5ETBA

Crystal structure of the human brpf1 bromodomain in complex with seed13
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5etbA00
4CFLA 5E9IA 5KU3A 5LJ1A 3QZTA 2R0YA 3Q2FA 5A7CA 5CP5A 3IU6A 3SVHA 4OGIA 5BT4A 2DKWA 4N3WA 4QSRA 3P1DA 5EVAA 4NR5A 4NS5A 5EPSA 4QR4A 4ALHA 5FE0A 5DX4A 3QZSA 5EWDA 5C4QA 5DFDA 3JVJA 5DKDA 4LRGA 5IGKA 4BHWA 4YC9A 5BT3A 3Q2EA 3P1CA 4UYHA 4CUTA 2I8NA 4HBXA 5A5PA 5AD3A 1JM4B 5ENEA 5CS8A 4BW1A 4QSXA 4NR4A 5E3DA 3O34A 5E74A 4UYFA 5D26A 4OUFA 4TTEA 5HLSA 2RNYA 2E7NA 5CQ8A 4NXJA 4TT4A 5I88A 5FH6A 5F25A 5CTLA 3U5LA 4A9EA 4LYIA 2RNXA 5FG6A 4X2IA 5D25A 4A9HA 5C7NA 5FE5A 5I7YA 5FE2A 4ZQLA 5A5SA 4WHWA 3O35A 5FH8A 5FE1A 5FE9A 4UITA 5IGMA 4A9KA 5CUAA 5CQ7A 4HBYA 4UIXA 4IR5A 4O7FA 4QUUA 5ETDA 5HJCA 3AQAA 5C87A 4Y03A 5TB6A 2DVVA 4YH3A 4MR3A 4O70A 3UVXA 4N4GA 1E6IA 4LZ2A 3UW9A 4A9MA 5A81A 4NR8A 4MENA 4O7BA 5IGNA 5FB1A 4XYAA 4KV4A 5EM3A 3UVYA 4A9FA 4Z6HA 4NRCA 4TU4A 4RVRA 4XUBA 5CQ4A 4YY4A 5G4RA 4J3IA 5IG6A 3MXFA 4QY4A 5EICA 3MB3A 5H1TA 4O72A 5HQ6A 5F5ZA 4QSSA 5FE8A 4YYKA 5C89A 5FE6A 5FE3A 4XY8A 3I3JA 5HENA 4HXNA 3O37A 5A83A 4A9JA 4BW3A 5FH7A 5EGUA 4CUSA 5IGLA 3SVGA 5F60A 3HMEA 4O76A 5KO4A 4QEUA 3D7CA 5AD2A 5EPBA 4UYDA 3UV2A 4Z1QA 5I1QA 2E3KA 5KHMA 5HQ5A 4HXLA 5CQ6A 3U5MA 4YYHA 2DVQA 5EPRA 5L8UA 4LZRA 4QSQA 4UYGA 4PKLA 3ONIA 1X0JA 4O7AA 4MR6A 4UIUA 2L84A 5HQ7A 5HRWA 2N9GA 5I80A 3P1FA 5IBNA 4TZ2A 1ZS5A 5FG4A 4YYIA 3HMHA 4YBSA 4Z93A 5E0RA 2I7KA 4YK0A 4NUDA 2WP2A 3DWYA 3MB4A 5K29A 4OGJA 5DLXA 3LQJA 4O74A 4NQNA 4BJXA 4QC3A 4DONA 5HM0A 5E9MA 5ENHA 4O71A 4YY6A 3U5NA 4BW2A 5D3LA 2H60A 5CUBA 4HXPA 3TLPA 4QB3A 4HXOA 4AKNA 5CQAA 2RFJA 4XY9A 5LKUA 4A9IA 4YBTA 5L99A 3G0JA 3JVLA 4O75A 5ETBA 4PS5A 2E7OA 5LJ2A 4PTBA 5E9LA 2D82A 4TQNA 3LQHA 5CY9A 1EQFA 5EISA 4LR6A 4QUTA 4QSWA 4YYGA 3ZYUA 4E96A 5HCLA 2F6NA 5FBXA 5FE4A 5EWHA 4GPJA 5D3SA 5L98A 4LDFA 4TZ8A 5DBMA 5I86A 5II1A 2YW5A 4NUEA 4HBVA 4FLPA 5F2PA 4NYVA 2YDWA 2MJVB 3UV4A 4C66A 4KV1A 3UVDA 4QSUA 4MEQA 4BW4A 4HXSA 3FKMX 4LYSA 4A9NA 4N4HA 5E3GA 2YQDA 3U5PA 4HXKA 4PY6A 5CUEA 5HEMA 5E9KA 4IORA 5ENJA 4NYWA 5LKZA 2DATA 5DKCA 4YATA 4QC1A 3JVKA 4QEVA 5F3AA 5CUGA 4HBWA 3RCWA 5A5OA 3MQMA 3U5KA 5DFCA 5FFYA 5H1UA 4N4FA 5FFWA 4TU6A 5G4SA 5H85A 4J1PA 5FG5A 5F1HA 5ENCA 3UVWA 5C85A 3NXBA 4QBMA 5FDZA 5A5NA 4IOOA 3U5OA 2RI7A 3K2JA 5J0DA 5DKHA 2KTBB 5L8TA 2NXBA 3UV5A 4YYDA 5CFWA 4MEPA 4QYLA 4CLBA 5CGPA 4UIVA 5D0CA 5EI4A 4O7CA 5HRXA 4LZSA 5JI8A 5ENBA 5DYCA 4NRAA 1WUMA 5D7XA 3LQIA 5KTWA 5E9VA 3HMFA 5LKXA 5CRZA 5HRVA 4CURA 2GRCA 5FFVA 4QSTA 4F3IA 4YYNA 4UYEA 3U5JA 5DYAA 2DWWA 5I40A 4NRBA 5EWWA 4Q0NA 5A5RA 4UIYA 1N72A 4UYFB 5ENIA 5CUDA 5EV9A 3MUKA 4QNSA 5F36A 4YABA 5JWMA 2R10A 2OO1A 2YYNA 1WUGA 5HFRA 2RS9B 4MR4A 2LSPB 4NR6A 3P1EA 2OSSA 5DY7A 5COIA 4NR7A 3LXJA 4J0RA 1F68A 5TCMA 5E73A 4NR9A 5I89A 5ENGA 5A82A 5E7DA 2RNWA 4TT6A 4ALGA 3GG3A 3LJWA 4IR3A 5F61A 5EA1A 2D9EA 5BT5A 4QEWA 2YELA 5H1VA 2RO1A 5ENFA 4QZSA 4QSVA 4KCXA 5A85A 4QR5A 4HXMA 4MR5A 5FE7A 5AMEA 4YYJA 5A5QA 3O33A 5F62A 4A9OA 5DW2A 4CL9A 2L5EA 4ZC9A 5EQ1A 4WHUA 5ACYA 4Z6IA 2R0SA 5CQ3A 4NUCA 5I7XA 5I29A 5EWCA 4C67A 5CUCA 5LUUA 5DYUA 5EU1A 4O77A 5D3HA 4ZW1A 5EK9A 4YBMA 5KTUA 3P5OA 5D3JA 3O36A 5CPEA 4WIVA 5DW1A 5DYXA 4Q0OA 3S92A 2OUOA 3AADA 4QR3A 3JVMA 5F63A 4YH4A 5F1LA 4NQMA 5AMFA 4YADA 4Z1SA 5CU8A 2L85A 5D3TA 3MULA 4UIWA 2G4AA 2YEMA 4J0SA 4YAXA 3SVFA 5EP7A 5E9YA 5I83A 5LKTA 3S91A 2DVSA 5HFQA 5EWVA 5II2A 1JSPB 5CQTA 2WP1A 3QZVA 4XUAA 5L97A 4CUPA 5HELA 5LVQA 5L96A 4CFKA 3DAIA 4HXRA 5LVRA 4TS8A 3G0LA 4UIZA 4TT2A 4YYMA 4IR6A 4N4IA 5IIDA 4LYWA 5FB0A 4QSPA 4LC2A 4QYDA 5DLZA 4PCEA 4A9LA 4CUUA 5CZGA 5DFBA 4NYXA 4IR4A 4MEOA 4PCIA 5D3RA 2R0VA 5D3PA 3IU5A 5CRMA 5CQ5A 5D24A 5D3NA 4CUQA 2FSAA 2F6JA 5C8GA 5LJ0A 4TYLA 5KTXA 4O7EA 2YEKA 4O78A 2DVRA 4IOQA
