5I86A

Crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02778174
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords CREB-binding protein
publication title Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637).
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i86A00
5L96A 4N3WA 5CQ8A 5F5ZA 5LVRA 5H1UA 5G4SA 2L85A 5EPSA 4OUFA 1JM4B 4YYJA 4BW3A 4TT6A 5A5SA 5CUGA 4A9HA 4QUTA 4MR4A 4YYMA 5F60A 4E96A 4QR5A 4Q0NA 2DKWA 5LVQA 2DVQA 4OGIA 5CS8A 5DKHA 5DFDA 4Q0OA 2YYNA 5D3NA 5E7DA 1ZS5A 4ALHA 3MB4A 5CQ4A 5I40A 5EVAA 5H85A 4QSWA 2YEMA 2OO1A 5DLZA 4O7AA 3JVKA 5COIA 4PY6A 3LQJA 3DAIA 4HXKA 5E74A 4N4FA 4MEOA 5FG5A 4AKNA 2YW5A 4LDFA 2DATA 5ENBA 4A9KA 5D7XA 4NR5A 4O7EA 5AMEA 4CUQA 3HMHA 4UIWA 4NYWA 4DONA 5CRMA 5KTXA 5DYAA 3NXBA 3U5MA 3ZYUA 3RCWA 4CLBA 4CUSA 5E3DA 2G4AA 4O74A 4IOQA 5E9YA 4J0SA 5F25A 5E9MA 5D3RA 3O33A 3U5LA 4O7FA 5KO4A 4QSSA 4C66A 5FE2A 4XUBA 3FKMX 4BW1A 5DFBA 2E7OA 5F63A 5IGLA 4O72A 2RNXA 5DFCA 5LKZA 5D3HA 5ENHA 5EK9A 5IGKA 4MR6A 4LYIA 4TS8A 2YDWA 5HCLA 5BT4A 5FE4A 5I7XA 5L8TA 2NXBA 2D9EA 5FDZA 3D7CA 5CU8A 5CUCA 5BT5A 5LJ2A 3JVLA 5A5RA 3P1DA 5D3SA 5AD3A 4YBTA 5C7NA 2MJVB 5ETDA 5D0CA 3MB3A 2RS9B 3IU6A 5EWWA 4WHUA 4CUUA 4MEQA 2YELA 5I7YA 3UV4A 4NR8A 3TLPA 5HRWA 5LJ1A 5I86A 3UV2A 4UYFB 3U5OA 2L84A 4QYDA 4TTEA 5A5PA 4Y03A 5LKTA 5E9VA 4IORA 4QB3A 4UIUA 2DVVA 5F61A 5EP7A 5CQ6A 4IR6A 4A9LA 4WIVA 5DLXA 5DKCA 5HQ6A 4XYAA 4O76A 4IR4A 4YYKA 3P5OA 5EISA 5IBNA 4HXOA 2RFJA 1F68A 4J0RA 5HRXA 3HMFA 4QR3A 5I88A 4MR5A 4HXSA 4A9NA 4O70A 5L97A 5ENIA 1N72A 2N9GA 5CQ3A 5E9LA 5HLSA 5HM0A 2R10A 4YYHA 4PTBA 5A81A 2F6JA 4A9IA 5FE5A 3JVJA 2I8NA 4J3IA 5FG4A 4YABA 4CURA 5K29A 4NR9A 4NYVA 3HMEA 4QEVA 4YK0A 4UIYA 3P1EA 4XY9A 4NUEA 4LZSA 4NR6A 5FE3A 3U5PA 3O36A 5BT3A 3AQAA 5LJ0A 5E9KA 5FB1A 3QZTA 5FFVA 5CFWA 3U5JA 5A5QA 3MQMA 4NUDA 5C87A 5FG6A 2RNWA 5CQAA 1X0JA 5HRVA 4YC9A 4YATA 4UYDA 4GPJA 4WHWA 5IGNA 3UVWA 3K2JA 4J1PA 4O78A 2WP1A 