5EWVA

Crystal structure of the human brpf1 bromodomain in complex with seed20
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Crystal structure of the human BRPF1 bromodomain in complex with SEED20
rcsb
source organism Homo sapiens
total genus 39
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewvA00
4NYWA 5FFVA 4A9LA 4YYGA 5CP5A 5E9KA 4A9HA 5FG4A 5FE6A 4O75A 5FH6A 5D3JA 4KCXA 5HEMA 2RNXA 5FB0A 5ENCA 5ENHA 5LUUA 3ONIA 5ENEA 4ZC9A 4O71A 4HBVA 5A7CA 4IR3A 5F61A 4QSXA 4QYDA 1N72A 4O74A 5HQ5A 3LQJA 5H1TA 5CUBA 2E7NA 4TU4A 4MEPA 5A82A 3HMFA 2KTBB 5LKZA 3JVKA 4NR7A 3MB4A 4QUUA 4CUTA 5ENJA 4ZW1A 4MENA 5II2A 4QB3A 5LVQA 4QNSA 5CRMA 5EM3A 3UW9A 3Q2EA 2N9GA 5L96A 4O77A 5DLZA 5EWVA 5E9VA 5EICA 2I8NA 4YYIA 5FE4A 1WUMA 4LYSA 5I40A 4NR6A 5EWCA 5A5NA 5EPSA 5KTXA 4IOQA 4Z1QA 3QZSA 4N4FA 4TS8A 5HFQA 4NR4A 5EU1A 4ALGA 2I7KA 4UYFA 5HQ6A 5DY7A 5HFRA 4J0RA 3S92A 4OGIA 5A5PA 3D7CA 5CZGA 5I29A 5D3LA 5CQ8A 5IGLA 5FG5A 2RS9B 5BT5A 3SVFA 3ZYUA 3P1FA 4BHWA 2YEKA 5D3SA 4A9IA 4QR3A 3MUKA 4YYHA 3LXJA 5FFWA 5D3RA 3IU6A 4XY8A 5EWWA 4DONA 4NR8A 5AD2A 5FE2A 4UIYA 5DW2A 5E9LA 4F3IA 3QZTA 2R0VA 3P1EA 5L8TA 5C7NA 4OGJA 5IBNA 4ALHA 5C89A 5D3PA 4LR6A 4QR4A 4LYWA 5D24A 2YQDA 3I3JA 5HRVA 5F3AA 5HQ7A 3P1CA 2WP2A 4QSWA 4CFKA 5DX4A 2R10A 2LSPB 5I1QA 1F68A 4UYDA 4LYIA 5FB1A 4N3WA 5I80A 4MEOA 5FBXA 3QZVA 5DYXA 1EQFA 5E3GA 4BW2A 4NRAA 5CFWA 3UV4A 4FLPA 5IGKA 3U5LA 2RI7A 4WIVA 5E73A 2RFJA 5EA1A 4NUCA 5D3HA 5AD3A 4YH4A 5CQTA 5C85A 4Y03A 3P5OA 4O72A 5HJCA 4HXLA 4O70A 5EWHA 4E96A 3O33A 4WHWA 4J3IA 4KV1A 5KTWA 4O76A 5F62A 4UYHA 2YEMA 5E3DA 4UYFB 5FH7A 5G4SA 5C8GA 5A85A 4QEUA 4QR5A 5C87A 1X0JA 4LZRA 4QSSA 5ENGA 3U5KA 3LQHA 4LDFA 4MR5A 5D26A 4A9MA 4NQNA 4Q0OA 3MQMA 4N4HA 5H1VA 1WUGA 4A9EA 4WHUA 5LJ1A 2R0SA 5DYCA 4CUSA 2L5EA 3DAIA 4Z6IA 5KU3A 5FE0A 2D9EA 2NXBA 4HXMA 4IR6A 4Z93A 5FE5A 4PS5A 4TQNA 5HRXA 5I7YA 5JWMA 5E9YA 5HCLA 2RNWA 5IGNA 3DWYA 5FE3A 4CUQA 5TCMA 5F1LA 4NRBA 5JI8A 5EPBA 5IIDA 5CUCA 4HXNA 2OUOA 5L97A 4N4GA 4MEQA 5I86A 5FG6A 2FSAA 3U5NA 4N4IA 5CQAA 4CL9A 5E74A 4OUFA 4UITA 5CGPA 5CUEA 5D3NA 4TZ8A 5CRZA 4TT4A 5FE9A 2L85A 5DLXA 5DKCA 4YAXA 4O7BA 4XUAA 4HBYA 4PCEA 4YYMA 4NUDA 1JM4B 3S91A 4A9KA 5F2PA 5EQ1A 5CQ3A 5CPEA 4QSQA 5DKDA 3SVHA 5CUDA 5J0DA 4NR9A 4BW4A 4QYLA 2YDWA 1E6IA 5LKTA 2DVRA 4PTBA 4NUEA 5AMFA 5L99A 5HLSA 2F6NA 4A9OA 4HXPA 4UYEA 4YADA 2OSSA 5D25A 5F25A 4HXSA 5II1A 4UYGA 5F63A 4NRCA 5H1UA 4QSUA 4KV4A 3U5PA 4PKLA 3O36A 5E0RA 4YYDA 4O78A 3SVGA 3IU5A 5EK9A 5CQ4A 4CFLA 5CS8A 2DVSA 5FFYA 5H85A 4YBMA 5I83A 4QY4A 4PCIA 5CUGA 5CU8A 5ENBA 4YBTA 4TT2A 2OO1A 2D82A 4TU6A 2R0YA 4YH3A 2WP1A 4NXJA 3MULA 5D3TA 5ACYA 4TZ2A 4A9FA 4YYNA 2DWWA 5COIA 3UV2A 5CQ6A 5F60A 5K29A 4YBSA 5E7DA 3AQAA 4LC2A 5EI4A 4QC3A 2MJVB 3AADA 5HELA 5LKXA 5ENFA 4YC9A 5A81A 5FH8A 5CQ5A 5A5RA 3G0LA 4YK0A 4QEVA 4IORA 5DFDA 4CUUA 5C4QA 4O7AA 3JVMA 4NQMA 5I89A 1ZS5A 5LVRA 4J0SA 2DKWA 5I7XA 5BT3A 5FDZA 5EP7A 3P1DA 3HMEA 3UV5A 5L98A 5BT4A 5F36A 4YYKA 5LKUA 5CTLA 2H60A 4YATA 3TLPA 2DATA 3FKMX 5D7XA 5KTUA 5EV9A 4TT6A 3HMHA 4IR5A 5A83A 2RNYA 4NYVA 5DFCA 5HRWA 3O37A 4Q0NA 4QUTA 4C67A 3UVWA 3U5OA 2G4AA 5DBMA 4XY9A 4NS5A 5DYUA 4TTEA 4QC1A 2YELA 4Z1SA 4A9JA 3JVLA 5EGUA 2DVVA 3JVJA 4LRGA 3O35A 5DKHA 3G0JA 3NXBA 4C66A 2RO1A 5I88A 2E7OA 5ETDA 4Z6HA 4QSTA 4O7EA 4NYXA 4O7FA 4QSPA 4TYLA 5IG6A 5FE8A 4YABA 5TB6A 4YYJA 4ZQLA 4X2IA 5A5QA 5LJ0A 4MR4A 4UIZA 5A5SA 4MR6A 4CLBA 5LJ2A 4HBXA 2YW5A 4IOOA 5FE1A 4BJXA 5HM0A 1JSPB 5CUAA 5F5ZA 3LJWA 3MB3A 4IR4A 5DFBA 2YYNA 5AMEA 4QSRA 2DVQA 4J1PA 4QSVA 4HXKA 4RVRA 2L84A 4AKNA 5A5OA 4QEWA 3K2JA 4XYAA 5FE7A 5D0CA 5E9IA 5EPRA 3RCWA 4PY6A 4UIXA 5ENIA 3U5MA 5KHMA 2F6JA 3UVXA 5F1HA 3U5JA 5L8UA 4UIWA 5HENA 5DW1A 5ETBA 4HBWA 5EVAA 4O7CA 3O34A 4LZSA 4QZSA 4A9NA 5E9MA 5EWDA 4CUPA 5KO4A 2GRCA 4NR5A 3LQIA 4UIVA 4LZ2A 4BW1A 5G4RA 4QBMA 5CQ7A 4HXRA 2E3KA 5DYAA 5EISA 4YY4A 4UIUA 3Q2FA 4XUBA 3UVDA 3MXFA 4CURA 5IGMA 3GG3A 4GPJA 4HXOA 3UVYA 4BW3A 5CY9A 4MR3A 4YY6A