chains in the Genus database with same CATH superfamily
4CFLA 5E9IA 5KU3A 5LJ1A 4AKHA 3QZTA 2R0YA 3Q2FA 5A7CA 5CP5A 3IU6A 3SVHA 4OGIA 5BT4A 2DKWA 4N3WA 4QSRA 3P1DA 5EVAA 4NR5A 4NS5A 5EPSA 4QR4A 4ALHA 5FE0A 5DX4A 3QZSA 5EWDA 5C4QA 5DFDA 3JVJA 5DKDA 4LRGA 5IGKA 4BHWA 4YC9A 5BT3A 3Q2EA 3P1CA 4UYHA 4CUTA 2I8NA 4HBXA 5A5PA 5AD3A 1JM4B 5ENEA 5CS8A 4BW1A 4QSXA 4NR4A 5E3DA 3O34A 5E74A 4UYFA 5D26A 4OUFA 4TTEA 5HLSA 2RNYA 2E7NA 5CQ8A 4NXJA 4TT4A 5I88A 5FH6A 5F25A 5CTLA 3U5LA 4A9EA 4LYIA 2RNXA 5FG6A 4X2IA 5D25A 4A9HA 5C7NA 3VKGA 5FE5A 5I7YA 5FE2A 4ZQLA 5A5SA 4WHWA 3O35A 5FH8A 5FE1A 5FE9A 4UITA 5IGMA 4A9KA 5CUAA 5CQ7A 4HBYA 4UIXA 4IR5A 4O7FA 4QUUA 5ETDA 5HJCA 3AQAA 5C87A 4Y03A 5TB6A 2DVVA 4YH3A 4MR3A 4O70A 3UVXA 4N4GA 1E6IA 4LZ2A 3UW9A 4A9MA 5A81A 4NR8A 4MENA 4O7BA 5IGNA 5FB1A 4XYAA 4KV4A 5EM3A 3UVYA 4A9FA 4Z6HA 4NRCA 4TU4A 4RVRA 4XUBA 5CQ4A 4YY4A 5G4RA 4J3IA 5IG6A 3MXFA 3D1BA 4QY4A 5EICA 3MB3A 5H1TA 4O72A 5HQ6A 5F5ZA 4QSSA 5FE8A 1ZKRA 4YYKA 5C89A 5FE6A 5FE3A 4XY8A 3I3JA 5HENA 4HXNA 3O37A 5A83A 4A9JA 4BW3A 5FH7A 5EGUA 4CUSA 5IGLA 3SVGA 5F60A 3HMEA 4O76A 5KO4A 4QEUA 3D7CA 5AD2A 5EPBA 4UYDA 3UV2A 4Z1QA 5I1QA 2E3KA 5KHMA 5HQ5A 4HXLA 5CQ6A 3U5MA 4YYHA 2DVQA 5EPRA 5L8UA 4LZRA 4QSQA 4UYGA 4PKLA 3ONIA 1X0JA 4O7AA 4MR6A 4UIUA 2L84A 5HQ7A 5HRWA 2N9GA 5I80A 3P1FA 5IBNA 4TZ2A 1ZS5A 5FG4A 4YYIA 3HMHA 4YBSA 4Z93A 5E0RA 2I7KA 4YK0A 4NUDA 2WP2A 3DWYA 3MB4A 5K29A 4OGJA 5DLXA 3LQJA 4O74A 4NQNA 4BJXA 4QC3A 4DONA 5HM0A 5E9MA 5ENHA 4O71A 4YY6A 3U5NA 4BW2A 5D3LA 2H60A 5CUBA 4HXPA 3TLPA 4QB3A 4HXOA 4AKNA 5CQAA 2RFJA 4XY9A 5LKUA 4A9IA 4YBTA 5L99A 3G0JA 3JVLA 4O75A 5ETBA 4PS5A 2E7OA 5LJ2A 4PTBA 5E9LA 2D82A 4TQNA 4AKIA 3LQHA 3ERRA 5CY9A 1EQFA 5EISA 1PUOA 4LR6A 4QUTA 4QSWA 4YYGA 3ZYUA 4E96A 5HCLA 2F6NA 5FBXA 5FE4A 5EWHA 4GPJA 5D3SA 5L98A 4LDFA 4TZ8A 5DBMA 5I86A 5II1A 2YW5A 4NUEA 4HBVA 4FLPA 5F2PA 4NYVA 2YDWA 2MJVB 3UV4A 4C66A 4KV1A 3UVDA 4QSUA 4MEQA 4BW4A 4HXSA 3FKMX 4LYSA 4A9NA 4N4HA 5E3GA 2YQDA 3U5PA 4HXKA 4PY6A 5CUEA 5HEMA 5E9KA 4IORA 5ENJA 4NYWA 5LKZA 2DATA 5DKCA 4YATA 4QC1A 3JVKA 4QEVA 5F3AA 5CUGA 4HBWA 3RCWA 5A5OA 3MQMA 3U5KA 5DFCA 5FFYA 5H1UA 4N4FA 5FFWA 4TU6A 5G4SA 5H85A 4J1PA 5FG5A 5F1HA 5ENCA 3UVWA 5C85A 3NXBA 4QBMA 5FDZA 5A5NA 4IOOA 3D1DA 3U5OA 2RI7A 3K2JA 5J0DA 5DKHA 2KTBB 5L8TA 2NXBA 3UV5A 4YYDA 5CFWA 4MEPA 4QYLA 4CLBA 4AKGA 5CGPA 4UIVA 5D0CA 5EI4A 4O7CA 5HRXA 4LZSA 5JI8A 5ENBA 5DYCA 4NRAA 1WUMA 5D7XA 3LQIA 5KTWA 5E9VA 3HMFA 5LKXA 5CRZA 5HRVA 4CURA 2GRCA 5FFVA 4QSTA 4F3IA 4YYNA 4UYEA 3U5JA 5DYAA 2DWWA 5I40A 4NRBA 5EWWA 4Q0NA 5A5RA 4UIYA 1N72A 4UYFB 5ENIA 5CUDA 5EV9A 3MUKA 4QNSA 5F36A 4YABA 5JWMA 2R10A 2OO1A 2YYNA 1WUGA 5HFRA 2RS9B 4MR4A 2LSPB 4NR6A 3P1EA 2OSSA 5DY7A 5COIA 4NR7A 4AI6A 3LXJA 4J0RA 1F68A 5TCMA 5E73A 4NR9A 5I89A 5ENGA 5A82A 5E7DA 2RNWA 4TT6A 4ALGA 3GG3A 3LJWA 4IR3A 5F61A 5EA1A 2D9EA 5BT5A 4QEWA 2YELA 5H1VA 2RO1A 5ENFA 4QZSA 4QSVA 4KCXA 5A85A 4QR5A 4HXMA 4MR5A 5FE7A 5AMEA 4YYJA 5A5QA 3O33A 5F62A 4A9OA 5DW2A 4CL9A 2L5EA 2EJNA 4ZC9A 5EQ1A 4WHUA 5ACYA 4Z6IA 2R0SA 5CQ3A 4NUCA 5I7XA 5I29A 5EWCA 4C67A 5CUCA 5LUUA 5DYUA 5EU1A 4O77A 5D3HA 4ZW1A 5EK9A 4YBMA 5KTUA 3P5OA 5D3JA 3O36A 5CPEA 4WIVA 5DW1A 5DYXA 