3MUKA 4QEUA 4QC1A 5EU1A 4NYXA 2L5EA 3UV5A 5DW1A 4NQNA 4PKLA 5JI8A 5FE6A 5EGUA 4QUUA 5D3JA 5CQTA 3LQHA 5D3TA 4NRBA 5DKDA 5CP5A 4QEWA 5DW2A 4PCEA 5DBMA 4IOOA 4MR3A 3O34A 4QSRA 5EWCA 2R0SA 4TZ2A 2R0YA 5D25A 3SVHA 5JWMA 4BW4A 4NRAA 3UVDA 5EI4A 4LZ2A 3UVYA 3ONIA 5II1A 5LUUA 4NQMA 5F2PA 2RO1A 3G0LA 4TU4A 4YADA 4UYEA 5H1TA 4QC3A 4YY6A 2R0VA 4HBVA 5CUDA 4O71A 4O7CA 5DY7A 4QSQA 1EQFA 5C8GA 5HQ5A 4CUPA 5FH7A 5C4QA 4O77A 1E6IA 5E9IA 5L98A 2DVRA 4YY4A 5A82A 4UIXA 4Z6IA 4YAXA 4YH4A 5CRZA 5DYUA 4OGJA 3IU5A 4QSXA 4BW2A 5FFWA 5A7CA 5AD2A 3JVMA 3MULA 5E3GA 3Q2FA 3U5KA 5D26A 4TT4A 4HXNA 5CTLA 5HEMA 5HFRA 4HBWA 5II2A 5A83A 2E3KA 4HXRA 4F3IA 5KTUA 4IR3A 5FE0A 4KV4A 3UVXA 4NXJA 5A5OA 4ZC9A 4QNSA 4IR5A 5TB6A 4LRGA 4YH3A 4N4HA 5EPBA 2GRCA 4Z93A 5ENFA 4A9MA 5LKXA 5FE7A 4QZSA 5D24A 4Z1QA 4PS5A 4Z1SA 5EWDA 4LC2A 2D82A 5I83A 4TU6A 5E0RA 4HXLA 4TT2A 4N4GA 5I80A 5DYXA 4A9FA 4C67A 5I89A 5HJCA 5ENCA 4QYLA 4UIVA 5LKUA 5A5NA 4MENA 2LSPB 5EICA 5CY9A 4UYFA 5DYCA 5KHMA 4A9EA 5ETBA 5FH8A 5CUEA 5FE1A 4QSPA 3MXFA 5IG6A 4LR6A 5EV9A 5CPEA 4KCXA 2OUOA 5IGMA 4RVRA 2E7NA 3P1FA 4UIZA 5EWVA 5CQ7A 5D3LA 4NRCA 5H1VA 4LYWA 5I29A 5EA1A 5ENJA 4CL9A 4FLPA 3LXJA 3LJWA 5KU3A 4HBXA 5EM3A 4A9OA 5G4RA 4QSVA 5FE8A 4QBMA 5A85A 3G0JA 4UITA 5CZGA 3AADA 3O35A 5D3PA 4CFLA 4HXMA 2YEKA 2KTBB 5F3AA 2YQDA 3S91A 3DWYA 5ENGA 5KTWA 5F36A 4N4IA 4TQNA 4NS5A 5EWHA 5HELA 2I7KA 4YBMA 4O7BA 5CUBA 3SVGA 2RI7A 4UYGA 4MEPA 3LQIA 5CQ5A 4NR7A 4UYHA 3Q2EA 3QZSA 4QSTA 5FH6A 5AMFA 4QY4A 4O75A 5HFQA 4Z6HA 5EQ1A 4XY8A 4XUAA 5HENA 5ENEA 4YYIA 4X2IA 5ACYA 4NR4A 5E73A 3SVFA 3I3JA 1WUMA 4YYGA 3GG3A 5CUAA 4CFKA 1JSPB 2F6NA 5I1QA 2WP2A 4KV1A 2OSSA 5J0DA 3UW9A 4TZ8A 4A9JA 4CUTA 4LZRA 5F62A 4YYNA 3P1CA 5C85A 2DVSA 4HXPA 4ZQLA 4BJXA 5F1HA 5F1LA 4BHWA 4YYDA 5TCMA 5L99A 5CGPA 3S92A 5FFYA 5FE9A 4QSUA 4ALGA 2FSAA 5DX4A 3O37A 5C89A 5EPRA 2H60A 1WUGA 4LYSA 5L8UA 4ZW1A 5HQ7A 3QZVA 5IIDA 5FB0A 2DWWA 4QR4A 2RNYA 4YBSA 3U5NA 4HBYA 5FBXA 4TYLA 4NUCA 4PCIA