chains in the Genus database with same CATH superfamily
4NYWA 5FFVA 4A9LA 4YYGA 4AKGA 5CP5A 5E9KA 4A9HA 5FG4A 5FE6A 4O75A 5FH6A 5D3JA 4KCXA 5HEMA 2RNXA 5FB0A 5ENCA 5ENHA 5LUUA 3ONIA 5ENEA 4ZC9A 4O71A 4HBVA 5A7CA 4IR3A 5F61A 4QSXA 4QYDA 1N72A 4O74A 5HQ5A 3LQJA 5H1TA 5CUBA 2E7NA 4TU4A 4MEPA 5A82A 3HMFA 2KTBB 5LKZA 3JVKA 4NR7A 3MB4A 4QUUA 4CUTA 5ENJA 4ZW1A 4MENA 5II2A 4QB3A 5LVQA 4QNSA 5CRMA 5EM3A 3UW9A 3Q2EA 2N9GA 5L96A 4O77A 5DLZA 5EWVA 5E9VA 5EICA 2I8NA 4YYIA 5FE4A 1WUMA 4LYSA 5I40A 4NR6A 5EWCA 5A5NA 5EPSA 5KTXA 4IOQA 4Z1QA 3QZSA 4N4FA 4TS8A 5HFQA 4NR4A 5EU1A 4ALGA 3VKGA 2I7KA 4UYFA 5HQ6A 5DY7A 5HFRA 4J0RA 3S92A 4OGIA 5A5PA 3D7CA 5CZGA 5I29A 5D3LA 5CQ8A 5IGLA 5FG5A 2RS9B 5BT5A 3SVFA 3ZYUA 3P1FA 4BHWA 2YEKA 5D3SA 4A9IA 4QR3A 3MUKA 4YYHA 3LXJA 5FFWA 5D3RA 3IU6A 4XY8A 5EWWA 4DONA 4NR8A 5AD2A 5FE2A 4UIYA 5DW2A 5E9LA 4F3IA 3QZTA 2R0VA 3P1EA 2EJNA 5L8TA 5C7NA 4OGJA 5IBNA 4ALHA 5C89A 5D3PA 4LR6A 4QR4A 4LYWA 5D24A 2YQDA 3I3JA 5HRVA 5F3AA 5HQ7A 3P1CA 2WP2A 4QSWA 4CFKA 5DX4A 2R10A 2LSPB 5I1QA 1F68A 4UYDA 4LYIA 5FB1A 4N3WA 5I80A 4MEOA 5FBXA 3D1BA 3QZVA 5DYXA 1EQFA 5E3GA 4BW2A 4NRAA 5CFWA 3UV4A 4FLPA 5IGKA 3U5LA 2RI7A 4WIVA 5E73A 2RFJA 5EA1A 4NUCA 5D3HA 5AD3A 4YH4A 5CQTA 5C85A 4Y03A 3P5OA 4O72A 5HJCA 4HXLA 4O70A 5EWHA 4E96A 3O33A 4WHWA 4J3IA 4KV1A 5KTWA 4O76A 5F62A 4UYHA 2YEMA 5E3DA 4UYFB 5FH7A 5G4SA 5C8GA 5A85A 4QEUA 4QR5A 5C87A 1X0JA 4LZRA 4QSSA 5ENGA 3U5KA 3LQHA 4LDFA 4MR5A 5D26A 4A9MA 4NQNA 4Q0OA 3MQMA 4N4HA 5H1VA 1WUGA 4A9EA 4WHUA 5LJ1A 2R0SA 5DYCA 4CUSA 2L5EA 3DAIA 4Z6IA 5KU3A 5FE0A 2D9EA 2NXBA 4HXMA 4IR6A 4Z93A 5FE5A 4PS5A 4TQNA 5HRXA 5I7YA 5JWMA 5E9YA 5HCLA 2RNWA 5IGNA 3DWYA 5FE3A 4CUQA 5TCMA 5F1LA 4NRBA 5JI8A 5EPBA 5IIDA 5CUCA 4HXNA 2OUOA 5L97A 4N4GA 4MEQA 5I86A 5FG6A 2FSAA 3U5NA 4N4IA 5CQAA 4CL9A 5E74A 4OUFA 4UITA 5CGPA 5CUEA 5D3NA 4TZ8A 5CRZA 4TT4A 5FE9A 2L85A 5DLXA 5DKCA 4YAXA 4O7BA 4XUAA 4HBYA 4PCEA 4YYMA 4NUDA 1JM4B 3S91A 4A9KA 5F2PA 5EQ1A 5CQ3A 5CPEA 4QSQA 5DKDA 3SVHA 5CUDA 5J0DA 1ZKRA 4NR9A 4BW4A 4QYLA 2YDWA 1E6IA 5LKTA 2DVRA 4PTBA 4NUEA 5AMFA 5L99A 5HLSA 2F6NA 4A9OA 4HXPA 4UYEA 4YADA 1PUOA 2OSSA 5D25A 5F25A 4HXSA 5II1A 4UYGA 5F63A 4NRCA 5H1UA 4QSUA 4KV4A 3U5PA 4PKLA 3O36A 5E0RA 4YYDA 4O78A 3SVGA 3IU5A 5EK9A 5CQ4A 4CFLA 5CS8A 2DVSA 5FFYA 5H85A 4YBMA 5I83A 4QY4A 4PCIA 5CUGA 5CU8A 5ENBA 4YBTA 4TT2A 2OO1A 2D82A 4TU6A 2R0YA 4YH3A 2WP1A 4NXJA 3MULA 5D3TA 5ACYA 4TZ2A 4A9FA 4YYNA 2DWWA 5COIA 3UV2A 5CQ6A 5F60A 5K29A 4YBSA 5E7DA 3AQAA 4LC2A 5EI4A 4QC3A 2MJVB 3AADA 5HELA 5LKXA 5ENFA 4YC9A 5A81A 5FH8A 5CQ5A 5A5RA 3G0LA 4YK0A 4QEVA 4IORA 5DFDA 4CUUA 5C4QA 4O7AA 3JVMA 4NQMA 5I89A 1ZS5A 5LVRA 4J0SA 2DKWA 5I7XA 5BT3A 5FDZA 5EP7A 3P1DA 3HMEA 3UV5A 5L98A 5BT4A 5F36A 4YYKA 5LKUA 5CTLA 2H60A 4YATA 3TLPA 4AKHA 2DATA 3FKMX 5D7XA 5KTUA 5EV9A 4TT6A 3HMHA 4IR5A 5A83A 2RNYA 4NYVA 5DFCA 5HRWA 3O37A 3D1DA 4Q0NA 4QUTA 4C67A 4AKIA 3UVWA 3U5OA 2G4AA 5DBMA 4XY9A 4NS5A 5DYUA 4TTEA 4QC1A 2YELA 4Z1SA 4A9JA 3JVLA 5EGUA 2DVVA 3JVJA 4LRGA 3O35A 5DKHA 3G0JA 3NXBA 4C66A 2RO1A 5I88A 2E7OA 