4Q0OA 3S92A 2OUOA 3AADA 4QR3A 3JVMA 5F63A 4YH4A 5F1LA 4NQMA 5AMFA 4YADA 4Z1SA 5CU8A 2L85A 5D3TA 3MULA 4UIWA 2G4AA 2YEMA 4J0SA 4YAXA 3SVFA 5EP7A 5E9YA 5I83A 5LKTA 3S91A 2DVSA 5HFQA 3VKHA 5EWVA 5II2A 1JSPB 5CQTA 2WP1A 3QZVA 4XUAA 5L97A 4CUPA 5HELA 5LVQA 5L96A 4CFKA 3DAIA 4HXRA 5LVRA 4TS8A 3G0LA 4UIZA 4TT2A 4YYMA 4IR6A 4N4IA 5IIDA 4LYWA 5FB0A 4QSPA 4LC2A 4QYDA 5DLZA 4PCEA 4A9LA 4CUUA 5CZGA 5DFBA 4NYXA 4IR4A 4MEOA 4PCIA 5D3RA 2R0VA 5D3PA 3IU5A 5CRMA 5CQ5A 5D24A 5D3NA 4CUQA 2FSAA 2F6JA 5C8GA 5LJ0A 4TYLA 5KTXA 4O7EA 2YEKA 4O78A 2DVRA 4IOQA
chains in the Genus database with same CATH topology
4CFLA 5E9IA 5KU3A 5LJ1A 3QZTA 2R0YA 3Q2FA 5A7CA 5CP5A 3IU6A 3SVHA 4OGIA 5BT4A 2DKWA 4N3WA 4QSRA 3P1DA 5EVAA 4NR5A 4NS5A 5EPSA 4QR4A 4ALHA 5FE0A 5DX4A 3QZSA 5EWDA 5C4QA 5DFDA 3JVJA 5DKDA 4LRGA 5IGKA 4BHWA 4YC9A 5BT3A 3Q2EA 3P1CA 4UYHA 4CUTA 2I8NA 4HBXA 5A5PA 5AD3A 1JM4B 5ENEA 5CS8A 4BW1A 4QSXA 4NR4A 5E3DA 3O34A 5E74A 4UYFA 5D26A 4OUFA 4TTEA 5HLSA 2RNYA 2E7NA 5CQ8A 4NXJA 4TT4A 5I88A 5FH6A 5F25A 5CTLA 3U5LA 4A9EA 4LYIA 2RNXA 5FG6A 4X2IA 5D25A 4A9HA 5C7NA 5FE5A 5I7YA 5FE2A 4ZQLA 5A5SA 4WHWA 3O35A 5FH8A 5FE1A 5FE9A 4UITA 5IGMA 4A9KA 5CUAA 5CQ7A 4HBYA 4UIXA 4IR5A 4O7FA 4QUUA 5ETDA 5HJCA 3AQAA 5C87A 4Y03A 5TB6A 2DVVA 4YH3A 4MR3A 4O70A 3UVXA 4N4GA 1E6IA 4LZ2A 3UW9A 4A9MA 5A81A 4NR8A 4MENA 4O7BA 5IGNA 5FB1A 4XYAA 4KV4A 5EM3A 3UVYA 4A9FA 4Z6HA 4NRCA 4TU4A 4RVRA 4XUBA 5CQ4A 4YY4A 5G4RA 4J3IA 5IG6A 3MXFA 4QY4A 5EICA 3MB3A 5H1TA 4O72A 5HQ6A 5F5ZA 4QSSA 5FE8A 4YYKA 5C89A 5FE6A 5FE3A 4XY8A 3I3JA 5HENA 4HXNA 3O37A 5A83A 4A9JA 4BW3A 5FH7A 5EGUA 4CUSA 5IGLA 3SVGA 5F60A 3HMEA 4O76A 5KO4A 4QEUA 3D7CA 5AD2A 5EPBA 4UYDA 3UV2A 4Z1QA 5I1QA 2E3KA 5KHMA 5HQ5A 4HXLA 5CQ6A 3U5MA 4YYHA 2DVQA 5EPRA 5L8UA 4LZRA 4QSQA 4UYGA 4PKLA 3ONIA 1X0JA 4O7AA 4MR6A 4UIUA 2L84A 5HQ7A 5HRWA 2N9GA 5I80A 3P1FA 5IBNA 4TZ2A 1ZS5A 5FG4A 4YYIA 3HMHA 4YBSA 4Z93A 5E0RA 2I7KA 4YK0A 4NUDA 2WP2A 3DWYA 3MB4A 5K29A 4OGJA 5DLXA 3LQJA 4O74A 4NQNA 4BJXA 4QC3A 4DONA 5HM0A 5E9MA 5ENHA 4O71A 4YY6A 3U5NA 4BW2A 5D3LA 2H60A 5CUBA 4HXPA 3TLPA 4QB3A 4HXOA 4AKNA 5CQAA 2RFJA 4XY9A 5LKUA 4A9IA 4YBTA 5L99A 3G0JA 3JVLA 4O75A 5ETBA 4PS5A 2E7OA 5LJ2A 4PTBA 5E9LA 2D82A 4TQNA 3LQHA 5CY9A 1EQFA 5EISA 4LR6A 4QUTA 4QSWA 4YYGA 3ZYUA 4E96A 5HCLA 2F6NA 5FBXA 5FE4A 5EWHA 4GPJA 5D3SA 5L98A 4LDFA 4TZ8A 5DBMA 5I86A 5II1A 2YW5A 4NUEA 4HBVA 4FLPA 5F2PA 4NYVA 2YDWA 2MJVB 3UV4A 4C66A 4KV1A 3UVDA 4QSUA 4MEQA 4BW4A 4HXSA 3FKMX 4LYSA 4A9NA 4N4HA 5E3GA 2YQDA 3U5PA 4HXKA 4PY6A 5CUEA 5HEMA 5E9KA 4IORA 5ENJA 4NYWA 5LKZA 2DATA 5DKCA 4YATA 4QC1A 3JVKA 4QEVA 5F3AA 5CUGA 4HBWA 3RCWA 5A5OA 3MQMA 3U5KA 5DFCA 5FFYA 5H1UA 4N4FA 5FFWA 4TU6A 5G4SA 5H85A 4J1PA 5FG5A 5F1HA 5ENCA 3UVWA 5C85A 3NXBA 4QBMA 5FDZA 5A5NA 4IOOA 3U5OA 2RI7A 3K2JA 5J0DA 5DKHA 2KTBB 5L8TA 2NXBA 3UV5A 4YYDA 5CFWA 4MEPA 4QYLA 4CLBA 5CGPA 4UIVA 5D0CA 5EI4A 4O7CA 5HRXA 4LZSA 5JI8A 5ENBA 5DYCA 4NRAA 1WUMA 5D7XA 3LQIA 5KTWA 5E9VA 3HMFA 5LKXA 5CRZA 5HRVA 4CURA 2GRCA 5FFVA 4QSTA 4F3IA 4YYNA 4UYEA 3U5JA 5DYAA 2DWWA 5I40A 4NRBA 5EWWA 4Q0NA 5A5RA 4UIYA 1N72A 4UYFB 5ENIA 5CUDA 5EV9A 3MUKA 4QNSA 5F36A 4YABA 5JWMA 2R10A 2OO1A 2YYNA 1WUGA 5HFRA 2RS9B 4MR4A 2LSPB 4NR6A 3P1EA 2OSSA 5DY7A 5COIA 4NR7A 3LXJA 4J0RA 1F68A 5TCMA 5E73A 4NR9A 5I89A 5ENGA 5A82A 5E7DA 2RNWA 4TT6A 4ALGA 3GG3A 3LJWA 4IR3A 5F61A 5EA1A 2D9EA 5BT5A 4QEWA 2YELA 5H1VA 2RO1A 5ENFA 4QZSA 4QSVA 4KCXA 5A85A 4QR5A 4HXMA 4MR5A 5FE7A 5AMEA 4YYJA 5A5QA 3O33A 5F62A 