chains in the Genus database with same CATH superfamily
5L96A 4N3WA 5CQ8A 5F5ZA 5LVRA 5H1UA 5G4SA 2L85A 3ERRA 5EPSA 4OUFA 1JM4B 4YYJA 4BW3A 4TT6A 4AKGA 5A5SA 5CUGA 4A9HA 4QUTA 4MR4A 4YYMA 5F60A 4E96A 4QR5A 4Q0NA 2DKWA 5LVQA 2DVQA 4OGIA 5CS8A 5DKHA 5DFDA 4Q0OA 2YYNA 1ZKRA 5D3NA 5E7DA 1ZS5A 4ALHA 3MB4A 5CQ4A 5I40A 5EVAA 5H85A 4QSWA 2YEMA 2OO1A 5DLZA 4O7AA 3JVKA 3D1DA 5COIA 4PY6A 3LQJA 3DAIA 4HXKA 5E74A 4N4FA 4MEOA 5FG5A 4AKNA 2YW5A 4LDFA 2DATA 5ENBA 4A9KA 5D7XA 4NR5A 4O7EA 5AMEA 4CUQA 3HMHA 4UIWA 4NYWA 4DONA 5CRMA 5KTXA 5DYAA 3NXBA 3U5MA 3ZYUA 3RCWA 4CLBA 4CUSA 5E3DA 2G4AA 4O74A 4IOQA 5E9YA 4J0SA 5F25A 5E9MA 5D3RA 3O33A 3U5LA 4O7FA 5KO4A 4QSSA 4C66A 5FE2A 4XUBA 3FKMX 4BW1A 5DFBA 2E7OA 5F63A 5IGLA 4O72A 2RNXA 5DFCA 5LKZA 5D3HA 5ENHA 5EK9A 5IGKA 4MR6A 4LYIA 4TS8A 2YDWA 5HCLA 5BT4A 5FE4A 5I7XA 5L8TA 2NXBA 2D9EA 5FDZA 3D7CA 5CU8A 5CUCA 5BT5A 5LJ2A 3JVLA 5A5RA 3P1DA 5D3SA 5AD3A 4YBTA 5C7NA 2MJVB 5ETDA 5D0CA 3MB3A 2RS9B 3IU6A 5EWWA 4WHUA 4CUUA 4MEQA 2YELA 5I7YA 3UV4A 4NR8A 3TLPA 5HRWA 5LJ1A 5I86A 3UV2A 4UYFB 3U5OA 2L84A 4QYDA 4TTEA 5A5PA 4Y03A 5LKTA 5E9VA 4IORA 4QB3A 4UIUA 2DVVA 5F61A 5EP7A 5CQ6A 4IR6A 4A9LA 4WIVA 5DLXA 5DKCA 5HQ6A 4XYAA 4O76A 4IR4A 4YYKA 3P5OA 5EISA 5IBNA 4HXOA 2RFJA 1F68A 4J0RA 5HRXA 3HMFA 4QR3A 5I88A 4MR5A 4HXSA 4A9NA 4O70A 5L97A 5ENIA 1N72A 2N9GA 5CQ3A 5E9LA 5HLSA 5HM0A 2R10A 4YYHA 4PTBA 5A81A 2F6JA 4A9IA 5FE5A 3JVJA 2I8NA 4J3IA 5FG4A 4YABA 4CURA 5K29A 4NR9A 4NYVA 3HMEA 4QEVA 4YK0A 4UIYA 3P1EA 4XY9A 4NUEA 4LZSA 4NR6A 5FE3A 3U5PA 3O36A 5BT3A 3AQAA 5LJ0A 5E9KA 5FB1A 3QZTA 5FFVA 5CFWA 3U5JA 5A5QA 3MQMA 4NUDA 5C87A 5FG6A 2RNWA 5CQAA 1X0JA 5HRVA 4YC9A 4YATA 4UYDA 4GPJA 4WHWA 5IGNA 3UVWA 3K2JA 4J1PA 4O78A 3D1BA 2WP1A 3MUKA 4QEUA 4QC1A 5EU1A 4NYXA 2L5EA 3UV5A 5DW1A 4NQNA 4PKLA 5JI8A 5FE6A 5EGUA 4QUUA 5D3JA 5CQTA 3LQHA 5D3TA 4NRBA 5DKDA 5CP5A 4QEWA 5DW2A 4PCEA 4AI6A 5DBMA 4IOOA 4MR3A 