5ETBA

Crystal structure of the human brpf1 bromodomain in complex with seed13
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5etbA00
5CUEA 4UYGA 4HXPA 5CGPA 5DYCA 5CQ7A 4NQNA 3P1CA 3K2JA 5FE3A 5DKDA 2E7NA 4XUAA 5D3JA 5KTWA 4QSPA 3UV5A 5BT4A 3SVHA 4YYKA 5H85A 4WIVA 4BW4A 5CPEA 4YYJA 1WUGA 2H60A 5I80A 5IGNA 4YC9A 4HBYA 4TYLA 4N4HA 2E3KA 4A9MA 5CQTA 3D7CA 5F3AA 5LKXA 4NR4A 4UYHA 4J0RA 4LYSA 4YADA 5FFWA 5FG4A 5F1HA 4C66A 5A7CA 4QYDA 5FE7A 3O33A 4AKNA 3ONIA 4QSSA 5E3DA 4NUEA 5EICA 3Q2EA 5D3NA 4QSRA 4N4GA 3I3JA 5K29A 5D0CA 2YELA 5CTLA 4BW2A 3O37A 4YYIA 3IU6A 4QC3A 2R0YA 5EV9A 4QNSA 3NXBA 3DWYA 5H1TA 4HXKA 4CFLA 4HBXA 4CLBA 5FH6A 4BJXA 4PY6A 5E9LA 4LZRA 5HFQA 4IOQA 3UV4A 4QR3A 5CP5A 5HQ5A 5LKTA 4PCIA 5E9MA 3HMFA 4UITA 5IG6A 4NRAA 4QR5A 5IBNA 4MR3A 4YBMA 5HQ6A 4NRBA 5ENFA 4QSWA 5CQ3A 5AMFA 3U5JA 4WHUA 5BT5A 3U5MA 5CUGA 5EPSA 4YYMA 5L8TA 5D3SA 4CFKA 5DYXA 3FKMX 4A9LA 4HXSA 5CQAA 4QY4A 5DLZA 4QEUA 5A85A 4OUFA 5CY9A 5A5QA 5EK9A 4CL9A 5HM0A 4TT4A 4J1PA 3LJWA 3MXFA 4HXRA 2L85A 4IR4A 5IGKA 5CRMA 4HXNA 4YATA 5EPRA 4TT6A 2DVSA 4Q0OA 4O7CA 5ETDA 5LJ1A 5LUUA 3U5LA 5D3TA 1EQFA 4XUBA 4QSXA 2DVQA 4ZC9A 5HFRA 4LYIA 2I8NA 4TU4A 5KHMA 2LSPB 3ZYUA 5FE9A 2RO1A 5ENCA 4YYNA 3MB4A 3UVWA 4OGJA 4XY9A 5FH8A 2GRCA 4NR5A 3SVGA 4XYAA 4QEWA 4UYEA 5HENA 5ENIA 4TT2A 5C87A 1E6IA 2YW5A 5ENBA 5IGLA 5FE0A 5L8UA 4CUSA 5D26A 3TLPA 4ALHA 4QYLA 3JVMA 5EU1A 5TCMA 4TZ8A 4YK0A 3G0LA 3MB3A 4J3IA 5EGUA 4BW1A 5A5PA 5C4QA 5CU8A 2OO1A 5BT3A 5FG6A 2YEKA 4HBWA 4NUDA 5D25A 4YAXA 5ENGA 4KCXA 4MENA 5HCLA 3MQMA 3O34A 4IOOA 4TS8A 3DAIA 4QUUA 5C85A 4UIZA 2YEMA 4ZW1A 2YYNA 2F6NA 4LRGA 5KTXA 4BW3A 5LKUA 4J0SA 4ALGA 4TTEA 5F5ZA 3S91A 2DKWA 5FFYA 2N9GA 4QSTA 4XY8A 4NYWA 5COIA 2YDWA 5EPBA 5CRZA 2RNXA 4PCEA 4NUCA 5KO4A 5D3RA 4DONA 5J0DA 4Y03A 5DYAA 5D3PA 5L96A 4NYXA 5I7YA 5FH7A 3UVDA 4E96A 3QZTA 2R10A 1X0JA 4N4FA 5DKHA 5EWCA 5EM3A 4O74A 5CUDA 5G4SA 5FBXA 5E9YA 4YH4A 4O7EA 4LR6A 4IR5A 5A5RA 2D9EA 2R0VA 4QR4A 4QSQA 4UIYA 4KV4A 4O70A 5C89A 4NR9A 1WUMA 2E7OA 5LKZA 4Z6IA 3JVKA 5ACYA 5DW1A 3P1DA 5A5OA 4ZQLA 5DKCA 5CZGA 5TB6A 4A9EA 2RFJA 4Z93A 5E7DA 5E9VA 5DFCA 4NRCA 4LC2A 3MULA 4YBTA 5F25A 5HJCA 5F1LA 5CQ6A 2FSAA 4MR4A 5D7XA 4O75A 4UIUA 3IU5A 4LZSA 4FLPA 1N72A 3P1FA 3QZVA 4CUTA 2G4AA 5AD3A 5E9IA 2L84A 3U5PA 3LXJA 4YBSA 5EWDA 4NR7A 3SVFA 4MEPA 5C8GA 4KV1A 4PS5A 5H1UA 4CUUA 5JWMA 3JVLA 5CUAA 5LVQA 5C7NA 1JSPB 4O7AA 5II2A 2NXBA 4O78A 5D24A 4A9HA 5EI4A 3P1EA 4NR8A 4LZ2A 3S92A 4QUTA 5EA1A 3RCWA 3HMEA 4HXMA 1F68A 4A9KA 3HMHA 2DVVA 5FE8A 4TU6A 4N4IA 5HLSA 5IGMA 4MR6A 5CUBA 5AMEA 5FE5A 3Q2FA 5E73A 5FDZA 2OUOA 2WP2A 5E74A 4TZ2A 4UYFB 5F62A 5LJ2A 4NYVA 4NR6A 4HXOA 4UYDA 5EWVA 4YH3A 4O71A 5F61A 4NS5A 4A9JA 5F36A 5I83A 4IR3A 5LVRA 4O7BA 4UIWA 5EISA 4QZSA 3LQIA 4CUQA 3O35A 5DFDA 5EQ1A 5HQ7A 4Z1SA 4LDFA 2RNYA 5FB1A 4QBMA 4RVRA 5DW2A 4YY4A 4YABA 4O72A 5FB0A 1JM4B 3U5KA 2DWWA 4OGIA 5EP7A 5I88A 2DATA 4NXJA 5E9KA 5I89A 2D82A 3AQAA 5CS8A 2I7KA 5F63A 4YYGA 5I40A 5DY7A 4MEQA 5ENEA 5L98A 2YQDA 4O7FA 4A9NA 5FE6A 2DVRA 5HRVA 2F6JA 4N3WA 2KTBB 5LJ0A 3LQJA 4F3IA 5ENHA 5KU3A 4GPJA 3MUKA 5FE4A 4O77A 4PKLA 2MJVB 4QB3A 5D3HA 5EWWA 5H1VA 5FE2A 5E0RA 2R0SA 3JVJA 5FG5A 5HRWA 4YY6A 4HXLA 4IORA 3UW9A 4UYFA 5A5SA 4YYHA 5I1QA 3QZSA 5JI8A 4BHWA 5G4RA 4Z6HA 5ETBA 3AADA 2RS9B 4YYDA 4A9FA 5HELA 3UV2A 4A9OA 5CQ8A 4NQMA 4O76A 5CUCA 3U5NA 5IIDA 5AD2A 5A83A 5II1A 3G0JA 3O36A 5HRXA 5I7XA 4CUPA 3U5OA 4QEVA 3GG3A 3P5OA 5EWHA 4UIXA 5DYUA 5DFBA 5A82A 5CQ4A 5F60A 4WHWA 5DLXA 4TQNA 5A81A 5FE1A 4PTBA 4A9IA 4QC1A 5E3GA 5I86A 5D3LA 4C67A 5FFVA 3UVXA 4MEOA 5L99A 5A5NA 5CQ5A 1ZS5A 4CURA 2RI7A 4Q0NA 4QSUA 3UVYA 4UIVA 4IR6A 5L97A 2L5EA 4QSVA 2WP1A 5DBMA 2RNWA 2OSSA 4HBVA 5CFWA 5I29A 5ENJA 3LQHA 5HEMA 4Z1QA 4MR5A 4LYWA 5F2PA 5KTUA 5DX4A 4X2IA 5EVAA