4A9OA 5DW2A 4CL9A 2L5EA 4ZC9A 5EQ1A 4WHUA 5ACYA 4Z6IA 2R0SA 5CQ3A 4NUCA 5I7XA 5I29A 5EWCA 4C67A 5CUCA 5LUUA 5DYUA 5EU1A 4O77A 5D3HA 4ZW1A 5EK9A 4YBMA 5KTUA 3P5OA 5D3JA 3O36A 5CPEA 4WIVA 5DW1A 5DYXA 4Q0OA 3S92A 2OUOA 3AADA 4QR3A 3JVMA 5F63A 4YH4A 5F1LA 4NQMA 5AMFA 4YADA 4Z1SA 5CU8A 2L85A 5D3TA 3MULA 4UIWA 2G4AA 2YEMA 4J0SA 4YAXA 3SVFA 5EP7A 5E9YA 5I83A 5LKTA 3S91A 2DVSA 5HFQA 5EWVA 5II2A 1JSPB 5CQTA 2WP1A 3QZVA 4XUAA 5L97A 4CUPA 5HELA 5LVQA 5L96A 4CFKA 3DAIA 4HXRA 5LVRA 4TS8A 3G0LA 4UIZA 4TT2A 4YYMA 4IR6A 4N4IA 5IIDA 4LYWA 5FB0A 4QSPA 4LC2A 4QYDA 5DLZA 4PCEA 4A9LA 4CUUA 5CZGA 5DFBA 4NYXA 4IR4A 4MEOA 4PCIA 5D3RA 2R0VA 5D3PA 3IU5A 5CRMA 5CQ5A 5D24A 5D3NA 4CUQA 2FSAA 2F6JA 5C8GA 5LJ0A 4TYLA 5KTXA 4O7EA 2YEKA 4O78A 2DVRA 4IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFL A;  5E9I A;  5KU3 A;  5LJ1 A;  3QZT A;  2R0Y A;  3Q2F A;  5A7C A;  5CP5 A;  3IU6 A;  3SVH A;  4OGI A;  5BT4 A;  2DKW A;  4N3W A;  4QSR A;  3P1D A;  5EVA A;  4NR5 A;  4NS5 A;  5EPS A;  4QR4 A;  4ALH A;  5FE0 A;  5DX4 A;  3QZS A;  5EWD A;  5C4Q A;  5DFD A;  3JVJ A;  5DKD A;  4LRG A;  5IGK A;  4BHW A;  4YC9 A;  5BT3 A;  3Q2E A;  3P1C A;  4UYH A;  4CUT A;  2I8N A;  4HBX A;  5A5P A;  5AD3 A;  1JM4 B;  5ENE A;  5CS8 A;  4BW1 A;  4QSX A;  4NR4 A;  5E3D A;  3O34 A;  5E74 A;  4UYF A;  5D26 A;  4OUF A;  4TTE A;  5HLS A;  2RNY A;  2E7N A;  5CQ8 A;  4NXJ A;  4TT4 A;  5I88 A;  5FH6 A;  5F25 A;  5CTL A;  3U5L A;  4A9E A;  4LYI A;  2RNX A;  5FG6 A;  4X2I A;  5D25 A;  4A9H A;  5C7N A;  5FE5 A;  5I7Y A;  5FE2 A;  4ZQL A;  5A5S A;  4WHW A;  3O35 A;  5FH8 A;  5FE1 A;  5FE9 A;  4UIT A;  5IGM A;  4A9K A;  5CUA A;  5CQ7 A;  4HBY A;  4UIX A;  4IR5 A;  4O7F A;  4QUU A;  5ETD A;  5HJC A;  3AQA A;  5C87 A;  4Y03 A;  5TB6 A;  2DVV A;  4YH3 A;  4MR3 A;  4O70 A;  3UVX A;  4N4G A;  1E6I A;  4LZ2 A;  3UW9 A;  4A9M A;  5A81 A;  4NR8 A;  4MEN A;  4O7B A;  5IGN A;  5FB1 A;  4XYA A;  4KV4 A;  5EM3 A;  3UVY A;  4A9F A;  4Z6H A;  4NRC A;  4TU4 A;  4RVR A;  4XUB A;  5CQ4 A;  4YY4 A;  5G4R A;  4J3I A;  5IG6 A;  3MXF A;  4QY4 A;  5EIC A;  3MB3 A;  5H1T A;  4O72 A;  5HQ6 A;  5F5Z A;  4QSS A;  5FE8 A;  4YYK A;  5C89 A;  5FE6 A;  5FE3 A;  4XY8 A;  3I3J A;  5HEN A;  4HXN A;  3O37 A;  5A83 A;  4A9J A;  4BW3 A;  5FH7 A;  5EGU A;  4CUS A;  5IGL A;  3SVG A;  5F60 A;  3HME A;  4O76 A;  5KO4 A;  4QEU A;  3D7C A;  5AD2 A;  5EPB A;  4UYD A;  3UV2 A;  4Z1Q A;  5I1Q A;  2E3K A;  5KHM A;  5HQ5 A;  4HXL A;  5CQ6 A;  3U5M A;  4YYH A;  2DVQ A;  5EPR A;  5L8U A;  4LZR A;  4QSQ A;  4UYG A;  4PKL A;  3ONI A;  1X0J A;  4O7A A;  4MR6 A;  4UIU A;  2L84 A;  5HQ7 A;  5HRW A;  2N9G A;  5I80 A;  3P1F A;  5IBN A;  4TZ2 A;  1ZS5 A;  5FG4 A;  4YYI A;  3HMH A;  4YBS A;  4Z93 A;  5E0R A;  2I7K A;  4YK0 A;  4NUD A;  2WP2 A;  3DWY A;  3MB4 A;  5K29 A;  4OGJ A;  5DLX A;  3LQJ A;  4O74 A;  4NQN A;  4BJX A;  4QC3 A;  4DON A;  5HM0 A;  5E9M A;  5ENH A;  4O71 A;  4YY6 A;  3U5N A;  4BW2 A;  5D3L A;  2H60 A;  5CUB A;  4HXP A;  3TLP A;  4QB3 A;  4HXO A;  4AKN A;  5CQA A;  2RFJ A;  4XY9 A;  5LKU A;  4A9I A;  4YBT A;  5L99 A;  3G0J A;  3JVL A;  4O75 A;  5ETB A;  4PS5 A;  2E7O A;  5LJ2 A;  4PTB A;  5E9L A;  2D82 A;  4TQN A;  3LQH A;  5CY9 A;  1EQF A;  5EIS A;  4LR6 A;  4QUT A;  4QSW A;  4YYG A;  3ZYU A;  4E96 A;  5HCL A;  2F6N A;  5FBX A;  5FE4 A;  5EWH A;  4GPJ A;  5D3S A;  5L98 A;  4LDF A;  4TZ8 A;  5DBM A;  5I86 A;  5II1 A;  2YW5 A;  4NUE A;  4HBV A;  4FLP A;  5F2P A;  