3O34A 4QSRA 5EWCA 2R0SA 4TZ2A 2R0YA 5D25A 3SVHA 5JWMA 4BW4A 4NRAA 3UVDA 5EI4A 4LZ2A 3UVYA 3ONIA 5II1A 5LUUA 4NQMA 5F2PA 2RO1A 3G0LA 4TU4A 4YADA 4UYEA 5H1TA 4QC3A 4YY6A 2R0VA 4HBVA 5CUDA 4O71A 4O7CA 5DY7A 4QSQA 1EQFA 5C8GA 5HQ5A 4CUPA 5FH7A 5C4QA 4O77A 1E6IA 5E9IA 5L98A 2DVRA 4YY4A 5A82A 4UIXA 4Z6IA 4YAXA 4YH4A 5CRZA 5DYUA 4OGJA 3IU5A 4QSXA 4BW2A 5FFWA 5A7CA 5AD2A 3JVMA 3MULA 5E3GA 3Q2FA 3U5KA 5D26A 4TT4A 4HXNA 5CTLA 5HEMA 5HFRA 4HBWA 5II2A 5A83A 2E3KA 4HXRA 4F3IA 5KTUA 4IR3A 5FE0A 4KV4A 3UVXA 4NXJA 5A5OA 4ZC9A 4QNSA 4IR5A 5TB6A 4LRGA 2EJNA 4YH3A 4N4HA 5EPBA 2GRCA 4Z93A 5ENFA 4A9MA 5LKXA 5FE7A 4QZSA 5D24A 4Z1QA 4PS5A 4Z1SA 5EWDA 4LC2A 2D82A 5I83A 4TU6A 5E0RA 4HXLA 4TT2A 4N4GA 5I80A 5DYXA 4A9FA 4C67A 5I89A 5HJCA 5ENCA 4QYLA 4UIVA 3VKGA 5LKUA 5A5NA 4MENA 2LSPB 5EICA 5CY9A 4UYFA 5DYCA 5KHMA 4A9EA 5ETBA 5FH8A 5CUEA 5FE1A 4QSPA 3MXFA 5IG6A 4LR6A 5EV9A 5CPEA 4KCXA 2OUOA 5IGMA 4RVRA 2E7NA 3P1FA 4UIZA 5EWVA 5CQ7A 5D3LA 4NRCA 5H1VA 4LYWA 5I29A 5EA1A 5ENJA 4CL9A 3VKHA 4FLPA 3LXJA 3LJWA 5KU3A 4HBXA 5EM3A 4A9OA 5G4RA 4QSVA 5FE8A 4QBMA 5A85A 3G0JA 4UITA 5CZGA 3AADA 3O35A 5D3PA 4CFLA 4HXMA 2YEKA 2KTBB 5F3AA 2YQDA 3S91A 3DWYA 5ENGA 5KTWA 5F36A 4N4IA 4TQNA 4NS5A 5EWHA 5HELA 2I7KA 4YBMA 4O7BA 5CUBA 3SVGA 2RI7A 4UYGA 4MEPA 3LQIA 5CQ5A 4NR7A 4UYHA 3Q2EA 3QZSA 4QSTA 5FH6A 5AMFA 4QY4A 4O75A 5HFQA 4Z6HA 5EQ1A 4AKHA 4XY8A 4XUAA 5HENA 5ENEA 4YYIA 4X2IA 5ACYA 4NR4A 5E73A 3SVFA 3I3JA 1WUMA 4YYGA 3GG3A 5CUAA 4CFKA 1JSPB 2F6NA 5I1QA 2WP2A 4KV1A 2OSSA 5J0DA 3UW9A 4TZ8A 4A9JA 4CUTA 4LZRA 5F62A 4YYNA 1PUOA 3P1CA 5C85A 2DVSA 4HXPA 4ZQLA 4BJXA 5F1HA 5F1LA 4BHWA 4YYDA 5TCMA 5L99A 5CGPA 3S92A 5FFYA 5FE9A 4QSUA 4ALGA 2FSAA 5DX4A 3O37A 5C89A 5EPRA 2H60A 1WUGA 4LYSA 5L8UA 4ZW1A 5HQ7A 3QZVA 5IIDA 5FB0A 2DWWA 4QR4A 2RNYA 4YBSA 3U5NA 4AKIA 4HBYA 5FBXA 4TYLA 4NUCA 4PCIA
chains in the Genus database with same CATH topology