chains in the Genus database with same CATH superfamily
5CUEA 4UYGA 4HXPA 5CGPA 5DYCA 5CQ7A 4NQNA 3P1CA 3K2JA 5FE3A 5DKDA 2E7NA 4XUAA 5D3JA 5KTWA 4QSPA 3UV5A 5BT4A 3SVHA 4YYKA 5H85A 4WIVA 4BW4A 5CPEA 4YYJA 1WUGA 2H60A 5I80A 5IGNA 4YC9A 4HBYA 4TYLA 4N4HA 2E3KA 4A9MA 5CQTA 3D7CA 5F3AA 5LKXA 4NR4A 4UYHA 4J0RA 4LYSA 4YADA 5FFWA 5FG4A 5F1HA 4C66A 5A7CA 4QYDA 5FE7A 3O33A 4AKNA 3ONIA 4QSSA 4AKIA 5E3DA 4NUEA 5EICA 3Q2EA 5D3NA 4QSRA 4N4GA 3I3JA 5K29A 5D0CA 2YELA 5CTLA 4BW2A 3O37A 4YYIA 3IU6A 4QC3A 2R0YA 5EV9A 4QNSA 3NXBA 3DWYA 5H1TA 4HXKA 4CFLA 4HBXA 4CLBA 5FH6A 4BJXA 4PY6A 5E9LA 4LZRA 5HFQA 4IOQA 3UV4A 4QR3A 5CP5A 5HQ5A 5LKTA 4PCIA 5E9MA 3HMFA 4UITA 5IG6A 4NRAA 4QR5A 5IBNA 4MR3A 4YBMA 5HQ6A 4NRBA 5ENFA 4QSWA 5CQ3A 5AMFA 3U5JA 4WHUA 5BT5A 3U5MA 5CUGA 5EPSA 4YYMA 5L8TA 5D3SA 4CFKA 5DYXA 3FKMX 4A9LA 4HXSA 5CQAA 4QY4A 5DLZA 4QEUA 5A85A 4OUFA 5CY9A 5A5QA 5EK9A 4CL9A 5HM0A 4TT4A 4J1PA 3LJWA 3MXFA 4HXRA 2L85A 4IR4A 5IGKA 5CRMA 4HXNA 4YATA 5EPRA 4TT6A 2DVSA 4Q0OA 4O7CA 5ETDA 5LJ1A 5LUUA 3U5LA 5D3TA 1EQFA 4XUBA 4QSXA 2DVQA 4ZC9A 5HFRA 4LYIA 2I8NA 4TU4A 5KHMA 2LSPB 3ZYUA 5FE9A 2RO1A 5ENCA 4YYNA 3MB4A 3UVWA 4OGJA 4XY9A 5FH8A 2GRCA 4NR5A 3SVGA 4XYAA 4QEWA 4UYEA 5HENA 5ENIA 4TT2A 5C87A 1E6IA 2YW5A 5ENBA 5IGLA 5FE0A 5L8UA 4CUSA 5D26A 3TLPA 4ALHA 4QYLA 3JVMA 5EU1A 5TCMA 4TZ8A 4YK0A 3G0LA 3MB3A 4J3IA 5EGUA 4BW1A 5A5PA 5C4QA 5CU8A 2OO1A 2EJNA 5BT3A 5FG6A 2YEKA 4HBWA 4NUDA 5D25A 4YAXA 5ENGA 4KCXA 4MENA 5HCLA 3MQMA 3O34A 4IOOA 4TS8A 3DAIA 4QUUA 5C85A 4UIZA 2YEMA 4ZW1A 2YYNA 2F6NA 4LRGA 5KTXA 4BW3A 5LKUA 4J0SA 4ALGA 4TTEA 5F5ZA 3S91A 2DKWA 5FFYA 2N9GA 4QSTA 4XY8A 4NYWA 5COIA 2YDWA 5EPBA 5CRZA 2RNXA 4PCEA 4NUCA 5KO4A 5D3RA 4DONA 3D1BA 5J0DA 4Y03A 5DYAA 5D3PA 5L96A 4NYXA 5I7YA 5FH7A 3UVDA 4E96A 3QZTA 3VKGA 2R10A 1X0JA 4N4FA 5DKHA 5EWCA 5EM3A 4O74A 5CUDA 5G4SA 5FBXA 5E9YA 4YH4A 4O7EA 4LR6A 4IR5A 5A5RA 2D9EA 2R0VA 4QR4A 4QSQA 4UIYA 4KV4A 4O70A 5C89A 4NR9A 1WUMA 2E7OA 5LKZA 4Z6IA 3JVKA 5ACYA 5DW1A 3P1DA 5A5OA 4ZQLA 5DKCA 5CZGA 5TB6A 4A9EA 2RFJA 4Z93A 5E7DA 5E9VA 5DFCA 4NRCA 4LC2A 3MULA 4YBTA 3VKHA 5F25A 5HJCA 5F1LA 5CQ6A 2FSAA 4MR4A 5D7XA 4O75A 4UIUA 3IU5A 4LZSA 4FLPA 1N72A 3P1FA 3QZVA 4CUTA 2G4AA 5AD3A 5E9IA 2L84A 3U5PA 3LXJA 4YBSA 5EWDA 4NR7A 3SVFA 4MEPA 5C8GA 4KV1A 4PS5A 5H1UA 4CUUA 5JWMA 3JVLA 5CUAA 5LVQA 5C7NA 1JSPB 4O7AA 5II2A 2NXBA 4O78A 5D24A 4A9HA 5EI4A 3P1EA 4NR8A 4LZ2A 3S92A 4QUTA 5EA1A 3RCWA 3HMEA 3D1DA 4HXMA 1F68A 4A9KA 3HMHA 2DVVA 5FE8A 4TU6A 4N4IA 5HLSA 4AKHA 5IGMA 4MR6A 5CUBA 5AMEA 5FE5A 3Q2FA 5E73A 5FDZA 2OUOA 2WP2A 5E74A 4TZ2A 4UYFB 5F62A 5LJ2A 4NYVA 4NR6A 4HXOA 4UYDA 5EWVA 4YH3A 4O71A 5F61A 4NS5A 4A9JA 5F36A 5I83A 4IR3A 4AI6A 5LVRA 4O7BA 4UIWA 5EISA 4QZSA 3LQIA 4CUQA 3O35A 5DFDA 5EQ1A 5HQ7A 4Z1SA 4LDFA 2RNYA 5FB1A 4QBMA 4RVRA 5DW2A 4YY4A 1PUOA 4YABA 4O72A 5FB0A 1JM4B 3ERRA 3U5KA 2DWWA 4OGIA 5EP7A 5I88A 2DATA 4NXJA 5E9KA 5I89A 2D82A 3AQAA 5CS8A 2I7KA 5F63A 4YYGA 5I40A 5DY7A 4MEQA 5ENEA 5L98A 2YQDA 4O7FA 4A9NA 5FE6A 2DVRA 5HRVA 2F6JA 4N3WA 2KTBB 5LJ0A 3LQJA 4AKGA 4F3IA 5ENHA 5KU3A 4GPJA 3MUKA 5FE4A 4O77A 4PKLA 2MJVB 4QB3A 5D3HA 5EWWA 5H1VA 5FE2A 5E0RA 2R0SA 3JVJA 5FG5A 5HRWA 4YY6A 4HXLA 4IORA 3UW9A 