4NYV A;  2YDW A;  2MJV B;  3UV4 A;  4C66 A;  4KV1 A;  3UVD A;  4QSU A;  4MEQ A;  4BW4 A;  4HXS A;  3FKM X;  4LYS A;  4A9N A;  4N4H A;  5E3G A;  2YQD A;  3U5P A;  4HXK A;  4PY6 A;  5CUE A;  5HEM A;  5E9K A;  4IOR A;  5ENJ A;  4NYW A;  5LKZ A;  2DAT A;  5DKC A;  4YAT A;  4QC1 A;  3JVK A;  4QEV A;  5F3A A;  5CUG A;  4HBW A;  3RCW A;  5A5O A;  3MQM A;  3U5K A;  5DFC A;  5FFY A;  5H1U A;  4N4F A;  5FFW A;  4TU6 A;  5G4S A;  5H85 A;  4J1P A;  5FG5 A;  5F1H A;  5ENC A;  3UVW A;  5C85 A;  3NXB A;  4QBM A;  5FDZ A;  5A5N A;  4IOO A;  3U5O A;  2RI7 A;  3K2J A;  5J0D A;  5DKH A;  2KTB B;  5L8T A;  2NXB A;  3UV5 A;  4YYD A;  5CFW A;  4MEP A;  4QYL A;  4CLB A;  5CGP A;  4UIV A;  5D0C A;  5EI4 A;  4O7C A;  5HRX A;  4LZS A;  5JI8 A;  5ENB A;  5DYC A;  4NRA A;  1WUM A;  5D7X A;  3LQI A;  5KTW A;  5E9V A;  3HMF A;  5LKX A;  5CRZ A;  5HRV A;  4CUR A;  2GRC A;  5FFV A;  4QST A;  4F3I A;  4YYN A;  4UYE A;  3U5J A;  5DYA A;  2DWW A;  5I40 A;  4NRB A;  5EWW A;  4Q0N A;  5A5R A;  4UIY A;  1N72 A;  4UYF B;  5ENI A;  5CUD A;  5EV9 A;  3MUK A;  4QNS A;  5F36 A;  4YAB A;  5JWM A;  2R10 A;  2OO1 A;  2YYN A;  1WUG A;  5HFR A;  2RS9 B;  4MR4 A;  2LSP B;  4NR6 A;  3P1E A;  2OSS A;  5DY7 A;  5COI A;  4NR7 A;  3LXJ A;  4J0R A;  1F68 A;  5TCM A;  5E73 A;  4NR9 A;  5I89 A;  5ENG A;  5A82 A;  5E7D A;  2RNW A;  4TT6 A;  4ALG A;  3GG3 A;  3LJW A;  4IR3 A;  5F61 A;  5EA1 A;  2D9E A;  5BT5 A;  4QEW A;  2YEL A;  5H1V A;  2RO1 A;  5ENF A;  4QZS A;  4QSV A;  4KCX A;  5A85 A;  4QR5 A;  4HXM A;  4MR5 A;  5FE7 A;  5AME A;  4YYJ A;  5A5Q A;  3O33 A;  5F62 A;  4A9O A;  5DW2 A;  4CL9 A;  2L5E A;  4ZC9 A;  5EQ1 A;  4WHU A;  5ACY A;  4Z6I A;  2R0S A;  5CQ3 A;  4NUC A;  5I7X A;  5I29 A;  5EWC A;  4C67 A;  5CUC A;  5LUU A;  5DYU A;  5EU1 A;  4O77 A;  5D3H A;  4ZW1 A;  5EK9 A;  4YBM A;  5KTU A;  3P5O A;  5D3J A;  3O36 A;  5CPE A;  4WIV A;  5DW1 A;  5DYX A;  4Q0O A;  3S92 A;  2OUO A;  3AAD A;  4QR3 A;  3JVM A;  5F63 A;  4YH4 A;  5F1L A;  4NQM A;  5AMF A;  4YAD A;  4Z1S A;  5CU8 A;  2L85 A;  5D3T A;  3MUL A;  4UIW A;  2G4A A;  2YEM A;  4J0S A;  4YAX A;  3SVF A;  5EP7 A;  5E9Y A;  5I83 A;  5LKT A;  3S91 A;  2DVS A;  5HFQ A;  5EWV A;  5II2 A;  1JSP B;  5CQT A;  2WP1 A;  3QZV A;  4XUA A;  5L97 A;  4CUP A;  5HEL A;  5LVQ A;  5L96 A;  4CFK A;  3DAI A;  4HXR A;  5LVR A;  4TS8 A;  3G0L A;  4UIZ A;  4TT2 A;  4YYM A;  4IR6 A;  4N4I A;  5IID A;  4LYW A;  5FB0 A;  4QSP A;  4LC2 A;  4QYD A;  5DLZ A;  4PCE A;  4A9L A;  4CUU A;  5CZG A;  5DFB A;  4NYX A;  4IR4 A;  4MEO A;  4PCI A;  5D3R A;  2R0V A;  5D3P A;  3IU5 A;  5CRM A;  5CQ5 A;  5D24 A;  5D3N A;  4CUQ A;  2FSA A;  2F6J A;  5C8G A;  5LJ0 A;  4TYL A;  5KTX A;  4O7E A;  2YEK A;  4O78 A;  2DVR A;  4IOQ A; 
#chains in the Genus database with same CATH topology
 4CFL A;  5E9I A;  5KU3 A;  5LJ1 A;  4AKH A;  3QZT A;  2R0Y A;  3Q2F A;  5A7C A;  5CP5 A;  3IU6 A;  3SVH A;  4OGI A;  5BT4 A;  2DKW A;  4N3W A;  4QSR A;  3P1D A;  5EVA A;  4NR5 A;  4NS5 A;  5EPS A;  4QR4 A;  4ALH A;  5FE0 A;  5DX4 A;  3QZS A;  5EWD A;  5C4Q A;  5DFD A;  3JVJ A;  5DKD A;  4LRG A;  5IGK A;  4BHW A;  4YC9 A;  5BT3 A;  3Q2E A;  3P1C A;  4UYH A;  4CUT A;  2I8N A;  4HBX A;  5A5P A;  5AD3 A;  1JM4 B;  5ENE A;  5CS8 A;  4BW1 A;  4QSX A;  4NR4 A;  5E3D A;  3O34 A;  5E74 A;  4UYF A;  5D26 A;  4OUF A;  4TTE A;  5HLS A;  2RNY A;  2E7N A;  5CQ8 A;  4NXJ A;  4TT4 A;  5I88 A;  5FH6 A;  5F25 A;  5CTL A;  3U5L A;  