5ETDA 4Z6HA 3ERRA 4QSTA 4O7EA 4NYXA 4O7FA 4QSPA 4TYLA 5IG6A 5FE8A 4YABA 5TB6A 4YYJA 4ZQLA 4X2IA 5A5QA 5LJ0A 4MR4A 4UIZA 5A5SA 4MR6A 4CLBA 5LJ2A 4HBXA 2YW5A 4IOOA 5FE1A 4BJXA 5HM0A 1JSPB 5CUAA 4AI6A 5F5ZA 3LJWA 3MB3A 4IR4A 5DFBA 2YYNA 5AMEA 4QSRA 2DVQA 4J1PA 4QSVA 4HXKA 4RVRA 2L84A 4AKNA 5A5OA 4QEWA 3K2JA 4XYAA 5FE7A 5D0CA 5E9IA 5EPRA 3RCWA 4PY6A 4UIXA 5ENIA 3U5MA 5KHMA 2F6JA 3UVXA 5F1HA 3U5JA 5L8UA 4UIWA 5HENA 5DW1A 5ETBA 4HBWA 5EVAA 4O7CA 3O34A 4LZSA 4QZSA 4A9NA 5E9MA 3VKHA 5EWDA 4CUPA 5KO4A 2GRCA 4NR5A 3LQIA 4UIVA 4LZ2A 4BW1A 5G4RA 4QBMA 5CQ7A 4HXRA 2E3KA 5DYAA 5EISA 4YY4A 4UIUA 3Q2FA 4XUBA 3UVDA 3MXFA 4CURA 5IGMA 3GG3A 4GPJA 4HXOA 3UVYA 4BW3A 5CY9A 4MR3A 4YY6A
chains in the Genus database with same CATH topology
4NYWA 5FFVA 4A9LA 4YYGA 5CP5A 5E9KA 4A9HA 5FG4A 5FE6A 4O75A 5FH6A 5D3JA 4KCXA 5HEMA 2RNXA 5FB0A 5ENCA 5ENHA 5LUUA 3ONIA 5ENEA 4ZC9A 4O71A 4HBVA 5A7CA 4IR3A 5F61A 4QSXA 4QYDA 1N72A 4O74A 5HQ5A 3LQJA 5H1TA 5CUBA 2E7NA 4TU4A 4MEPA 5A82A 3HMFA 2KTBB 5LKZA 3JVKA 4NR7A 3MB4A 4QUUA 4CUTA 5ENJA 4ZW1A 4MENA 5II2A 4QB3A 5LVQA 4QNSA 5CRMA 5EM3A 3UW9A 3Q2EA 2N9GA 5L96A 4O77A 5DLZA 5EWVA 5E9VA 5EICA 2I8NA 4YYIA 5FE4A 1WUMA 4LYSA 5I40A 4NR6A 5EWCA 5A5NA 5EPSA 5KTXA 4IOQA 4Z1QA 3QZSA 4N4FA 4TS8A 5HFQA 4NR4A 5EU1A 4ALGA 2I7KA 4UYFA 5HQ6A 5DY7A 5HFRA 4J0RA 3S92A 4OGIA 5A5PA 3D7CA 5CZGA 5I29A 5D3LA 5CQ8A 5IGLA 5FG5A 2RS9B 5BT5A 3SVFA 3ZYUA 3P1FA 4BHWA 2YEKA 5D3SA 4A9IA 4QR3A 3MUKA 4YYHA 3LXJA 5FFWA 5D3RA 3IU6A 4XY8A 5EWWA 4DONA 4NR8A 5AD2A 5FE2A 4UIYA 5DW2A 5E9LA 4F3IA 3QZTA 2R0VA 3P1EA 5L8TA 5C7NA 4OGJA 5IBNA 4ALHA 5C89A 5D3PA 4LR6A 4QR4A 4LYWA 5D24A 2YQDA 3I3JA 5HRVA 5F3AA 5HQ7A 3P1CA 2WP2A 4QSWA 4CFKA 5DX4A 2R10A 2LSPB 5I1QA 1F68A 4UYDA 4LYIA 5FB1A 4N3WA 5I80A 4MEOA 5FBXA 3QZVA 5DYXA 1EQFA 5E3GA 4BW2A 4NRAA 5CFWA 3UV4A 4FLPA 5IGKA 3U5LA 2RI7A 4WIVA 5E73A 2RFJA 5EA1A 4NUCA 5D3HA 5AD3A 4YH4A 5CQTA 5C85A 4Y03A 3P5OA 4O72A 5HJCA 4HXLA 4O70A 5EWHA 4E96A 3O33A 4WHWA 4J3IA 4KV1A 5KTWA 4O76A 5F62A 4UYHA 2YEMA 5E3DA 4UYFB 5FH7A 5G4SA 5C8GA 5A85A 4QEUA 4QR5A 5C87A 1X0JA 4LZRA 4QSSA 5ENGA 3U5KA 3LQHA 4LDFA 4MR5A 5D26A 4A9MA 4NQNA 4Q0OA 3MQMA 4N4HA 5H1VA 1WUGA 4A9EA 4WHUA 5LJ1A 2R0SA 5DYCA 4CUSA 2L5EA 3DAIA 4Z6IA 5KU3A 5FE0A 2D9EA 2NXBA 4HXMA 4IR6A 4Z93A 5FE5A 4PS5A 4TQNA 5HRXA 5I7YA 5JWMA 5E9YA 5HCLA 2RNWA 5IGNA 3DWYA 5FE3A 4CUQA 5TCMA 5F1LA 4NRBA 5JI8A 5EPBA 5IIDA 5CUCA 4HXNA 2OUOA 5L97A 4N4GA 4MEQA 5I86A 5FG6A 2FSAA 3U5NA 4N4IA 5CQAA 4CL9A 5E74A 4OUFA 4UITA 5CGPA 5CUEA 5D3NA 4TZ8A 5CRZA 4TT4A 5FE9A 2L85A 5DLXA 5DKCA 4YAXA 4O7BA 4XUAA 4HBYA 4PCEA 4YYMA 4NUDA 1JM4B 3S91A 4A9KA 5F2PA 5EQ1A 5CQ3A 5CPEA 4QSQA 5DKDA 3SVHA 5CUDA 5J0DA 4NR9A 4BW4A 4QYLA 2YDWA 1E6IA 5LKTA 2DVRA 4PTBA 4NUEA 5AMFA 5L99A 5HLSA 2F6NA 4A9OA 4HXPA 4UYEA 4YADA 2OSSA 5D25A 5F25A 4HXSA 5II1A 4UYGA 5F63A 4NRCA 5H1UA 4QSUA 4KV4A 3U5PA 4PKLA 3O36A 5E0RA 4YYDA 4O78A 3SVGA 3IU5A 5EK9A 5CQ4A 4CFLA 5CS8A 2DVSA 5FFYA 5H85A 4YBMA 5I83A 4QY4A 4PCIA 5CUGA 5CU8A 5ENBA 4YBTA 4TT2A 2OO1A 2D82A 4TU6A 2R0YA 4YH3A 2WP1A 4NXJA 3MULA 5D3TA 5ACYA 4TZ2A 4A9FA 4YYNA 2DWWA 5COIA 3UV2A 5CQ6A 5F60A 5K29A 4YBSA 5E7DA 3AQAA 4LC2A 5EI4A 4QC3A 2MJVB 3AADA 5HELA 5LKXA 5ENFA 4YC9A 5A81A 5FH8A 5CQ5A 5A5RA 3G0LA 4YK0A 4QEVA 4IORA 5DFDA 4CUUA 5C4QA 4O7AA 3JVMA 4NQMA 5I89A 1ZS5A 5LVRA 4J0SA 2DKWA 5I7XA 5BT3A 5FDZA 5EP7A 3P1DA 3HMEA 3UV5A 5L98A 5BT4A 5F36A 4YYKA 5LKUA 5CTLA 2H60A 4YATA 3TLPA 2DATA 3FKMX 5D7XA 5KTUA 5EV9A 4TT6A 3HMHA 4IR5A 5A83A 2RNYA 4NYVA 