5L96A 4N3WA 5CQ8A 5F5ZA 5LVRA 5H1UA 5G4SA 2L85A 5EPSA 4OUFA 1JM4B 4YYJA 4BW3A 4TT6A 5A5SA 5CUGA 4A9HA 4QUTA 4MR4A 4YYMA 5F60A 4E96A 4QR5A 4Q0NA 2DKWA 5LVQA 2DVQA 4OGIA 5CS8A 5DKHA 5DFDA 4Q0OA 2YYNA 5D3NA 5E7DA 1ZS5A 4ALHA 3MB4A 5CQ4A 5I40A 5EVAA 5H85A 4QSWA 2YEMA 2OO1A 5DLZA 4O7AA 3JVKA 5COIA 4PY6A 3LQJA 3DAIA 4HXKA 5E74A 4N4FA 4MEOA 5FG5A 4AKNA 2YW5A 4LDFA 2DATA 5ENBA 4A9KA 5D7XA 4NR5A 4O7EA 5AMEA 4CUQA 3HMHA 4UIWA 4NYWA 4DONA 5CRMA 5KTXA 5DYAA 3NXBA 3U5MA 3ZYUA 3RCWA 4CLBA 4CUSA 5E3DA 2G4AA 4O74A 4IOQA 5E9YA 4J0SA 5F25A 5E9MA 5D3RA 3O33A 3U5LA 4O7FA 5KO4A 4QSSA 4C66A 5FE2A 4XUBA 3FKMX 4BW1A 5DFBA 2E7OA 5F63A 5IGLA 4O72A 2RNXA 5DFCA 5LKZA 5D3HA 5ENHA 5EK9A 5IGKA 4MR6A 4LYIA 4TS8A 2YDWA 5HCLA 5BT4A 5FE4A 5I7XA 5L8TA 2NXBA 2D9EA 5FDZA 3D7CA 5CU8A 5CUCA 5BT5A 5LJ2A 3JVLA 5A5RA 3P1DA 5D3SA 5AD3A 4YBTA 5C7NA 2MJVB 5ETDA 5D0CA 3MB3A 2RS9B 3IU6A 5EWWA 4WHUA 4CUUA 4MEQA 2YELA 5I7YA 3UV4A 4NR8A 3TLPA 5HRWA 5LJ1A 5I86A 3UV2A 4UYFB 3U5OA 2L84A 4QYDA 4TTEA 5A5PA 4Y03A 5LKTA 5E9VA 4IORA 4QB3A 4UIUA 2DVVA 5F61A 5EP7A 5CQ6A 4IR6A 4A9LA 4WIVA 5DLXA 5DKCA 5HQ6A 4XYAA 4O76A 4IR4A 4YYKA 3P5OA 5EISA 5IBNA 4HXOA 2RFJA 1F68A 4J0RA 5HRXA 3HMFA 4QR3A 5I88A 4MR5A 4HXSA 4A9NA 4O70A 5L97A 5ENIA 1N72A 2N9GA 5CQ3A 5E9LA 5HLSA 5HM0A 2R10A 4YYHA 4PTBA 5A81A 2F6JA 4A9IA 5FE5A 3JVJA 2I8NA 4J3IA 5FG4A 4YABA 4CURA 5K29A 4NR9A 4NYVA 3HMEA 4QEVA 4YK0A 4UIYA 3P1EA 4XY9A 4NUEA 4LZSA 4NR6A 5FE3A 3U5PA 3O36A 5BT3A 3AQAA 5LJ0A 5E9KA 5FB1A 3QZTA 5FFVA 5CFWA 3U5JA 5A5QA 3MQMA 4NUDA 5C87A 5FG6A 2RNWA 5CQAA 1X0JA 5HRVA 4YC9A 4YATA 4UYDA 4GPJA 4WHWA 5IGNA 3UVWA 3K2JA 4J1PA 4O78A 2WP1A 3MUKA 4QEUA 4QC1A 5EU1A 4NYXA 2L5EA 3UV5A 5DW1A 4NQNA 4PKLA 5JI8A 5FE6A 5EGUA 4QUUA 5D3JA 5CQTA 3LQHA 5D3TA 4NRBA 5DKDA 5CP5A 4QEWA 5DW2A 4PCEA 5DBMA 4IOOA 4MR3A 3O34A 4QSRA 5EWCA 2R0SA 4TZ2A 2R0YA 5D25A 3SVHA 5JWMA 4BW4A 4NRAA 3UVDA 5EI4A 4LZ2A 3UVYA 3ONIA 5II1A 5LUUA 4NQMA 5F2PA 2RO1A 3G0LA 4TU4A 4YADA 4UYEA 5H1TA 4QC3A 