4UYFA 5A5SA 4YYHA 5I1QA 3QZSA 5JI8A 4BHWA 5G4RA 4Z6HA 5ETBA 3AADA 2RS9B 4YYDA 4A9FA 5HELA 3UV2A 4A9OA 5CQ8A 4NQMA 4O76A 5CUCA 3U5NA 5IIDA 5AD2A 5A83A 5II1A 3G0JA 1ZKRA 3O36A 5HRXA 5I7XA 4CUPA 3U5OA 4QEVA 3GG3A 3P5OA 5EWHA 4UIXA 5DYUA 5DFBA 5A82A 5CQ4A 5F60A 4WHWA 5DLXA 4TQNA 5A81A 5FE1A 4PTBA 4A9IA 4QC1A 5E3GA 5I86A 5D3LA 4C67A 5FFVA 3UVXA 4MEOA 5L99A 5A5NA 5CQ5A 1ZS5A 4CURA 2RI7A 4Q0NA 4QSUA 3UVYA 4UIVA 4IR6A 5L97A 2L5EA 4QSVA 2WP1A 5DBMA 2RNWA 2OSSA 4HBVA 5CFWA 5I29A 5ENJA 3LQHA 5HEMA 4Z1QA 4MR5A 4LYWA 5F2PA 5KTUA 5DX4A 4X2IA 5EVAA
chains in the Genus database with same CATH topology
5CUEA 4UYGA 4HXPA 5CGPA 5DYCA 5CQ7A 4NQNA 3P1CA 3K2JA 5FE3A 5DKDA 2E7NA 4XUAA 5D3JA 5KTWA 4QSPA 3UV5A 5BT4A 3SVHA 4YYKA 5H85A 4WIVA 4BW4A 5CPEA 4YYJA 1WUGA 2H60A 5I80A 5IGNA 4YC9A 4HBYA 4TYLA 4N4HA 2E3KA 4A9MA 5CQTA 3D7CA 5F3AA 5LKXA 4NR4A 4UYHA 4J0RA 4LYSA 4YADA 5FFWA 5FG4A 5F1HA 4C66A 5A7CA 4QYDA 5FE7A 3O33A 4AKNA 3ONIA 4QSSA 5E3DA 4NUEA 5EICA 3Q2EA 5D3NA 4QSRA 4N4GA 3I3JA 5K29A 5D0CA 2YELA 5CTLA 4BW2A 3O37A 4YYIA 3IU6A 4QC3A 2R0YA 5EV9A 4QNSA 3NXBA 3DWYA 5H1TA 4HXKA 4CFLA 4HBXA 4CLBA 5FH6A 4BJXA 4PY6A 5E9LA 4LZRA 5HFQA 4IOQA 3UV4A 4QR3A 5CP5A 5HQ5A 5LKTA 4PCIA 5E9MA 3HMFA 4UITA 5IG6A 4NRAA 4QR5A 5IBNA 4MR3A 4YBMA 5HQ6A 4NRBA 5ENFA 4QSWA 5CQ3A 5AMFA 3U5JA 4WHUA 5BT5A 3U5MA 5CUGA 5EPSA 4YYMA 5L8TA 5D3SA 4CFKA 5DYXA 3FKMX 4A9LA 4HXSA 5CQAA 4QY4A 5DLZA 4QEUA 5A85A 4OUFA 5CY9A 5A5QA 5EK9A 4CL9A 5HM0A 4TT4A 4J1PA 3LJWA 3MXFA 4HXRA 2L85A 4IR4A 5IGKA 5CRMA 4HXNA 4YATA 5EPRA 4TT6A 2DVSA 4Q0OA 4O7CA 5ETDA 5LJ1A 5LUUA 3U5LA 5D3TA 1EQFA 4XUBA 4QSXA 2DVQA 4ZC9A 5HFRA 4LYIA 2I8NA 4TU4A 5KHMA 2LSPB 3ZYUA 5FE9A 2RO1A 5ENCA 4YYNA 3MB4A 3UVWA 4OGJA 4XY9A 5FH8A 2GRCA 4NR5A 3SVGA 4XYAA 4QEWA 4UYEA 5HENA 5ENIA 4TT2A 5C87A 1E6IA 2YW5A 5ENBA 5IGLA 5FE0A 5L8UA 4CUSA 5D26A 3TLPA 4ALHA 4QYLA 3JVMA 5EU1A 5TCMA 4TZ8A 4YK0A 3G0LA 3MB3A 4J3IA 5EGUA 4BW1A 5A5PA 5C4QA 5CU8A 2OO1A 5BT3A 5FG6A 2YEKA 4HBWA 4NUDA 5D25A 4YAXA 5ENGA 4KCXA 4MENA 5HCLA 3MQMA 3O34A 4IOOA 4TS8A 3DAIA 4QUUA 5C85A 4UIZA 2YEMA 4ZW1A 2YYNA 2F6NA 4LRGA 5KTXA 4BW3A 5LKUA 4J0SA 4ALGA 4TTEA 5F5ZA 3S91A 2DKWA 5FFYA 2N9GA 4QSTA 4XY8A 4NYWA 5COIA 2YDWA 5EPBA 5CRZA 2RNXA 4PCEA 4NUCA 5KO4A 5D3RA 4DONA 5J0DA 4Y03A 5DYAA 5D3PA 5L96A 4NYXA 5I7YA 5FH7A 3UVDA 4E96A 3QZTA 2R10A 1X0JA 4N4FA 5DKHA 5EWCA 5EM3A 4O74A 5CUDA 5G4SA 5FBXA 5E9YA 4YH4A 4O7EA 4LR6A 4IR5A 5A5RA 2D9EA 2R0VA 4QR4A 4QSQA 4UIYA 4KV4A 4O70A 5C89A 4NR9A 1WUMA 2E7OA 5LKZA 4Z6IA 3JVKA 5ACYA 5DW1A 3P1DA 5A5OA 4ZQLA 5DKCA 5CZGA 5TB6A 4A9EA 2RFJA 4Z93A 5E7DA 5E9VA 5DFCA 4NRCA 4LC2A 3MULA 4YBTA 5F25A 5HJCA 5F1LA 5CQ6A 2FSAA 4MR4A 5D7XA 4O75A 4UIUA 3IU5A 4LZSA 4FLPA 1N72A 3P1FA 3QZVA 4CUTA 2G4AA 5AD3A 5E9IA 2L84A 3U5PA 3LXJA 4YBSA 5EWDA 4NR7A 3SVFA 4MEPA 5C8GA 4KV1A 4PS5A 5H1UA 4CUUA 5JWMA 3JVLA 5CUAA 5LVQA 5C7NA 1JSPB 4O7AA 5II2A 2NXBA 4O78A 5D24A 4A9HA 5EI4A 3P1EA 4NR8A 4LZ2A 3S92A 4QUTA 5EA1A 3RCWA 3HMEA 4HXMA 1F68A 4A9KA 3HMHA 2DVVA 5FE8A 4TU6A 4N4IA 5HLSA 5IGMA 4MR6A 5CUBA 5AMEA 5FE5A 3Q2FA 5E73A 5FDZA 2OUOA 2WP2A 5E74A 4TZ2A 4UYFB 5F62A 5LJ2A 4NYVA 4NR6A 4HXOA 4UYDA 5EWVA 4YH3A 4O71A 5F61A 4NS5A 4A9JA 5F36A 5I83A 4IR3A 5LVRA 4O7BA 4UIWA 5EISA 4QZSA 3LQIA 4CUQA 3O35A 5DFDA 5EQ1A 5HQ7A 4Z1SA 4LDFA 2RNYA 5FB1A 4QBMA 4RVRA 5DW2A 4YY4A 4YABA 4O72A 5FB0A 1JM4B 3U5KA 2DWWA 4OGIA 5EP7A 5I88A 2DATA 4NXJA 5E9KA 5I89A 2D82A 3AQAA 5CS8A 2I7KA 5F63A 4YYGA 5I40A 5DY7A 4MEQA 5ENEA 5L98A 2YQDA 