4A9E A;  4LYI A;  2RNX A;  5FG6 A;  4X2I A;  5D25 A;  4A9H A;  5C7N A;  3VKG A;  5FE5 A;  5I7Y A;  5FE2 A;  4ZQL A;  5A5S A;  4WHW A;  3O35 A;  5FH8 A;  5FE1 A;  5FE9 A;  4UIT A;  5IGM A;  4A9K A;  5CUA A;  5CQ7 A;  4HBY A;  4UIX A;  4IR5 A;  4O7F A;  4QUU A;  5ETD A;  5HJC A;  3AQA A;  5C87 A;  4Y03 A;  5TB6 A;  2DVV A;  4YH3 A;  4MR3 A;  4O70 A;  3UVX A;  4N4G A;  1E6I A;  4LZ2 A;  3UW9 A;  4A9M A;  5A81 A;  4NR8 A;  4MEN A;  4O7B A;  5IGN A;  5FB1 A;  4XYA A;  4KV4 A;  5EM3 A;  3UVY A;  4A9F A;  4Z6H A;  4NRC A;  4TU4 A;  4RVR A;  4XUB A;  5CQ4 A;  4YY4 A;  5G4R A;  4J3I A;  5IG6 A;  3MXF A;  3D1B A;  4QY4 A;  5EIC A;  3MB3 A;  5H1T A;  4O72 A;  5HQ6 A;  5F5Z A;  4QSS A;  5FE8 A;  1ZKR A;  4YYK A;  5C89 A;  5FE6 A;  5FE3 A;  4XY8 A;  3I3J A;  5HEN A;  4HXN A;  3O37 A;  5A83 A;  4A9J A;  4BW3 A;  5FH7 A;  5EGU A;  4CUS A;  5IGL A;  3SVG A;  5F60 A;  3HME A;  4O76 A;  5KO4 A;  4QEU A;  3D7C A;  5AD2 A;  5EPB A;  4UYD A;  3UV2 A;  4Z1Q A;  5I1Q A;  2E3K A;  5KHM A;  5HQ5 A;  4HXL A;  5CQ6 A;  3U5M A;  4YYH A;  2DVQ A;  5EPR A;  5L8U A;  4LZR A;  4QSQ A;  4UYG A;  4PKL A;  3ONI A;  1X0J A;  4O7A A;  4MR6 A;  4UIU A;  2L84 A;  5HQ7 A;  5HRW A;  2N9G A;  5I80 A;  3P1F A;  5IBN A;  4TZ2 A;  1ZS5 A;  5FG4 A;  4YYI A;  3HMH A;  4YBS A;  4Z93 A;  5E0R A;  2I7K A;  4YK0 A;  4NUD A;  2WP2 A;  3DWY A;  3MB4 A;  5K29 A;  4OGJ A;  5DLX A;  3LQJ A;  4O74 A;  4NQN A;  4BJX A;  4QC3 A;  4DON A;  5HM0 A;  5E9M A;  5ENH A;  4O71 A;  4YY6 A;  3U5N A;  4BW2 A;  5D3L A;  2H60 A;  5CUB A;  4HXP A;  3TLP A;  4QB3 A;  4HXO A;  4AKN A;  5CQA A;  2RFJ A;  4XY9 A;  5LKU A;  4A9I A;  4YBT A;  5L99 A;  3G0J A;  3JVL A;  4O75 A;  5ETB A;  4PS5 A;  2E7O A;  5LJ2 A;  4PTB A;  5E9L A;  2D82 A;  4TQN A;  4AKI A;  3LQH A;  3ERR A;  5CY9 A;  1EQF A;  5EIS A;  1PUO A;  4LR6 A;  4QUT A;  4QSW A;  4YYG A;  3ZYU A;  4E96 A;  5HCL A;  2F6N A;  5FBX A;  5FE4 A;  5EWH A;  4GPJ A;  5D3S A;  5L98 A;  4LDF A;  4TZ8 A;  5DBM A;  5I86 A;  5II1 A;  2YW5 A;  4NUE A;  4HBV A;  4FLP A;  5F2P A;  4NYV A;  2YDW A;  2MJV B;  3UV4 A;  4C66 A;  4KV1 A;  3UVD A;  4QSU A;  4MEQ A;  4BW4 A;  4HXS A;  3FKM X;  4LYS A;  4A9N A;  4N4H A;  5E3G A;  2YQD A;  3U5P A;  4HXK A;  4PY6 A;  5CUE A;  5HEM A;  5E9K A;  4IOR A;  5ENJ A;  4NYW A;  5LKZ A;  2DAT A;  5DKC A;  4YAT A;  4QC1 A;  3JVK A;  4QEV A;  5F3A A;  5CUG A;  4HBW A;  3RCW A;  5A5O A;  3MQM A;  3U5K A;  5DFC A;  5FFY A;  5H1U A;  4N4F A;  5FFW A;  4TU6 A;  5G4S A;  5H85 A;  4J1P A;  5FG5 A;  5F1H A;  5ENC A;  3UVW A;  5C85 A;  3NXB A;  4QBM A;  5FDZ A;  5A5N A;  4IOO A;  3D1D A;  3U5O A;  2RI7 A;  3K2J A;  5J0D A;  5DKH A;  2KTB B;  5L8T A;  2NXB A;  3UV5 A;  4YYD A;  5CFW A;  4MEP A;  4QYL A;  4CLB A;  4AKG A;  5CGP A;  4UIV A;  5D0C A;  5EI4 A;  4O7C A;  5HRX A;  4LZS A;  5JI8 A;  5ENB A;  5DYC A;  4NRA A;  1WUM A;  5D7X A;  3LQI A;  5KTW A;  5E9V A;  3HMF A;  5LKX A;  5CRZ A;  5HRV A;  4CUR A;  2GRC A;  5FFV A;  4QST A;  4F3I A;  4YYN A;  4UYE A;  3U5J A;  5DYA A;  2DWW A;  5I40 A;  4NRB A;  5EWW A;  4Q0N A;  5A5R A;  4UIY A;  1N72 A;  4UYF B;  5ENI A;  5CUD A;  5EV9 A;  3MUK A;  4QNS A;  5F36 A;  4YAB A;  5JWM A;  2R10 A;  2OO1 A;  2YYN A;  1WUG A;  5HFR A;  2RS9 B;  4MR4 A;  2LSP B;  4NR6 A;  3P1E A;  2OSS A;  5DY7 A;  5COI A;  4NR7 A;  4AI6 A;  3LXJ A;  4J0R A;  1F68 A;  5TCM A;  5E73 A;  4NR9 A;  5I89 A;  5ENG A;  5A82 A;  5E7D A;  2RNW A;  4TT6 A;  