5DFCA 5HRWA 3O37A 4Q0NA 4QUTA 4C67A 3UVWA 3U5OA 2G4AA 5DBMA 4XY9A 4NS5A 5DYUA 4TTEA 4QC1A 2YELA 4Z1SA 4A9JA 3JVLA 5EGUA 2DVVA 3JVJA 4LRGA 3O35A 5DKHA 3G0JA 3NXBA 4C66A 2RO1A 5I88A 2E7OA 5ETDA 4Z6HA 4QSTA 4O7EA 4NYXA 4O7FA 4QSPA 4TYLA 5IG6A 5FE8A 4YABA 5TB6A 4YYJA 4ZQLA 4X2IA 5A5QA 5LJ0A 4MR4A 4UIZA 5A5SA 4MR6A 4CLBA 5LJ2A 4HBXA 2YW5A 4IOOA 5FE1A 4BJXA 5HM0A 1JSPB 5CUAA 5F5ZA 3LJWA 3MB3A 4IR4A 5DFBA 2YYNA 5AMEA 4QSRA 2DVQA 4J1PA 4QSVA 4HXKA 4RVRA 2L84A 4AKNA 5A5OA 4QEWA 3K2JA 4XYAA 5FE7A 5D0CA 5E9IA 5EPRA 3RCWA 4PY6A 4UIXA 5ENIA 3U5MA 5KHMA 2F6JA 3UVXA 5F1HA 3U5JA 5L8UA 4UIWA 5HENA 5DW1A 5ETBA 4HBWA 5EVAA 4O7CA 3O34A 4LZSA 4QZSA 4A9NA 5E9MA 5EWDA 4CUPA 5KO4A 2GRCA 4NR5A 3LQIA 4UIVA 4LZ2A 4BW1A 5G4RA 4QBMA 5CQ7A 4HXRA 2E3KA 5DYAA 5EISA 4YY4A 4UIUA 3Q2FA 4XUBA 3UVDA 3MXFA 4CURA 5IGMA 3GG3A 4GPJA 4HXOA 3UVYA 4BW3A 5CY9A 4MR3A 4YY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYW A;  5FFV A;  4A9L A;  4YYG A;  5CP5 A;  5E9K A;  4A9H A;  5FG4 A;  5FE6 A;  4O75 A;  5FH6 A;  5D3J A;  4KCX A;  5HEM A;  2RNX A;  5FB0 A;  5ENC A;  5ENH A;  5LUU A;  3ONI A;  5ENE A;  4ZC9 A;  4O71 A;  4HBV A;  5A7C A;  4IR3 A;  5F61 A;  4QSX A;  4QYD A;  1N72 A;  4O74 A;  5HQ5 A;  3LQJ A;  5H1T A;  5CUB A;  2E7N A;  4TU4 A;  4MEP A;  5A82 A;  3HMF A;  2KTB B;  5LKZ A;  3JVK A;  4NR7 A;  3MB4 A;  4QUU A;  4CUT A;  5ENJ A;  4ZW1 A;  4MEN A;  5II2 A;  4QB3 A;  5LVQ A;  4QNS A;  5CRM A;  5EM3 A;  3UW9 A;  3Q2E A;  2N9G A;  5L96 A;  4O77 A;  5DLZ A;  5EWV A;  5E9V A;  5EIC A;  2I8N A;  4YYI A;  5FE4 A;  1WUM A;  4LYS A;  5I40 A;  4NR6 A;  5EWC A;  5A5N A;  5EPS A;  5KTX A;  4IOQ A;  4Z1Q A;  3QZS A;  4N4F A;  4TS8 A;  5HFQ A;  4NR4 A;  5EU1 A;  4ALG A;  2I7K A;  4UYF A;  5HQ6 A;  5DY7 A;  5HFR A;  4J0R A;  3S92 A;  4OGI A;  5A5P A;  3D7C A;  5CZG A;  5I29 A;  5D3L A;  5CQ8 A;  5IGL A;  5FG5 A;  2RS9 B;  5BT5 A;  3SVF A;  3ZYU A;  3P1F A;  4BHW A;  2YEK A;  5D3S A;  4A9I A;  4QR3 A;  3MUK A;  4YYH A;  3LXJ A;  5FFW A;  5D3R A;  3IU6 A;  4XY8 A;  5EWW A;  4DON A;  4NR8 A;  5AD2 A;  5FE2 A;  4UIY A;  5DW2 A;  5E9L A;  4F3I A;  3QZT A;  2R0V A;  3P1E A;  5L8T A;  5C7N A;  4OGJ A;  5IBN A;  4ALH A;  5C89 A;  5D3P A;  4LR6 A;  4QR4 A;  4LYW A;  5D24 A;  2YQD A;  3I3J A;  5HRV A;  5F3A A;  5HQ7 A;  3P1C A;  2WP2 A;  4QSW A;  4CFK A;  5DX4 A;  2R10 A;  2LSP B;  5I1Q A;  1F68 A;  4UYD A;  4LYI A;  5FB1 A;  4N3W A;  5I80 A;  4MEO A;  5FBX A;  3QZV A;  5DYX A;  1EQF A;  5E3G A;  4BW2 A;  4NRA A;  5CFW A;  3UV4 A;  4FLP A;  5IGK A;  3U5L A;  2RI7 A;  4WIV A;  5E73 A;  2RFJ A;  5EA1 A;  4NUC A;  5D3H A;  5AD3 A;  4YH4 A;  5CQT A;  5C85 A;  4Y03 A;  3P5O A;  4O72 A;  5HJC A;  4HXL A;  4O70 A;  5EWH A;  4E96 A;  3O33 A;  4WHW A;  4J3I A;  4KV1 A;  5KTW A;  4O76 A;  5F62 A;  4UYH A;  2YEM A;  5E3D A;  4UYF B;  5FH7 A;  5G4S A;  5C8G A;  5A85 A;  4QEU A;  4QR5 A;  5C87 A;  1X0J A;  4LZR A;  4QSS A;  5ENG A;  3U5K A;  3LQH A;  4LDF A;  4MR5 A;  5D26 A;  4A9M A;  4NQN A;  4Q0O A;  3MQM A;  4N4H A;  5H1V A;  1WUG A;  4A9E A;  4WHU A;  5LJ1 A;  2R0S A;  5DYC A;  4CUS A;  2L5E A;  3DAI A;  4Z6I A;  5KU3 A;  5FE0 A;  2D9E A;  2NXB A;  4HXM A;  4IR6 A;  4Z93 A;  5FE5 A;  4PS5 A;  4TQN A;  5HRX A;  5I7Y A;  5JWM A;  5E9Y A;  5HCL A;  2RNW A;  5IGN A;  3DWY A;  5FE3 A;  4CUQ A;  5TCM A;  5F1L A;  4NRB A;  5JI8 A;  5EPB A;  5IID A;  5CUC A;  4HXN A;  2OUO A;  5L97 A;  4N4G A;  4MEQ A;  5I86 A;  5FG6 A;  2FSA A;  3U5N A;  4N4I A;  