4O7FA 4A9NA 5FE6A 2DVRA 5HRVA 2F6JA 4N3WA 2KTBB 5LJ0A 3LQJA 4F3IA 5ENHA 5KU3A 4GPJA 3MUKA 5FE4A 4O77A 4PKLA 2MJVB 4QB3A 5D3HA 5EWWA 5H1VA 5FE2A 5E0RA 2R0SA 3JVJA 5FG5A 5HRWA 4YY6A 4HXLA 4IORA 3UW9A 4UYFA 5A5SA 4YYHA 5I1QA 3QZSA 5JI8A 4BHWA 5G4RA 4Z6HA 5ETBA 3AADA 2RS9B 4YYDA 4A9FA 5HELA 3UV2A 4A9OA 5CQ8A 4NQMA 4O76A 5CUCA 3U5NA 5IIDA 5AD2A 5A83A 5II1A 3G0JA 3O36A 5HRXA 5I7XA 4CUPA 3U5OA 4QEVA 3GG3A 3P5OA 5EWHA 4UIXA 5DYUA 5DFBA 5A82A 5CQ4A 5F60A 4WHWA 5DLXA 4TQNA 5A81A 5FE1A 4PTBA 4A9IA 4QC1A 5E3GA 5I86A 5D3LA 4C67A 5FFVA 3UVXA 4MEOA 5L99A 5A5NA 5CQ5A 1ZS5A 4CURA 2RI7A 4Q0NA 4QSUA 3UVYA 4UIVA 4IR6A 5L97A 2L5EA 4QSVA 2WP1A 5DBMA 2RNWA 2OSSA 4HBVA 5CFWA 5I29A 5ENJA 3LQHA 5HEMA 4Z1QA 4MR5A 4LYWA 5F2PA 5KTUA 5DX4A 4X2IA 5EVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUE A;  4UYG A;  4HXP A;  5CGP A;  5DYC A;  5CQ7 A;  4NQN A;  3P1C A;  3K2J A;  5FE3 A;  5DKD A;  2E7N A;  4XUA A;  5D3J A;  5KTW A;  4QSP A;  3UV5 A;  5BT4 A;  3SVH A;  4YYK A;  5H85 A;  4WIV A;  4BW4 A;  5CPE A;  4YYJ A;  1WUG A;  2H60 A;  5I80 A;  5IGN A;  4YC9 A;  4HBY A;  4TYL A;  4N4H A;  2E3K A;  4A9M A;  5CQT A;  3D7C A;  5F3A A;  5LKX A;  4NR4 A;  4UYH A;  4J0R A;  4LYS A;  4YAD A;  5FFW A;  5FG4 A;  5F1H A;  4C66 A;  5A7C A;  4QYD A;  5FE7 A;  3O33 A;  4AKN A;  3ONI A;  4QSS A;  5E3D A;  4NUE A;  5EIC A;  3Q2E A;  5D3N A;  4QSR A;  4N4G A;  3I3J A;  5K29 A;  5D0C A;  2YEL A;  5CTL A;  4BW2 A;  3O37 A;  4YYI A;  3IU6 A;  4QC3 A;  2R0Y A;  5EV9 A;  4QNS A;  3NXB A;  3DWY A;  5H1T A;  4HXK A;  4CFL A;  4HBX A;  4CLB A;  5FH6 A;  4BJX A;  4PY6 A;  5E9L A;  4LZR A;  5HFQ A;  4IOQ A;  3UV4 A;  4QR3 A;  5CP5 A;  5HQ5 A;  5LKT A;  4PCI A;  5E9M A;  3HMF A;  4UIT A;  5IG6 A;  4NRA A;  4QR5 A;  5IBN A;  4MR3 A;  4YBM A;  5HQ6 A;  4NRB A;  5ENF A;  4QSW A;  5CQ3 A;  5AMF A;  3U5J A;  4WHU A;  5BT5 A;  3U5M A;  5CUG A;  5EPS A;  4YYM A;  5L8T A;  5D3S A;  4CFK A;  5DYX A;  3FKM X;  4A9L A;  4HXS A;  5CQA A;  4QY4 A;  5DLZ A;  4QEU A;  5A85 A;  4OUF A;  5CY9 A;  5A5Q A;  5EK9 A;  4CL9 A;  5HM0 A;  4TT4 A;  4J1P A;  3LJW A;  3MXF A;  4HXR A;  2L85 A;  4IR4 A;  5IGK A;  5CRM A;  4HXN A;  4YAT A;  5EPR A;  4TT6 A;  2DVS A;  4Q0O A;  4O7C A;  5ETD A;  5LJ1 A;  5LUU A;  3U5L A;  5D3T A;  1EQF A;  4XUB A;  4QSX A;  2DVQ A;  4ZC9 A;  5HFR A;  4LYI A;  2I8N A;  4TU4 A;  5KHM A;  2LSP B;  3ZYU A;  5FE9 A;  2RO1 A;  5ENC A;  4YYN A;  3MB4 A;  3UVW A;  4OGJ A;  4XY9 A;  5FH8 A;  2GRC A;  4NR5 A;  3SVG A;  4XYA A;  4QEW A;  4UYE A;  5HEN A;  5ENI A;  4TT2 A;  5C87 A;  1E6I A;  2YW5 A;  5ENB A;  5IGL A;  5FE0 A;  5L8U A;  4CUS A;  5D26 A;  3TLP A;  4ALH A;  4QYL A;  3JVM A;  5EU1 A;  5TCM A;  4TZ8 A;  4YK0 A;  3G0L A;  3MB3 A;  4J3I A;  5EGU A;  4BW1 A;  5A5P A;  5C4Q A;  5CU8 A;  2OO1 A;  5BT3 A;  5FG6 A;  2YEK A;  4HBW A;  4NUD A;  5D25 A;  4YAX A;  5ENG A;  4KCX A;  4MEN A;  5HCL A;  3MQM A;  3O34 A;  4IOO A;  4TS8 A;  3DAI A;  4QUU A;  5C85 A;  4UIZ A;  2YEM A;  4ZW1 A;  2YYN A;  2F6N A;  4LRG A;  5KTX A;  4BW3 A;  5LKU A;  4J0S A;  4ALG A;  4TTE A;  5F5Z A;  3S91 A;  2DKW A;  5FFY A;  2N9G A;  4QST A;  4XY8 A;  4NYW A;  5COI A;  2YDW A;  5EPB A;  5CRZ A;  2RNX A;  4PCE A;  4NUC A;  5KO4 A;  5D3R A;  4DON A;  5J0D A;  4Y03 A;  5DYA A;  5D3P A;  5L96 A;  4NYX A;  5I7Y A;  5FH7 A;  3UVD A;  4E96 A;  3QZT A;  2R10 A;  1X0J A;  4N4F A;  5DKH A;  5EWC A;  5EM3 A;  4O74 A;  5CUD A;  5G4S A;  5FBX A;  5E9Y A;  