4YY6A 2R0VA 4HBVA 5CUDA 4O71A 4O7CA 5DY7A 4QSQA 1EQFA 5C8GA 5HQ5A 4CUPA 5FH7A 5C4QA 4O77A 1E6IA 5E9IA 5L98A 2DVRA 4YY4A 5A82A 4UIXA 4Z6IA 4YAXA 4YH4A 5CRZA 5DYUA 4OGJA 3IU5A 4QSXA 4BW2A 5FFWA 5A7CA 5AD2A 3JVMA 3MULA 5E3GA 3Q2FA 3U5KA 5D26A 4TT4A 4HXNA 5CTLA 5HEMA 5HFRA 4HBWA 5II2A 5A83A 2E3KA 4HXRA 4F3IA 5KTUA 4IR3A 5FE0A 4KV4A 3UVXA 4NXJA 5A5OA 4ZC9A 4QNSA 4IR5A 5TB6A 4LRGA 4YH3A 4N4HA 5EPBA 2GRCA 4Z93A 5ENFA 4A9MA 5LKXA 5FE7A 4QZSA 5D24A 4Z1QA 4PS5A 4Z1SA 5EWDA 4LC2A 2D82A 5I83A 4TU6A 5E0RA 4HXLA 4TT2A 4N4GA 5I80A 5DYXA 4A9FA 4C67A 5I89A 5HJCA 5ENCA 4QYLA 4UIVA 5LKUA 5A5NA 4MENA 2LSPB 5EICA 5CY9A 4UYFA 5DYCA 5KHMA 4A9EA 5ETBA 5FH8A 5CUEA 5FE1A 4QSPA 3MXFA 5IG6A 4LR6A 5EV9A 5CPEA 4KCXA 2OUOA 5IGMA 4RVRA 2E7NA 3P1FA 4UIZA 5EWVA 5CQ7A 5D3LA 4NRCA 5H1VA 4LYWA 5I29A 5EA1A 5ENJA 4CL9A 4FLPA 3LXJA 3LJWA 5KU3A 4HBXA 5EM3A 4A9OA 5G4RA 4QSVA 5FE8A 4QBMA 5A85A 3G0JA 4UITA 5CZGA 3AADA 3O35A 5D3PA 4CFLA 4HXMA 2YEKA 2KTBB 5F3AA 2YQDA 3S91A 3DWYA 5ENGA 5KTWA 5F36A 4N4IA 4TQNA 4NS5A 5EWHA 5HELA 2I7KA 4YBMA 4O7BA 5CUBA 3SVGA 2RI7A 4UYGA 4MEPA 3LQIA 5CQ5A 4NR7A 4UYHA 3Q2EA 3QZSA 4QSTA 5FH6A 5AMFA 4QY4A 4O75A 5HFQA 4Z6HA 5EQ1A 4XY8A 4XUAA 5HENA 5ENEA 4YYIA 4X2IA 5ACYA 4NR4A 5E73A 3SVFA 3I3JA 1WUMA 4YYGA 3GG3A 5CUAA 4CFKA 1JSPB 2F6NA 5I1QA 2WP2A 4KV1A 2OSSA 5J0DA 3UW9A 4TZ8A 4A9JA 4CUTA 4LZRA 5F62A 4YYNA 3P1CA 5C85A 2DVSA 4HXPA 4ZQLA 4BJXA 5F1HA 5F1LA 4BHWA 4YYDA 5TCMA 5L99A 5CGPA 3S92A 5FFYA 5FE9A 4QSUA 4ALGA 2FSAA 5DX4A 3O37A 5C89A 5EPRA 2H60A 1WUGA 4LYSA 5L8UA 4ZW1A 5HQ7A 3QZVA 5IIDA 5FB0A 2DWWA 4QR4A 2RNYA 4YBSA 3U5NA 4HBYA 5FBXA 4TYLA 4NUCA 4PCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L96 A;  4N3W A;  5CQ8 A;  5F5Z A;  5LVR A;  5H1U A;  5G4S A;  2L85 A;  5EPS A;  4OUF A;  1JM4 B;  4YYJ A;  4BW3 A;  4TT6 A;  5A5S A;  5CUG A;  4A9H A;  4QUT A;  4MR4 A;  4YYM A;  5F60 A;  4E96 A;  4QR5 A;  4Q0N A;  2DKW A;  5LVQ A;  2DVQ A;  