5CQA A;  4CL9 A;  5E74 A;  4OUF A;  4UIT A;  5CGP A;  5CUE A;  5D3N A;  4TZ8 A;  5CRZ A;  4TT4 A;  5FE9 A;  2L85 A;  5DLX A;  5DKC A;  4YAX A;  4O7B A;  4XUA A;  4HBY A;  4PCE A;  4YYM A;  4NUD A;  1JM4 B;  3S91 A;  4A9K A;  5F2P A;  5EQ1 A;  5CQ3 A;  5CPE A;  4QSQ A;  5DKD A;  3SVH A;  5CUD A;  5J0D A;  4NR9 A;  4BW4 A;  4QYL A;  2YDW A;  1E6I A;  5LKT A;  2DVR A;  4PTB A;  4NUE A;  5AMF A;  5L99 A;  5HLS A;  2F6N A;  4A9O A;  4HXP A;  4UYE A;  4YAD A;  2OSS A;  5D25 A;  5F25 A;  4HXS A;  5II1 A;  4UYG A;  5F63 A;  4NRC A;  5H1U A;  4QSU A;  4KV4 A;  3U5P A;  4PKL A;  3O36 A;  5E0R A;  4YYD A;  4O78 A;  3SVG A;  3IU5 A;  5EK9 A;  5CQ4 A;  4CFL A;  5CS8 A;  2DVS A;  5FFY A;  5H85 A;  4YBM A;  5I83 A;  4QY4 A;  4PCI A;  5CUG A;  5CU8 A;  5ENB A;  4YBT A;  4TT2 A;  2OO1 A;  2D82 A;  4TU6 A;  2R0Y A;  4YH3 A;  2WP1 A;  4NXJ A;  3MUL A;  5D3T A;  5ACY A;  4TZ2 A;  4A9F A;  4YYN A;  2DWW A;  5COI A;  3UV2 A;  5CQ6 A;  5F60 A;  5K29 A;  4YBS A;  5E7D A;  3AQA A;  4LC2 A;  5EI4 A;  4QC3 A;  2MJV B;  3AAD A;  5HEL A;  5LKX A;  5ENF A;  4YC9 A;  5A81 A;  5FH8 A;  5CQ5 A;  5A5R A;  3G0L A;  4YK0 A;  4QEV A;  4IOR A;  5DFD A;  4CUU A;  5C4Q A;  4O7A A;  3JVM A;  4NQM A;  5I89 A;  1ZS5 A;  5LVR A;  4J0S A;  2DKW A;  5I7X A;  5BT3 A;  5FDZ A;  5EP7 A;  3P1D A;  3HME A;  3UV5 A;  5L98 A;  5BT4 A;  5F36 A;  4YYK A;  5LKU A;  5CTL A;  2H60 A;  4YAT A;  3TLP A;  2DAT A;  3FKM X;  5D7X A;  5KTU A;  5EV9 A;  4TT6 A;  3HMH A;  4IR5 A;  5A83 A;  2RNY A;  4NYV A;  5DFC A;  5HRW A;  3O37 A;  4Q0N A;  4QUT A;  4C67 A;  3UVW A;  3U5O A;  2G4A A;  5DBM A;  4XY9 A;  4NS5 A;  5DYU A;  4TTE A;  4QC1 A;  2YEL A;  4Z1S A;  4A9J A;  3JVL A;  5EGU A;  2DVV A;  3JVJ A;  4LRG A;  3O35 A;  5DKH A;  3G0J A;  3NXB A;  4C66 A;  2RO1 A;  5I88 A;  2E7O A;  5ETD A;  4Z6H A;  4QST A;  4O7E A;  4NYX A;  4O7F A;  4QSP A;  4TYL A;  5IG6 A;  5FE8 A;  4YAB A;  5TB6 A;  4YYJ A;  4ZQL A;  4X2I A;  5A5Q A;  5LJ0 A;  4MR4 A;  4UIZ A;  5A5S A;  4MR6 A;  4CLB A;  5LJ2 A;  4HBX A;  2YW5 A;  4IOO A;  5FE1 A;  4BJX A;  5HM0 A;  1JSP B;  5CUA A;  5F5Z A;  3LJW A;  3MB3 A;  4IR4 A;  5DFB A;  2YYN A;  5AME A;  4QSR A;  2DVQ A;  4J1P A;  4QSV A;  4HXK A;  4RVR A;  2L84 A;  4AKN A;  5A5O A;  4QEW A;  3K2J A;  4XYA A;  5FE7 A;  5D0C A;  5E9I A;  5EPR A;  3RCW A;  4PY6 A;  4UIX A;  5ENI A;  3U5M A;  5KHM A;  2F6J A;  3UVX A;  5F1H A;  3U5J A;  5L8U A;  4UIW A;  5HEN A;  5DW1 A;  5ETB A;  4HBW A;  5EVA A;  4O7C A;  3O34 A;  4LZS A;  4QZS A;  4A9N A;  5E9M A;  5EWD A;  4CUP A;  5KO4 A;  2GRC A;  4NR5 A;  3LQI A;  4UIV A;  4LZ2 A;  4BW1 A;  5G4R A;  4QBM A;  5CQ7 A;  4HXR A;  2E3K A;  5DYA A;  5EIS A;  4YY4 A;  4UIU A;  3Q2F A;  4XUB A;  3UVD A;  3MXF A;  4CUR A;  5IGM A;  3GG3 A;  4GPJ A;  4HXO A;  3UVY A;  4BW3 A;  5CY9 A;  4MR3 A;  4YY6 A; 
#chains in the Genus database with same CATH topology
 4NYW A;  5FFV A;  4A9L A;  4YYG A;  4AKG A;  5CP5 A;  5E9K A;  4A9H A;  5FG4 A;  5FE6 A;  4O75 A;  5FH6 A;  5D3J A;  4KCX A;  5HEM A;  2RNX A;  5FB0 A;  5ENC A;  5ENH A;  5LUU A;  3ONI A;  5ENE A;  4ZC9 A;  4O71 A;  4HBV A;  5A7C A;  4IR3 A;  5F61 A;  4QSX A;  4QYD A;  1N72 A;  4O74 A;  5HQ5 A;  3LQJ A;  5H1T A;  5CUB A;  2E7N A;  4TU4 A;  4MEP A;  5A82 A;  3HMF A;  2KTB B;  5LKZ A;  3JVK A;  4NR7 A;  3MB4 A;  4QUU A;  4CUT A;  5ENJ A;  4ZW1 A;  4MEN A;  5II2 A;  4QB3 A;  5LVQ A;  4QNS A;  5CRM A;  5EM3 A;  3UW9 A;  3Q2E A;  2N9G A;  5L96 A;  4O77 A;  