4YH4 A;  4O7E A;  4LR6 A;  4IR5 A;  5A5R A;  2D9E A;  2R0V A;  4QR4 A;  4QSQ A;  4UIY A;  4KV4 A;  4O70 A;  5C89 A;  4NR9 A;  1WUM A;  2E7O A;  5LKZ A;  4Z6I A;  3JVK A;  5ACY A;  5DW1 A;  3P1D A;  5A5O A;  4ZQL A;  5DKC A;  5CZG A;  5TB6 A;  4A9E A;  2RFJ A;  4Z93 A;  5E7D A;  5E9V A;  5DFC A;  4NRC A;  4LC2 A;  3MUL A;  4YBT A;  5F25 A;  5HJC A;  5F1L A;  5CQ6 A;  2FSA A;  4MR4 A;  5D7X A;  4O75 A;  4UIU A;  3IU5 A;  4LZS A;  4FLP A;  1N72 A;  3P1F A;  3QZV A;  4CUT A;  2G4A A;  5AD3 A;  5E9I A;  2L84 A;  3U5P A;  3LXJ A;  4YBS A;  5EWD A;  4NR7 A;  3SVF A;  4MEP A;  5C8G A;  4KV1 A;  4PS5 A;  5H1U A;  4CUU A;  5JWM A;  3JVL A;  5CUA A;  5LVQ A;  5C7N A;  1JSP B;  4O7A A;  5II2 A;  2NXB A;  4O78 A;  5D24 A;  4A9H A;  5EI4 A;  3P1E A;  4NR8 A;  4LZ2 A;  3S92 A;  4QUT A;  5EA1 A;  3RCW A;  3HME A;  4HXM A;  1F68 A;  4A9K A;  3HMH A;  2DVV A;  5FE8 A;  4TU6 A;  4N4I A;  5HLS A;  5IGM A;  4MR6 A;  5CUB A;  5AME A;  5FE5 A;  3Q2F A;  5E73 A;  5FDZ A;  2OUO A;  2WP2 A;  5E74 A;  4TZ2 A;  4UYF B;  5F62 A;  5LJ2 A;  4NYV A;  4NR6 A;  4HXO A;  4UYD A;  5EWV A;  4YH3 A;  4O71 A;  5F61 A;  4NS5 A;  4A9J A;  5F36 A;  5I83 A;  4IR3 A;  5LVR A;  4O7B A;  4UIW A;  5EIS A;  4QZS A;  3LQI A;  4CUQ A;  3O35 A;  5DFD A;  5EQ1 A;  5HQ7 A;  4Z1S A;  4LDF A;  2RNY A;  5FB1 A;  4QBM A;  4RVR A;  5DW2 A;  4YY4 A;  4YAB A;  4O72 A;  5FB0 A;  1JM4 B;  3U5K A;  2DWW A;  4OGI A;  5EP7 A;  5I88 A;  2DAT A;  4NXJ A;  5E9K A;  5I89 A;  2D82 A;  3AQA A;  5CS8 A;  2I7K A;  5F63 A;  4YYG A;  5I40 A;  5DY7 A;  4MEQ A;  5ENE A;  5L98 A;  2YQD A;  4O7F A;  4A9N A;  5FE6 A;  2DVR A;  5HRV A;  2F6J A;  4N3W A;  2KTB B;  5LJ0 A;  3LQJ A;  4F3I A;  5ENH A;  5KU3 A;  4GPJ A;  3MUK A;  5FE4 A;  4O77 A;  4PKL A;  2MJV B;  4QB3 A;  5D3H A;  5EWW A;  5H1V A;  5FE2 A;  5E0R A;  2R0S A;  3JVJ A;  5FG5 A;  5HRW A;  4YY6 A;  4HXL A;  4IOR A;  3UW9 A;  4UYF A;  5A5S A;  4YYH A;  5I1Q A;  3QZS A;  5JI8 A;  4BHW A;  5G4R A;  4Z6H A;  5ETB A;  3AAD A;  2RS9 B;  4YYD A;  4A9F A;  5HEL A;  3UV2 A;  4A9O A;  5CQ8 A;  4NQM A;  4O76 A;  5CUC A;  3U5N A;  5IID A;  5AD2 A;  5A83 A;  5II1 A;  3G0J A;  3O36 A;  5HRX A;  5I7X A;  4CUP A;  3U5O A;  4QEV A;  3GG3 A;  3P5O A;  5EWH A;  4UIX A;  5DYU A;  5DFB A;  5A82 A;  5CQ4 A;  5F60 A;  4WHW A;  5DLX A;  4TQN A;  5A81 A;  5FE1 A;  4PTB A;  4A9I A;  4QC1 A;  5E3G A;  5I86 A;  5D3L A;  4C67 A;  5FFV A;  3UVX A;  4MEO A;  5L99 A;  5A5N A;  5CQ5 A;  1ZS5 A;  4CUR A;  2RI7 A;  4Q0N A;  4QSU A;  3UVY A;  4UIV A;  4IR6 A;  5L97 A;  2L5E A;  4QSV A;  2WP1 A;  5DBM A;  2RNW A;  2OSS A;  4HBV A;  5CFW A;  5I29 A;  5ENJ A;  3LQH A;  5HEM A;  4Z1Q A;  4MR5 A;  4LYW A;  5F2P A;  5KTU A;  5DX4 A;  4X2I A;  5EVA A; 
#chains in the Genus database with same CATH topology
 5CUE A;  4UYG A;  4HXP A;  5CGP A;  5DYC A;  5CQ7 A;  4NQN A;  3P1C A;  3K2J A;  5FE3 A;  5DKD A;  2E7N A;  4XUA A;  5D3J A;  5KTW A;  4QSP A;  3UV5 A;  5BT4 A;  3SVH A;  4YYK A;  5H85 A;  4WIV A;  4BW4 A;  5CPE A;  4YYJ A;  1WUG A;  2H60 A;  5I80 A;  5IGN A;  4YC9 A;  4HBY A;  4TYL A;  4N4H A;  2E3K A;  4A9M A;  5CQT A;  3D7C A;  5F3A A;  5LKX A;  4NR4 A;  4UYH A;  4J0R A;  4LYS A;  4YAD A;  5FFW A;  5FG4 A;  5F1H A;  4C66 A;  5A7C A;  4QYD A;  5FE7 A;  3O33 A;  4AKN A;  3ONI A;  4QSS A;  4AKI A;  5E3D A;  4NUE A;  5EIC A;  3Q2E A;  5D3N A;  4QSR A;  4N4G A;  3I3J A;  5K29 A;  5D0C A;  2YEL A;  5CTL A;  4BW2 A;  