 A;  4XYA A;  5E9I A;  5EGU A;  3HMF A;  1ZS5 A;  5KTW A;  4MEP A;  4QSW A;  4TZ8 A;  4A9H A;  5DKC A;  5K29 A;  5DYU A;  4CL9 A;  5KO4 A;  4MR4 A;  5D0C A;  4YYJ A;  4MR3 A;  4PTB A;  4GPJ A;  2YQD A;  5E9V A;  3P1E A;  5ENH A;  3QZV A;  5C85 A;  3I3J A;  4HBW A;  4N4F A;  4CUQ A;  5CQT A;  2DVR A;  4XUB A;  2YYN A;  4MR5 A;  5C4Q A;  4HXM A;  5ENE A;  5IGN A;  4MR6 A;  5G4S A;  5KU3 A;  4A9N A;  4IR5 A;  4LZR A;  5EI4 A;  5I7X A;  5F1L A;  4N4I A;  2L84 A;  3O34 A;  3RCW A;  5FE2 A;  4WHU A;  5E73 A;  3LXJ A;  4NRA A;  3GG3 A;  4E96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...