4ALG A;  3GG3 A;  3LJW A;  4IR3 A;  5F61 A;  5EA1 A;  2D9E A;  5BT5 A;  4QEW A;  2YEL A;  5H1V A;  2RO1 A;  5ENF A;  4QZS A;  4QSV A;  4KCX A;  5A85 A;  4QR5 A;  4HXM A;  4MR5 A;  5FE7 A;  5AME A;  4YYJ A;  5A5Q A;  3O33 A;  5F62 A;  4A9O A;  5DW2 A;  4CL9 A;  2L5E A;  2EJN A;  4ZC9 A;  5EQ1 A;  4WHU A;  5ACY A;  4Z6I A;  2R0S A;  5CQ3 A;  4NUC A;  5I7X A;  5I29 A;  5EWC A;  4C67 A;  5CUC A;  5LUU A;  5DYU A;  5EU1 A;  4O77 A;  5D3H A;  4ZW1 A;  5EK9 A;  4YBM A;  5KTU A;  3P5O A;  5D3J A;  3O36 A;  5CPE A;  4WIV A;  5DW1 A;  5DYX A;  4Q0O A;  3S92 A;  2OUO A;  3AAD A;  4QR3 A;  3JVM A;  5F63 A;  4YH4 A;  5F1L A;  4NQM A;  5AMF A;  4YAD A;  4Z1S A;  5CU8 A;  2L85 A;  5D3T A;  3MUL A;  4UIW A;  2G4A A;  2YEM A;  4J0S A;  4YAX A;  3SVF A;  5EP7 A;  5E9Y A;  5I83 A;  5LKT A;  3S91 A;  2DVS A;  5HFQ A;  3VKH A;  5EWV A;  5II2 A;  1JSP B;  5CQT A;  2WP1 A;  3QZV A;  4XUA A;  5L97 A;  4CUP A;  5HEL A;  5LVQ A;  5L96 A;  4CFK A;  3DAI A;  4HXR A;  5LVR A;  4TS8 A;  3G0L A;  4UIZ A;  4TT2 A;  4YYM A;  4IR6 A;  4N4I A;  5IID A;  4LYW A;  5FB0 A;  4QSP A;  4LC2 A;  4QYD A;  5DLZ A;  4PCE A;  4A9L A;  4CUU A;  5CZG A;  5DFB A;  4NYX A;  4IR4 A;  4MEO A;  4PCI A;  5D3R A;  2R0V A;  5D3P A;  3IU5 A;  5CRM A;  5CQ5 A;  5D24 A;  5D3N A;  4CUQ A;  2FSA A;  2F6J A;  5C8G A;  5LJ0 A;  4TYL A;  5KTX A;  4O7E A;  2YEK A;  4O78 A;  2DVR A;  4IOQ A; 
#chains in the Genus database with same CATH homology
 4CFL A;  5E9I A;  5KU3 A;  5LJ1 A;  3QZT A;  2R0Y A;  3Q2F A;  5A7C A;  5CP5 A;  3IU6 A;  3SVH A;  4OGI A;  5BT4 A;  2DKW A;  4N3W A;  4QSR A;  3P1D A;  5EVA A;  4NR5 A;  4NS5 A;  5EPS A;  4QR4 A;  4ALH A;  5FE0 A;  5DX4 A;  3QZS A;  5EWD A;  5C4Q A;  5DFD A;  3JVJ A;  5DKD A;  4LRG A;  5IGK A;  4BHW A;  4YC9 A;  5BT3 A;  3Q2E A;  3P1C A;  4UYH A;  4CUT A;  2I8N A;  4HBX A;  5A5P A;  5AD3 A;  1JM4 B;  5ENE A;  5CS8 A;  4BW1 A;  4QSX A;  4NR4 A;  5E3D A;  3O34 A;  5E74 A;  4UYF A;  5D26 A;  4OUF A;  4TTE A;  5HLS A;  2RNY A;  2E7N A;  5CQ8 A;  4NXJ A;  4TT4 A;  5I88 A;  5FH6 A;  5F25 A;  5CTL A;  3U5L A;  4A9E A;  4LYI A;  2RNX A;  5FG6 A;  4X2I A;  5D25 A;  4A9H A;  5C7N A;  5FE5 A;  5I7Y A;  5FE2 A;  4ZQL A;  5A5S A;  4WHW A;  3O35 A;  5FH8 A;  5FE1 A;  5FE9 A;  4UIT A;  5IGM A;  4A9K A;  5CUA A;  5CQ7 A;  4HBY A;  4UIX A;  4IR5 A;  4O7F A;  4QUU A;  5ETD A;  5HJC A;  3AQA A;  5C87 A;  4Y03 A;  5TB6 A;  2DVV A;  4YH3 A;  4MR3 A;  4O70 A;  3UVX A;  4N4G A;  1E6I A;  4LZ2 A;  3UW9 A;  4A9M A;  5A81 A;  4NR8 A;  4MEN A;  4O7B A;  5IGN A;  5FB1 A;  4XYA A;  4KV4 A;  5EM3 A;  3UVY A;  4A9F A;  4Z6H A;  4NRC A;  4TU4 A;  4RVR A;  4XUB A;  5CQ4 A;  4YY4 A;  5G4R A;  4J3I A;  5IG6 A;  3MXF A;  4QY4 A;  5EIC A;  3MB3 A;  5H1T A;  4O72 A;  5HQ6 A;  5F5Z A;  4QSS A;  5FE8 A;  4YYK A;  5C89 A;  5FE6 A;  5FE3 A;  4XY8 A;  3I3J A;  5HEN A;  4HXN A;  3O37 A;  5A83 A;  4A9J A;  4BW3 A;  5FH7 A;  5EGU A;  4CUS A;  5IGL A;  3SVG A;  5F60 A;  3HME A;  4O76 A;  5KO4 A;  4QEU A;  3D7C A;  5AD2 A;  5EPB A;  4UYD A;  3UV2 A;  4Z1Q A;  5I1Q A;  2E3K A;  5KHM A;  5HQ5 A;  4HXL A;  5CQ6 A;  3U5M A;  4YYH A;  2DVQ A;  5EPR A;  5L8U A;  4LZR A;  4QSQ A;  4UYG A;  4PKL A;  3ONI A;  1X0J A;  4O7A A;  4MR6 A;  4UIU A;  2L84 A;  5HQ7 A;  5HRW A;  2N9G A;  5I80 A;  3P1F A;  5IBN A;  4TZ2 A;  1ZS5 A;  5FG4 A;  4YYI A;  3HMH A;  4YBS A;  4Z93 A;  5E0R A;  2I7K A;  4YK0 A;  4NUD A;  2WP2 A;  3DWY A;  3MB4 A;  