3O37 A;  4YYI A;  3IU6 A;  4QC3 A;  2R0Y A;  5EV9 A;  4QNS A;  3NXB A;  3DWY A;  5H1T A;  4HXK A;  4CFL A;  4HBX A;  4CLB A;  5FH6 A;  4BJX A;  4PY6 A;  5E9L A;  4LZR A;  5HFQ A;  4IOQ A;  3UV4 A;  4QR3 A;  5CP5 A;  5HQ5 A;  5LKT A;  4PCI A;  5E9M A;  3HMF A;  4UIT A;  5IG6 A;  4NRA A;  4QR5 A;  5IBN A;  4MR3 A;  4YBM A;  5HQ6 A;  4NRB A;  5ENF A;  4QSW A;  5CQ3 A;  5AMF A;  3U5J A;  4WHU A;  5BT5 A;  3U5M A;  5CUG A;  5EPS A;  4YYM A;  5L8T A;  5D3S A;  4CFK A;  5DYX A;  3FKM X;  4A9L A;  4HXS A;  5CQA A;  4QY4 A;  5DLZ A;  4QEU A;  5A85 A;  4OUF A;  5CY9 A;  5A5Q A;  5EK9 A;  4CL9 A;  5HM0 A;  4TT4 A;  4J1P A;  3LJW A;  3MXF A;  4HXR A;  2L85 A;  4IR4 A;  5IGK A;  5CRM A;  4HXN A;  4YAT A;  5EPR A;  4TT6 A;  2DVS A;  4Q0O A;  4O7C A;  5ETD A;  5LJ1 A;  5LUU A;  3U5L A;  5D3T A;  1EQF A;  4XUB A;  4QSX A;  2DVQ A;  4ZC9 A;  5HFR A;  4LYI A;  2I8N A;  4TU4 A;  5KHM A;  2LSP B;  3ZYU A;  5FE9 A;  2RO1 A;  5ENC A;  4YYN A;  3MB4 A;  3UVW A;  4OGJ A;  4XY9 A;  5FH8 A;  2GRC A;  4NR5 A;  3SVG A;  4XYA A;  4QEW A;  4UYE A;  5HEN A;  5ENI A;  4TT2 A;  5C87 A;  1E6I A;  2YW5 A;  5ENB A;  5IGL A;  5FE0 A;  5L8U A;  4CUS A;  5D26 A;  3TLP A;  4ALH A;  4QYL A;  3JVM A;  5EU1 A;  5TCM A;  4TZ8 A;  4YK0 A;  3G0L A;  3MB3 A;  4J3I A;  5EGU A;  4BW1 A;  5A5P A;  5C4Q A;  5CU8 A;  2OO1 A;  2EJN A;  5BT3 A;  5FG6 A;  2YEK A;  4HBW A;  4NUD A;  5D25 A;  4YAX A;  5ENG A;  4KCX A;  4MEN A;  5HCL A;  3MQM A;  3O34 A;  4IOO A;  4TS8 A;  3DAI A;  4QUU A;  5C85 A;  4UIZ A;  2YEM A;  4ZW1 A;  2YYN A;  2F6N A;  4LRG A;  5KTX A;  4BW3 A;  5LKU A;  4J0S A;  4ALG A;  4TTE A;  5F5Z A;  3S91 A;  2DKW A;  5FFY A;  2N9G A;  4QST A;  4XY8 A;  4NYW A;  5COI A;  2YDW A;  5EPB A;  5CRZ A;  2RNX A;  4PCE A;  4NUC A;  5KO4 A;  5D3R A;  4DON A;  3D1B A;  5J0D A;  4Y03 A;  5DYA A;  5D3P A;  5L96 A;  4NYX A;  5I7Y A;  5FH7 A;  3UVD A;  4E96 A;  3QZT A;  3VKG A;  2R10 A;  1X0J A;  4N4F A;  5DKH A;  5EWC A;  5EM3 A;  4O74 A;  5CUD A;  5G4S A;  5FBX A;  5E9Y A;  4YH4 A;  4O7E A;  4LR6 A;  4IR5 A;  5A5R A;  2D9E A;  2R0V A;  4QR4 A;  4QSQ A;  4UIY A;  4KV4 A;  4O70 A;  5C89 A;  4NR9 A;  1WUM A;  2E7O A;  5LKZ A;  4Z6I A;  3JVK A;  5ACY A;  5DW1 A;  3P1D A;  5A5O A;  4ZQL A;  5DKC A;  5CZG A;  5TB6 A;  4A9E A;  2RFJ A;  4Z93 A;  5E7D A;  5E9V A;  5DFC A;  4NRC A;  4LC2 A;  3MUL A;  4YBT A;  3VKH A;  5F25 A;  5HJC A;  5F1L A;  5CQ6 A;  2FSA A;  4MR4 A;  5D7X A;  4O75 A;  4UIU A;  3IU5 A;  4LZS A;  4FLP A;  1N72 A;  3P1F A;  3QZV A;  4CUT A;  2G4A A;  5AD3 A;  5E9I A;  2L84 A;  3U5P A;  3LXJ A;  4YBS A;  5EWD A;  4NR7 A;  3SVF A;  4MEP A;  5C8G A;  4KV1 A;  4PS5 A;  5H1U A;  4CUU A;  5JWM A;  3JVL A;  5CUA A;  5LVQ A;  5C7N A;  1JSP B;  4O7A A;  5II2 A;  2NXB A;  4O78 A;  5D24 A;  4A9H A;  5EI4 A;  3P1E A;  4NR8 A;  4LZ2 A;  3S92 A;  4QUT A;  5EA1 A;  3RCW A;  3HME A;  3D1D A;  4HXM A;  1F68 A;  4A9K A;  3HMH A;  2DVV A;  5FE8 A;  4TU6 A;  4N4I A;  5HLS A;  4AKH A;  5IGM A;  4MR6 A;  5CUB A;  5AME A;  5FE5 A;  3Q2F A;  5E73 A;  5FDZ A;  2OUO A;  2WP2 A;  5E74 A;  4TZ2 A;  4UYF B;  5F62 A;  5LJ2 A;  4NYV A;  4NR6 A;  4HXO A;  4UYD A;  5EWV A;  4YH3 A;  4O71 A;  5F61 A;  4NS5 A;  4A9J A;  5F36 A;  5I83 A;  4IR3 A;  4AI6 A;  5LVR A;  4O7B A;  4UIW A;  5EIS A;  4QZS A;  3LQI A;  4CUQ A;  3O35 A;  5DFD A;  5EQ1 A;  5HQ7 A;  4Z1S A;  4LDF A;  2RNY A;  5FB1 A;  4QBM A;  4RVR A;  5DW2 A;  4YY4 A;  1PUO A;  