4OGI A;  5CS8 A;  5DKH A;  5DFD A;  4Q0O A;  2YYN A;  5D3N A;  5E7D A;  1ZS5 A;  4ALH A;  3MB4 A;  5CQ4 A;  5I40 A;  5EVA A;  5H85 A;  4QSW A;  2YEM A;  2OO1 A;  5DLZ A;  4O7A A;  3JVK A;  5COI A;  4PY6 A;  3LQJ A;  3DAI A;  4HXK A;  5E74 A;  4N4F A;  4MEO A;  5FG5 A;  4AKN A;  2YW5 A;  4LDF A;  2DAT A;  5ENB A;  4A9K A;  5D7X A;  4NR5 A;  4O7E A;  5AME A;  4CUQ A;  3HMH A;  4UIW A;  4NYW A;  4DON A;  5CRM A;  5KTX A;  5DYA A;  3NXB A;  3U5M A;  3ZYU A;  3RCW A;  4CLB A;  4CUS A;  5E3D A;  2G4A A;  4O74 A;  4IOQ A;  5E9Y A;  4J0S A;  5F25 A;  5E9M A;  5D3R A;  3O33 A;  3U5L A;  4O7F A;  5KO4 A;  4QSS A;  4C66 A;  5FE2 A;  4XUB A;  3FKM X;  4BW1 A;  5DFB A;  2E7O A;  5F63 A;  5IGL A;  4O72 A;  2RNX A;  5DFC A;  5LKZ A;  5D3H A;  5ENH A;  5EK9 A;  5IGK A;  4MR6 A;  4LYI A;  4TS8 A;  2YDW A;  5HCL A;  5BT4 A;  5FE4 A;  5I7X A;  5L8T A;  2NXB A;  2D9E A;  5FDZ A;  3D7C A;  5CU8 A;  5CUC A;  5BT5 A;  5LJ2 A;  3JVL A;  5A5R A;  3P1D A;  5D3S A;  5AD3 A;  4YBT A;  5C7N A;  2MJV B;  5ETD A;  5D0C A;  3MB3 A;  2RS9 B;  3IU6 A;  5EWW A;  4WHU A;  4CUU A;  4MEQ A;  2YEL A;  5I7Y A;  3UV4 A;  4NR8 A;  3TLP A;  5HRW A;  5LJ1 A;  5I86 A;  3UV2 A;  4UYF B;  3U5O A;  2L84 A;  4QYD A;  4TTE A;  5A5P A;  4Y03 A;  5LKT A;  5E9V A;  4IOR A;  4QB3 A;  4UIU A;  2DVV A;  5F61 A;  5EP7 A;  5CQ6 A;  4IR6 A;  4A9L A;  4WIV A;  5DLX A;  5DKC A;  5HQ6 A;  4XYA A;  4O76 A;  4IR4 A;  4YYK A;  3P5O A;  5EIS A;  5IBN A;  4HXO A;  2RFJ A;  1F68 A;  4J0R A;  5HRX A;  3HMF A;  4QR3 A;  5I88 A;  4MR5 A;  4HXS A;  4A9N A;  4O70 A;  5L97 A;  5ENI A;  1N72 A;  2N9G A;  5CQ3 A;  5E9L A;  5HLS A;  5HM0 A;  2R10 A;  4YYH A;  4PTB A;  5A81 A;  2F6J A;  4A9I A;  5FE5 A;  3JVJ A;  2I8N A;  4J3I A;  5FG4 A;  4YAB A;  4CUR A;  5K29 A;  4NR9 A;  4NYV A;  3HME A;  4QEV A;  4YK0 A;  4UIY A;  3P1E A;  4XY9 A;  4NUE A;  4LZS A;  4NR6 A;  5FE3 A;  3U5P A;  3O36 A;  5BT3 A;  