5K29 A;  4OGJ A;  5DLX A;  3LQJ A;  4O74 A;  4NQN A;  4BJX A;  4QC3 A;  4DON A;  5HM0 A;  5E9M A;  5ENH A;  4O71 A;  4YY6 A;  3U5N A;  4BW2 A;  5D3L A;  2H60 A;  5CUB A;  4HXP A;  3TLP A;  4QB3 A;  4HXO A;  4AKN A;  5CQA A;  2RFJ A;  4XY9 A;  5LKU A;  4A9I A;  4YBT A;  5L99 A;  3G0J A;  3JVL A;  4O75 A;  5ETB A;  4PS5 A;  2E7O A;  5LJ2 A;  4PTB A;  5E9L A;  2D82 A;  4TQN A;  3LQH A;  5CY9 A;  1EQF A;  5EIS A;  4LR6 A;  4QUT A;  4QSW A;  4YYG A;  3ZYU A;  4E96 A;  5HCL A;  2F6N A;  5FBX A;  5FE4 A;  5EWH A;  4GPJ A;  5D3S A;  5L98 A;  4LDF A;  4TZ8 A;  5DBM A;  5I86 A;  5II1 A;  2YW5 A;  4NUE A;  4HBV A;  4FLP A;  5F2P A;  4NYV A;  2YDW A;  2MJV B;  3UV4 A;  4C66 A;  4KV1 A;  3UVD A;  4QSU A;  4MEQ A;  4BW4 A;  4HXS A;  3FKM X;  4LYS A;  4A9N A;  4N4H A;  5E3G A;  2YQD A;  3U5P A;  4HXK A;  4PY6 A;  5CUE A;  5HEM A;  5E9K A;  4IOR A;  5ENJ A;  4NYW A;  5LKZ A;  2DAT A;  5DKC A;  4YAT A;  4QC1 A;  3JVK A;  4QEV A;  5F3A A;  5CUG A;  4HBW A;  3RCW A;  5A5O A;  3MQM A;  3U5K A;  5DFC A;  5FFY A;  5H1U A;  4N4F A;  5FFW A;  4TU6 A;  5G4S A;  5H85 A;  4J1P A;  5FG5 A;  5F1H A;  5ENC A;  3UVW A;  5C85 A;  3NXB A;  4QBM A;  5FDZ A;  5A5N A;  4IOO A;  3U5O A;  2RI7 A;  3K2J A;  5J0D A;  5DKH A;  2KTB B;  5L8T A;  2NXB A;  3UV5 A;  4YYD A;  5CFW A;  4MEP A;  4QYL A;  4CLB A;  5CGP A;  4UIV A;  5D0C A;  5EI4 A;  4O7C A;  5HRX A;  4LZS A;  5JI8 A;  5ENB A;  5DYC A;  4NRA A;  1WUM A;  5D7X A;  3LQI A;  5KTW A;  5E9V A;  3HMF A;  5LKX A;  5CRZ A;  5HRV A;  4CUR A;  2GRC A;  5FFV A;  4QST A;  4F3I A;  4YYN A;  4UYE A;  3U5J A;  5DYA A;  2DWW A;  5I40 A;  4NRB A;  5EWW A;  4Q0N A;  5A5R A;  4UIY A;  1N72 A;  4UYF B;  5ENI A;  5CUD A;  5EV9 A;  3MUK A;  4QNS A;  5F36 A;  4YAB A;  5JWM A;  2R10 A;  2OO1 A;  2YYN A;  1WUG A;  5HFR A;  2RS9 B;  4MR4 A;  2LSP B;  4NR6 A;  3P1E A;  2OSS A;  5DY7 A;  5COI A;  4NR7 A;  3LXJ A;  4J0R A;  1F68 A;  5TCM A;  5E73 A;  4NR9 A;  5I89 A;  5ENG A;  5A82 A;  5E7D A;  2RNW A;  4TT6 A;  4ALG A;  3GG3 A;  3LJW A;  4IR3 A;  5F61 A;  5EA1 A;  2D9E A;  5BT5 A;  4QEW A;  2YEL A;  5H1V A;  2RO1 A;  5ENF A;  4QZS A;  4QSV A;  4KCX A;  5A85 A;  4QR5 A;  4HXM A;  4MR5 A;  5FE7 A;  5AME A;  4YYJ A;  5A5Q A;  3O33 A;  5F62 A;  4A9O A;  5DW2 A;  4CL9 A;  2L5E A;  4ZC9 A;  5EQ1 A;  4WHU A;  5ACY A;  4Z6I A;  2R0S A;  5CQ3 A;  4NUC A;  5I7X A;  5I29 A;  5EWC A;  4C67 A;  5CUC A;  5LUU A;  5DYU A;  5EU1 A;  4O77 A;  5D3H A;  4ZW1 A;  5EK9 A;  4YBM A;  5KTU A;  3P5O A;  5D3J A;  3O36 A;  5CPE A;  4WIV A;  5DW1 A;  5DYX A;  4Q0O A;  3S92 A;  2OUO A;  3AAD A;  4QR3 A;  3JVM A;  5F63 A;  4YH4 A;  5F1L A;  4NQM A;  5AMF A;  4YAD A;  4Z1S A;  5CU8 A;  2L85 A;  5D3T A;  3MUL A;  4UIW A;  2G4A A;  2YEM A;  4J0S A;  4YAX A;  3SVF A;  5EP7 A;  5E9Y A;  5I83 A;  5LKT A;  3S91 A;  2DVS A;  5HFQ A;  5EWV A;  5II2 A;  1JSP B;  5CQT A;  2WP1 A;  3QZV A;  4XUA A;  5L97 A;  4CUP A;  5HEL A;  5LVQ A;  5L96 A;  4CFK A;  3DAI A;  4HXR A;  5LVR A;  4TS8 A;  3G0L A;  4UIZ A;  4TT2 A;  4YYM A;  4IR6 A;  4N4I A;  5IID A;  4LYW A;  5FB0 A;  4QSP A;  4LC2 A;  4QYD A;  5DLZ A;  4PCE A;  4A9L A;  4CUU A;  5CZG A;  5DFB A;  4NYX A;  4IR4 A;  4MEO A;  4PCI A;  5D3R A;  2R0V A;  5D3P A;  3IU5 A;  5CRM A;  5CQ5 A;  5D24 A;  5D3N A;  4CUQ A;  2FSA A;  2F6J A;  5C8G A;  5LJ0 A;  4TYL A;  5KTX A;  4O7E A;  2YEK A;  4O78 A;  2DVR A;  4IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...