4YAB A;  4O72 A;  5FB0 A;  1JM4 B;  3ERR A;  3U5K A;  2DWW A;  4OGI A;  5EP7 A;  5I88 A;  2DAT A;  4NXJ A;  5E9K A;  5I89 A;  2D82 A;  3AQA A;  5CS8 A;  2I7K A;  5F63 A;  4YYG A;  5I40 A;  5DY7 A;  4MEQ A;  5ENE A;  5L98 A;  2YQD A;  4O7F A;  4A9N A;  5FE6 A;  2DVR A;  5HRV A;  2F6J A;  4N3W A;  2KTB B;  5LJ0 A;  3LQJ A;  4AKG A;  4F3I A;  5ENH A;  5KU3 A;  4GPJ A;  3MUK A;  5FE4 A;  4O77 A;  4PKL A;  2MJV B;  4QB3 A;  5D3H A;  5EWW A;  5H1V A;  5FE2 A;  5E0R A;  2R0S A;  3JVJ A;  5FG5 A;  5HRW A;  4YY6 A;  4HXL A;  4IOR A;  3UW9 A;  4UYF A;  5A5S A;  4YYH A;  5I1Q A;  3QZS A;  5JI8 A;  4BHW A;  5G4R A;  4Z6H A;  5ETB A;  3AAD A;  2RS9 B;  4YYD A;  4A9F A;  5HEL A;  3UV2 A;  4A9O A;  5CQ8 A;  4NQM A;  4O76 A;  5CUC A;  3U5N A;  5IID A;  5AD2 A;  5A83 A;  5II1 A;  3G0J A;  1ZKR A;  3O36 A;  5HRX A;  5I7X A;  4CUP A;  3U5O A;  4QEV A;  3GG3 A;  3P5O A;  5EWH A;  4UIX A;  5DYU A;  5DFB A;  5A82 A;  5CQ4 A;  5F60 A;  4WHW A;  5DLX A;  4TQN A;  5A81 A;  5FE1 A;  4PTB A;  4A9I A;  4QC1 A;  5E3G A;  5I86 A;  5D3L A;  4C67 A;  5FFV A;  3UVX A;  4MEO A;  5L99 A;  5A5N A;  5CQ5 A;  1ZS5 A;  4CUR A;  2RI7 A;  4Q0N A;  4QSU A;  3UVY A;  4UIV A;  4IR6 A;  5L97 A;  2L5E A;  4QSV A;  2WP1 A;  5DBM A;  2RNW A;  2OSS A;  4HBV A;  5CFW A;  5I29 A;  5ENJ A;  3LQH A;  5HEM A;  4Z1Q A;  4MR5 A;  4LYW A;  5F2P A;  5KTU A;  5DX4 A;  4X2I A;  5EVA A; 
#chains in the Genus database with same CATH homology
 5CUE A;  4UYG A;  4HXP A;  5CGP A;  5DYC A;  5CQ7 A;  4NQN A;  3P1C A;  3K2J A;  5FE3 A;  5DKD A;  2E7N A;  4XUA A;  5D3J A;  5KTW A;  4QSP A;  3UV5 A;  5BT4 A;  3SVH A;  4YYK A;  5H85 A;  4WIV A;  4BW4 A;  5CPE A;  4YYJ A;  1WUG A;  2H60 A;  5I80 A;  5IGN A;  4YC9 A;  4HBY A;  4TYL A;  4N4H A;  2E3K A;  4A9M A;  5CQT A;  3D7C A;  5F3A A;  5LKX A;  4NR4 A;  4UYH A;  4J0R A;  4LYS A;  4YAD A;  5FFW A;  5FG4 A;  5F1H A;  4C66 A;  5A7C A;  4QYD A;  5FE7 A;  3O33 A;  4AKN A;  3ONI A;  4QSS A;  5E3D A;  4NUE A;  5EIC A;  3Q2E A;  5D3N A;  4QSR A;  4N4G A;  3I3J A;  5K29 A;  5D0C A;  2YEL A;  5CTL A;  4BW2 A;  3O37 A;  4YYI A;  3IU6 A;  4QC3 A;  2R0Y A;  5EV9 A;  4QNS A;  3NXB A;  3DWY A;  5H1T A;  4HXK A;  4CFL A;  4HBX A;  4CLB A;  5FH6 A;  4BJX A;  4PY6 A;  5E9L A;  4LZR A;  5HFQ A;  4IOQ A;  3UV4 A;  4QR3 A;  5CP5 A;  5HQ5 A;  5LKT A;  4PCI A;  5E9M A;  3HMF A;  4UIT A;  5IG6 A;  4NRA A;  4QR5 A;  5IBN A;  4MR3 A;  4YBM A;  5HQ6 A;  4NRB A;  5ENF A;  4QSW A;  5CQ3 A;  5AMF A;  3U5J A;  4WHU A;  5BT5 A;  3U5M A;  5CUG A;  5EPS A;  4YYM A;  5L8T A;  5D3S A;  4CFK A;  5DYX A;  3FKM X;  4A9L A;  4HXS A;  5CQA A;  4QY4 A;  5DLZ A;  4QEU A;  5A85 A;  4OUF A;  5CY9 A;  5A5Q A;  5EK9 A;  4CL9 A;  5HM0 A;  4TT4 A;  4J1P A;  3LJW A;  3MXF A;  4HXR A;  2L85 A;  4IR4 A;  5IGK A;  5CRM A;  4HXN A;  4YAT A;  5EPR A;  4TT6 A;  2DVS A;  4Q0O A;  4O7C A;  5ETD A;  5LJ1 A;  5LUU A;  3U5L A;  5D3T A;  1EQF A;  4XUB A;  4QSX A;  2DVQ A;  4ZC9 A;  5HFR A;  4LYI A;  2I8N A;  4TU4 A;  5KHM A;  2LSP B;  3ZYU A;  5FE9 A;  2RO1 A;  5ENC A;  4YYN A;  3MB4 A;  3UVW A;  4OGJ A;  4XY9 A;  5FH8 A;  2GRC A;  4NR5 A;  3SVG A;  4XYA A;  4QEW A;  4UYE A;  5HEN A;  5ENI A;  4TT2 A;  5C87 A;  1E6I A;  2YW5 A;  5ENB A;  5IGL A;  5FE0 A;  5L8U A;  4CUS A;  5D26 A;  3TLP A;  4ALH A;  4QYL A;  3JVM A;  5EU1 A;  5TCM A;  4TZ8 A;  4YK0 A;  3G0L A;  3MB3 A;  4J3I A;  5EGU A;  4BW1 A;  5A5P A;  5C4Q A;  5CU8 A;  2OO1 A;  5BT3 