5DLZ A;  5EWV A;  5E9V A;  5EIC A;  2I8N A;  4YYI A;  5FE4 A;  1WUM A;  4LYS A;  5I40 A;  4NR6 A;  5EWC A;  5A5N A;  5EPS A;  5KTX A;  4IOQ A;  4Z1Q A;  3QZS A;  4N4F A;  4TS8 A;  5HFQ A;  4NR4 A;  5EU1 A;  4ALG A;  3VKG A;  2I7K A;  4UYF A;  5HQ6 A;  5DY7 A;  5HFR A;  4J0R A;  3S92 A;  4OGI A;  5A5P A;  3D7C A;  5CZG A;  5I29 A;  5D3L A;  5CQ8 A;  5IGL A;  5FG5 A;  2RS9 B;  5BT5 A;  3SVF A;  3ZYU A;  3P1F A;  4BHW A;  2YEK A;  5D3S A;  4A9I A;  4QR3 A;  3MUK A;  4YYH A;  3LXJ A;  5FFW A;  5D3R A;  3IU6 A;  4XY8 A;  5EWW A;  4DON A;  4NR8 A;  5AD2 A;  5FE2 A;  4UIY A;  5DW2 A;  5E9L A;  4F3I A;  3QZT A;  2R0V A;  3P1E A;  2EJN A;  5L8T A;  5C7N A;  4OGJ A;  5IBN A;  4ALH A;  5C89 A;  5D3P A;  4LR6 A;  4QR4 A;  4LYW A;  5D24 A;  2YQD A;  3I3J A;  5HRV A;  5F3A A;  5HQ7 A;  3P1C A;  2WP2 A;  4QSW A;  4CFK A;  5DX4 A;  2R10 A;  2LSP B;  5I1Q A;  1F68 A;  4UYD A;  4LYI A;  5FB1 A;  4N3W A;  5I80 A;  4MEO A;  5FBX A;  3D1B A;  3QZV A;  5DYX A;  1EQF A;  5E3G A;  4BW2 A;  4NRA A;  5CFW A;  3UV4 A;  4FLP A;  5IGK A;  3U5L A;  2RI7 A;  4WIV A;  5E73 A;  2RFJ A;  5EA1 A;  4NUC A;  5D3H A;  5AD3 A;  4YH4 A;  5CQT A;  5C85 A;  4Y03 A;  3P5O A;  4O72 A;  5HJC A;  4HXL A;  4O70 A;  5EWH A;  4E96 A;  3O33 A;  4WHW A;  4J3I A;  4KV1 A;  5KTW A;  4O76 A;  5F62 A;  4UYH A;  2YEM A;  5E3D A;  4UYF B;  5FH7 A;  5G4S A;  5C8G A;  5A85 A;  4QEU A;  4QR5 A;  5C87 A;  1X0J A;  4LZR A;  4QSS A;  5ENG A;  3U5K A;  3LQH A;  4LDF A;  4MR5 A;  5D26 A;  4A9M A;  4NQN A;  4Q0O A;  3MQM A;  4N4H A;  5H1V A;  1WUG A;  4A9E A;  4WHU A;  5LJ1 A;  2R0S A;  5DYC A;  4CUS A;  2L5E A;  3DAI A;  4Z6I A;  5KU3 A;  5FE0 A;  2D9E A;  2NXB A;  4HXM A;  4IR6 A;  4Z93 A;  5FE5 A;  4PS5 A;  4TQN A;  5HRX A;  5I7Y A;  5JWM A;  5E9Y A;  5HCL A;  2RNW A;  5IGN A;  3DWY A;  5FE3 A;  4CUQ A;  5TCM A;  5F1L A;  4NRB A;  5JI8 A;  5EPB A;  5IID A;  5CUC A;  4HXN A;  2OUO A;  5L97 A;  4N4G A;  4MEQ A;  5I86 A;  5FG6 A;  2FSA A;  3U5N A;  4N4I A;  5CQA A;  4CL9 A;  5E74 A;  4OUF A;  4UIT A;  5CGP A;  5CUE A;  5D3N A;  4TZ8 A;  5CRZ A;  4TT4 A;  5FE9 A;  2L85 A;  5DLX A;  5DKC A;  4YAX A;  4O7B A;  4XUA A;  4HBY A;  4PCE A;  4YYM A;  4NUD A;  1JM4 B;  3S91 A;  4A9K A;  5F2P A;  5EQ1 A;  5CQ3 A;  5CPE A;  4QSQ A;  5DKD A;  3SVH A;  5CUD A;  5J0D A;  1ZKR A;  4NR9 A;  4BW4 A;  4QYL A;  2YDW A;  1E6I A;  5LKT A;  2DVR A;  4PTB A;  4NUE A;  5AMF A;  5L99 A;  5HLS A;  2F6N A;  4A9O A;  4HXP A;  4UYE A;  4YAD A;  1PUO A;  2OSS A;  5D25 A;  5F25 A;  4HXS A;  5II1 A;  4UYG A;  5F63 A;  4NRC A;  5H1U A;  4QSU A;  4KV4 A;  3U5P A;  4PKL A;  3O36 A;  5E0R A;  4YYD A;  4O78 A;  3SVG A;  3IU5 A;  5EK9 A;  5CQ4 A;  4CFL A;  5CS8 A;  2DVS A;  5FFY A;  5H85 A;  4YBM A;  5I83 A;  4QY4 A;  4PCI A;  5CUG A;  5CU8 A;  5ENB A;  4YBT A;  4TT2 A;  2OO1 A;  2D82 A;  4TU6 A;  2R0Y A;  4YH3 A;  2WP1 A;  4NXJ A;  3MUL A;  5D3T A;  5ACY A;  4TZ2 A;  4A9F A;  4YYN A;  2DWW A;  5COI A;  3UV2 A;  5CQ6 A;  5F60 A;  5K29 A;  4YBS A;  5E7D A;  3AQA A;  4LC2 A;  5EI4 A;  4QC3 A;  2MJV B;  3AAD A;  5HEL A;  5LKX A;  5ENF A;  4YC9 A;  5A81 A;  5FH8 A;  5CQ5 A;  5A5R A;  3G0L A;  4YK0 A;  4QEV A;  4IOR A;  5DFD A;  4CUU A;  5C4Q A;  4O7A A;  3JVM A;  4NQM A;  5I89 A;  1ZS5 A;  5LVR A;  4J0S A;  2DKW A;  5I7X A;  5BT3 A;  5FDZ A;  5EP7 A;  3P1D A;  3HME A;  3UV5 A;  5L98 A;  5BT4 A;  5F36 A;  4YYK A;  5LKU A;  5CTL A;  2H60 A;  4YAT A;  3TLP A;  4AKH A;  2DAT A;  3FKM