A;  5FG6 A;  2YEK A;  4HBW A;  4NUD A;  5D25 A;  4YAX A;  5ENG A;  4KCX A;  4MEN A;  5HCL A;  3MQM A;  3O34 A;  4IOO A;  4TS8 A;  3DAI A;  4QUU A;  5C85 A;  4UIZ A;  2YEM A;  4ZW1 A;  2YYN A;  2F6N A;  4LRG A;  5KTX A;  4BW3 A;  5LKU A;  4J0S A;  4ALG A;  4TTE A;  5F5Z A;  3S91 A;  2DKW A;  5FFY A;  2N9G A;  4QST A;  4XY8 A;  4NYW A;  5COI A;  2YDW A;  5EPB A;  5CRZ A;  2RNX A;  4PCE A;  4NUC A;  5KO4 A;  5D3R A;  4DON A;  5J0D A;  4Y03 A;  5DYA A;  5D3P A;  5L96 A;  4NYX A;  5I7Y A;  5FH7 A;  3UVD A;  4E96 A;  3QZT A;  2R10 A;  1X0J A;  4N4F A;  5DKH A;  5EWC A;  5EM3 A;  4O74 A;  5CUD A;  5G4S A;  5FBX A;  5E9Y A;  4YH4 A;  4O7E A;  4LR6 A;  4IR5 A;  5A5R A;  2D9E A;  2R0V A;  4QR4 A;  4QSQ A;  4UIY A;  4KV4 A;  4O70 A;  5C89 A;  4NR9 A;  1WUM A;  2E7O A;  5LKZ A;  4Z6I A;  3JVK A;  5ACY A;  5DW1 A;  3P1D A;  5A5O A;  4ZQL A;  5DKC A;  5CZG A;  5TB6 A;  4A9E A;  2RFJ A;  4Z93 A;  5E7D A;  5E9V A;  5DFC A;  4NRC A;  4LC2 A;  3MUL A;  4YBT A;  5F25 A;  5HJC A;  5F1L A;  5CQ6 A;  2FSA A;  4MR4 A;  5D7X A;  4O75 A;  4UIU A;  3IU5 A;  4LZS A;  4FLP A;  1N72 A;  3P1F A;  3QZV A;  4CUT A;  2G4A A;  5AD3 A;  5E9I A;  2L84 A;  3U5P A;  3LXJ A;  4YBS A;  5EWD A;  4NR7 A;  3SVF A;  4MEP A;  5C8G A;  4KV1 A;  4PS5 A;  5H1U A;  4CUU A;  5JWM A;  3JVL A;  5CUA A;  5LVQ A;  5C7N A;  1JSP B;  4O7A A;  5II2 A;  2NXB A;  4O78 A;  5D24 A;  4A9H A;  5EI4 A;  3P1E A;  4NR8 A;  4LZ2 A;  3S92 A;  4QUT A;  5EA1 A;  3RCW A;  3HME A;  4HXM A;  1F68 A;  4A9K A;  3HMH A;  2DVV A;  5FE8 A;  4TU6 A;  4N4I A;  5HLS A;  5IGM A;  4MR6 A;  5CUB A;  5AME A;  5FE5 A;  3Q2F A;  5E73 A;  5FDZ A;  2OUO A;  2WP2 A;  5E74 A;  4TZ2 A;  4UYF B;  5F62 A;  5LJ2 A;  4NYV A;  4NR6 A;  4HXO A;  4UYD A;  5EWV A;  4YH3 A;  4O71 A;  5F61 A;  4NS5 A;  4A9J A;  5F36 A;  5I83 A;  4IR3 A;  5LVR A;  4O7B A;  4UIW A;  5EIS A;  4QZS A;  3LQI A;  4CUQ A;  3O35 A;  5DFD A;  5EQ1 A;  5HQ7 A;  4Z1S A;  4LDF A;  2RNY A;  5FB1 A;  4QBM A;  4RVR A;  5DW2 A;  4YY4 A;  4YAB A;  4O72 A;  5FB0 A;  1JM4 B;  3U5K A;  2DWW A;  4OGI A;  5EP7 A;  5I88 A;  2DAT A;  4NXJ A;  5E9K A;  5I89 A;  2D82 A;  3AQA A;  5CS8 A;  2I7K A;  5F63 A;  4YYG A;  5I40 A;  5DY7 A;  4MEQ A;  5ENE A;  5L98 A;  2YQD A;  4O7F A;  4A9N A;  5FE6 A;  2DVR A;  5HRV A;  2F6J A;  4N3W A;  2KTB B;  5LJ0 A;  3LQJ A;  4F3I A;  5ENH A;  5KU3 A;  4GPJ A;  3MUK A;  5FE4 A;  4O77 A;  4PKL A;  2MJV B;  4QB3 A;  5D3H A;  5EWW A;  5H1V A;  5FE2 A;  5E0R A;  2R0S A;  3JVJ A;  5FG5 A;  5HRW A;  4YY6 A;  4HXL A;  4IOR A;  3UW9 A;  4UYF A;  5A5S A;  4YYH A;  5I1Q A;  3QZS A;  5JI8 A;  4BHW A;  5G4R A;  4Z6H A;  5ETB A;  3AAD A;  2RS9 B;  4YYD A;  4A9F A;  5HEL A;  3UV2 A;  4A9O A;  5CQ8 A;  4NQM A;  4O76 A;  5CUC A;  3U5N A;  5IID A;  5AD2 A;  5A83 A;  5II1 A;  3G0J A;  3O36 A;  5HRX A;  5I7X A;  4CUP A;  3U5O A;  4QEV A;  3GG3 A;  3P5O A;  5EWH A;  4UIX A;  5DYU A;  5DFB A;  5A82 A;  5CQ4 A;  5F60 A;  4WHW A;  5DLX A;  4TQN A;  5A81 A;  5FE1 A;  4PTB A;  4A9I A;  4QC1 A;  5E3G A;  5I86 A;  5D3L A;  4C67 A;  5FFV A;  3UVX A;  4MEO A;  5L99 A;  5A5N A;  5CQ5 A;  1ZS5 A;  4CUR A;  2RI7 A;  4Q0N A;  4QSU A;  3UVY A;  4UIV A;  4IR6 A;  5L97 A;  2L5E A;  4QSV A;  2WP1 A;  5DBM A;  2RNW A;  2OSS A;  4HBV A;  5CFW A;  5I29 A;  5ENJ A;  3LQH A;  5HEM A;  4Z1Q A;  4MR5 A;  4LYW A;  5F2P A;  5KTU A;  5DX4 A;  4X2I A;  5EVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...