X;  5D7X A;  5KTU A;  5EV9 A;  4TT6 A;  3HMH A;  4IR5 A;  5A83 A;  2RNY A;  4NYV A;  5DFC A;  5HRW A;  3O37 A;  3D1D A;  4Q0N A;  4QUT A;  4C67 A;  4AKI A;  3UVW A;  3U5O A;  2G4A A;  5DBM A;  4XY9 A;  4NS5 A;  5DYU A;  4TTE A;  4QC1 A;  2YEL A;  4Z1S A;  4A9J A;  3JVL A;  5EGU A;  2DVV A;  3JVJ A;  4LRG A;  3O35 A;  5DKH A;  3G0J A;  3NXB A;  4C66 A;  2RO1 A;  5I88 A;  2E7O A;  5ETD A;  4Z6H A;  3ERR A;  4QST A;  4O7E A;  4NYX A;  4O7F A;  4QSP A;  4TYL A;  5IG6 A;  5FE8 A;  4YAB A;  5TB6 A;  4YYJ A;  4ZQL A;  4X2I A;  5A5Q A;  5LJ0 A;  4MR4 A;  4UIZ A;  5A5S A;  4MR6 A;  4CLB A;  5LJ2 A;  4HBX A;  2YW5 A;  4IOO A;  5FE1 A;  4BJX A;  5HM0 A;  1JSP B;  5CUA A;  4AI6 A;  5F5Z A;  3LJW A;  3MB3 A;  4IR4 A;  5DFB A;  2YYN A;  5AME A;  4QSR A;  2DVQ A;  4J1P A;  4QSV A;  4HXK A;  4RVR A;  2L84 A;  4AKN A;  5A5O A;  4QEW A;  3K2J A;  4XYA A;  5FE7 A;  5D0C A;  5E9I A;  5EPR A;  3RCW A;  4PY6 A;  4UIX A;  5ENI A;  3U5M A;  5KHM A;  2F6J A;  3UVX A;  5F1H A;  3U5J A;  5L8U A;  4UIW A;  5HEN A;  5DW1 A;  5ETB A;  4HBW A;  5EVA A;  4O7C A;  3O34 A;  4LZS A;  4QZS A;  4A9N A;  5E9M A;  3VKH A;  5EWD A;  4CUP A;  5KO4 A;  2GRC A;  4NR5 A;  3LQI A;  4UIV A;  4LZ2 A;  4BW1 A;  5G4R A;  4QBM A;  5CQ7 A;  4HXR A;  2E3K A;  5DYA A;  5EIS A;  4YY4 A;  4UIU A;  3Q2F A;  4XUB A;  3UVD A;  3MXF A;  4CUR A;  5IGM A;  3GG3 A;  4GPJ A;  4HXO A;  3UVY A;  4BW3 A;  5CY9 A;  4MR3 A;  4YY6 A; 
#chains in the Genus database with same CATH homology
 4NYW A;  5FFV A;  4A9L A;  4YYG A;  5CP5 A;  5E9K A;  4A9H A;  5FG4 A;  5FE6 A;  4O75 A;  5FH6 A;  5D3J A;  4KCX A;  5HEM A;  2RNX A;  5FB0 A;  5ENC A;  5ENH A;  5LUU A;  3ONI A;  5ENE A;  4ZC9 A;  4O71 A;  4HBV A;  5A7C A;  4IR3 A;  5F61 A;  4QSX A;  4QYD A;  1N72 A;  4O74 A;  5HQ5 A;  3LQJ A;  5H1T A;  5CUB A;  2E7N A;  4TU4 A;  4MEP A;  5A82 A;  3HMF A;  2KTB B;  5LKZ A;  3JVK A;  4NR7 A;  3MB4 A;  4QUU A;  4CUT A;  5ENJ A;  4ZW1 A;  4MEN A;  5II2 A;  4QB3 A;  5LVQ A;  4QNS A;  5CRM A;  5EM3 A;  3UW9 A;  3Q2E A;  2N9G A;  5L96 A;  4O77 A;  5DLZ A;  5EWV A;  5E9V A;  5EIC A;  2I8N A;  4YYI A;  5FE4 A;  1WUM A;  4LYS A;  5I40 A;  4NR6 A;  5EWC A;  5A5N A;  5EPS A;  5KTX A;  4IOQ A;  4Z1Q A;  3QZS A;  4N4F A;  4TS8 A;  5HFQ A;  4NR4 A;  5EU1 A;  4ALG A;  2I7K A;  4UYF A;  5HQ6 A;  5DY7 A;  5HFR A;  4J0R A;  3S92 A;  4OGI A;  5A5P A;  3D7C A;  5CZG A;  5I29 A;  5D3L A;  5CQ8 A;  5IGL A;  5FG5 A;  2RS9 B;  5BT5 A;  3SVF A;  3ZYU A;  3P1F A;  4BHW A;  2YEK A;  5D3S A;  4A9I A;  4QR3 A;  3MUK A;  4YYH A;  3LXJ A;  5FFW A;  5D3R A;  3IU6 A;  4XY8 A;  5EWW A;  4DON A;  4NR8 A;  5AD2 A;  5FE2 A;  4UIY A;  5DW2 A;  5E9L A;  4F3I A;  3QZT A;  2R0V A;  3P1E A;  5L8T A;  5C7N A;  4OGJ A;  5IBN A;  4ALH A;  5C89 A;  5D3P A;  4LR6 A;  4QR4 A;  4LYW A;  5D24 A;  2YQD A;  3I3J A;  5HRV A;  5F3A A;  5HQ7 A;  3P1C A;  2WP2 A;  4QSW A;  4CFK A;  5DX4 A;  2R10 A;  2LSP B;  5I1Q A;  1F68 A;  4UYD A;  4LYI A;  5FB1 A;  4N3W A;  5I80 A;  4MEO A;  5FBX A;  3QZV A;  5DYX A;  1EQF A;  5E3G A;  4BW2 A;  4NRA A;  5CFW A;  3UV4 A;  4FLP A;  5IGK A;  3U5L A;  2RI7 A;  4WIV A;  5E73 A;  2RFJ A;  5EA1 A;  4NUC A;  5D3H A;  5AD3 A;  4YH4 A;  5CQT A;  5C85 A;  4Y03 A;  3P5O A;  4O72 A;  5HJC A;  4HXL A;  4O70 A;  5EWH A;  4E96 A;  3O33 A;  4WHW A;  4J3I A;  4KV1 A;  5KTW A;  4O76 A;  5F62 A;  4UYH A;  2YEM A;  5E3D A;  4UYF B;  5FH7 A;  5G4S A;  5C8G A;  5A85 A;  4QEU A;  4QR5 A;  5C87 A;  1X0J A;  4LZR A;  4QSS A;  5ENG A;  3U5K A;  3LQH A;  4LDF A;  4MR5 A;  5D26 A;  4A9M A;  4NQN A;  4Q0O A;  3MQM A;  4N4H A;  5H1V A;  1WUG A;  4A9E A;  4WHU A;  5LJ1 A;  2R0S A;  5DYC A;  4CUS A;  2L5E A;  3DAI A;  4Z6I A;  5KU3 A;  5FE0 A;  2D9E A;  2NXB A;  4HXM A;  4IR6 A;  4Z93 A;  5FE5 A;  4PS5 A;  4TQN A;  5HRX A;  5I7Y A;  5JWM A;  5E9Y A;  5HCL A;  2RNW A;  5IGN A;  3DWY A;  5FE3 A;  4CUQ A;  5TCM A;  5F1L A;  4NRB A;  5JI8 A;  5EPB A;  5IID A;  5CUC A;  4HXN A;  2OUO A;  5L97 A;  4N4G A;  4MEQ A;  5I86 A;  5FG6 A;  2FSA A;  3U5N A;  4N4I A;  5CQA A;  4CL9 A;  5E74 A;  4OUF A;  4UIT A;  5CGP A;  5CUE A;  5D3N A;  4TZ8 A;  5CRZ A;  4TT4 A;  5FE9 A;  2L85 A;  5DLX A;  5DKC A;  4YAX A;  4O7B A;  4XUA A;  4HBY A;  4PCE A;  4YYM A;  4NUD A;  1JM4 B;  3S91 A;  4A9K A;  5F2P A;  5EQ1 A;  5CQ3 A;  5CPE A;  4QSQ A;  5DKD A;  3SVH A;  5CUD A;  5J0D A;  4NR9 A;  4BW4 A;  4QYL A;  2YDW A;  1E6I A;  5LKT A;  2DVR A;  4PTB A;  4NUE A;  5AMF A;  5L99 A;  5HLS A;  2F6N A;  4A9O A;  4HXP A;  4UYE A;  4YAD A;  2OSS A;  5D25 A;  5F25 A;  4HXS A;  5II1 A;  4UYG A;  5F63 A;  4NRC A;  5H1U A;  4QSU A;  4KV4 A;  3U5P A;  4PKL A;  3O36 A;  5E0R A;  4YYD A;  4O78 A;  3SVG A;  3IU5 A;  5EK9 A;  5CQ4 A;  4CFL A;  5CS8 A;  2DVS A;  5FFY A;  5H85 A;  4YBM A;  5I83 A;  4QY4 A;  4PCI A;  5CUG A;  5CU8 A;  5ENB A;  4YBT A;  4TT2 A;  2OO1 A;  2D82 A;  4TU6 A;  2R0Y A;  4YH3 A;  2WP1 A;  4NXJ A;  3MUL A;  5D3T A;  5ACY A;  4TZ2 A;  4A9F A;  4YYN A;  2DWW A;  5COI A;  3UV2 A;  5CQ6 A;  5F60 A;  5K29 A;  4YBS A;  5E7D A;  3AQA A;  4LC2 A;  5EI4 A;  4QC3 A;  2MJV B;  3AAD A;  5HEL A;  5LKX A;  5ENF A;  4YC9 A;  5A81 A;  5FH8 A;  5CQ5 A;  5A5R A;  3G0L A;  4YK0 A;  4QEV A;  4IOR A;  5DFD A;  4CUU A;  5C4Q A;  4O7A A;  3JVM A;  4NQM A;  5I89 A;  1ZS5 A;  5LVR A;  4J0S A;  2DKW A;  5I7X A;  5BT3 A;  5FDZ A;  5EP7 A;  3P1D A;  3HME A;  3UV5 A;  5L98 A;  5BT4 A;  5F36 A;  4YYK A;  5LKU A;  5CTL A;  2H60 A;  4YAT A;  3TLP A;  2DAT A;  3FKM X;  5D7X A;  5KTU A;  5EV9 A;  4TT6 A;  3HMH A;  4IR5 A;  5A83 A;  2RNY A;  4NYV A;  5DFC A;  5HRW A;  3O37 A;  4Q0N A;  4QUT A;  4C67 A;  3UVW A;  3U5O A;  2G4A A;  5DBM A;  4XY9 A;  4NS5 A;  5DYU A;  4TTE A;  4QC1 A;  2YEL A;  4Z1S A;  4A9J A;  3JVL A;  5EGU A;  2DVV A;  3JVJ A;  4LRG A;  3O35 A;  5DKH A;  3G0J A;  3NXB A;  4C66 A;  2RO1 A;  5I88 A;  2E7O A;  5ETD A;  4Z6H A;  4QST A;  4O7E A;  4NYX A;  4O7F A;  4QSP A;  4TYL A;  5IG6 A;  5FE8 A;  4YAB A;  5TB6 A;  4YYJ A;  4ZQL A;  4X2I A;  5A5Q A;  5LJ0 A;  4MR4 A;  4UIZ A;  5A5S A;  4MR6 A;  4CLB A;  5LJ2 A;  4HBX A;  2YW5 A;  4IOO A;  5FE1 A;  4BJX A;  5HM0 A;  1JSP B;  5CUA A;  5F5Z A;  3LJW A;  3MB3 A;  4IR4 A;  5DFB A;  2YYN A;  5AME A;  4QSR A;  2DVQ A;  4J1P A;  4QSV A;  4HXK A;  4RVR A;  2L84 A;  4AKN A;  5A5O A;  4QEW A;  3K2J A;  4XYA A;  5FE7 A;  5D0C A;  5E9I A;  5EPR A;  3RCW A;  4PY6 A;  4UIX A;  5ENI A;  3U5M A;  5KHM A;  2F6J A;  3UVX A;  5F1H A;  3U5J A;  5L8U A;  4UIW A;  5HEN A;  5DW1 A;  5ETB A;  4HBW A;  5EVA A;  4O7C A;  3O34 A;  4LZS A;  4QZS A;  4A9N A;  5E9M A;  5EWD A;  4CUP A;  5KO4 A;  2GRC A;  4NR5 A;  3LQI A;  4UIV A;  4LZ2 A;  4BW1 A;  5G4R A;  4QBM A;  5CQ7 A;  4HXR A;  2E3K A;  5DYA A;  5EIS A;  4YY4 A;  4UIU A;  3Q2F A;  4XUB A;  3UVD A;  3MXF A;  4CUR A;  5IGM A;  3GG3 A;  4GPJ A;  4HXO A;  3UVY A;  4BW3 A;  5CY9 A;  4MR3 A;  4YY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...