3AQA A;  5LJ0 A;  5E9K A;  5FB1 A;  3QZT A;  5FFV A;  5CFW A;  3U5J A;  5A5Q A;  3MQM A;  4NUD A;  5C87 A;  5FG6 A;  2RNW A;  5CQA A;  1X0J A;  5HRV A;  4YC9 A;  4YAT A;  4UYD A;  4GPJ A;  4WHW A;  5IGN A;  3UVW A;  3K2J A;  4J1P A;  4O78 A;  2WP1 A;  3MUK A;  4QEU A;  4QC1 A;  5EU1 A;  4NYX A;  2L5E A;  3UV5 A;  5DW1 A;  4NQN A;  4PKL A;  5JI8 A;  5FE6 A;  5EGU A;  4QUU A;  5D3J A;  5CQT A;  3LQH A;  5D3T A;  4NRB A;  5DKD A;  5CP5 A;  4QEW A;  5DW2 A;  4PCE A;  5DBM A;  4IOO A;  4MR3 A;  3O34 A;  4QSR A;  5EWC A;  2R0S A;  4TZ2 A;  2R0Y A;  5D25 A;  3SVH A;  5JWM A;  4BW4 A;  4NRA A;  3UVD A;  5EI4 A;  4LZ2 A;  3UVY A;  3ONI A;  5II1 A;  5LUU A;  4NQM A;  5F2P A;  2RO1 A;  3G0L A;  4TU4 A;  4YAD A;  4UYE A;  5H1T A;  4QC3 A;  4YY6 A;  2R0V A;  4HBV A;  5CUD A;  4O71 A;  4O7C A;  5DY7 A;  4QSQ A;  1EQF A;  5C8G A;  5HQ5 A;  4CUP A;  5FH7 A;  5C4Q A;  4O77 A;  1E6I A;  5E9I A;  5L98 A;  2DVR A;  4YY4 A;  5A82 A;  4UIX A;  4Z6I A;  4YAX A;  4YH4 A;  5CRZ A;  5DYU A;  4OGJ A;  3IU5 A;  4QSX A;  4BW2 A;  5FFW A;  5A7C A;  5AD2 A;  3JVM A;  3MUL A;  5E3G A;  3Q2F A;  3U5K A;  5D26 A;  4TT4 A;  4HXN A;  5CTL A;  5HEM A;  5HFR A;  4HBW A;  5II2 A;  5A83 A;  2E3K A;  4HXR A;  4F3I A;  5KTU A;  4IR3 A;  5FE0 A;  4KV4 A;  3UVX A;  4NXJ A;  5A5O A;  4ZC9 A;  4QNS A;  4IR5 A;  5TB6 A;  4LRG A;  4YH3 A;  4N4H A;  5EPB A;  2GRC A;  4Z93 A;  5ENF A;  4A9M A;  5LKX A;  5FE7 A;  4QZS A;  5D24 A;  4Z1Q A;  4PS5 A;  4Z1S A;  5EWD A;  4LC2 A;  2D82 A;  5I83 A;  4TU6 A;  5E0R A;  4HXL A;  4TT2 A;  4N4G A;  5I80 A;  5DYX A;  4A9F A;  4C67 A;  5I89 A;  5HJC A;  5ENC A;  4QYL A;  4UIV A;  5LKU A;  5A5N A;  4MEN A;  2LSP B;  5EIC A;  5CY9 A;  4UYF A;  5DYC A;  5KHM A;  4A9E A;  5ETB A;  5FH8 A;  5CUE A;  5FE1 A;  4QSP A;  3MXF A;  5IG6 A;  4LR6 A;  5EV9 A;  5CPE A;  4KCX A;  2OUO A;  5IGM A;  4RVR A;  2E7N A;  3P1F A;  4UIZ A;  5EWV A;  5CQ7 A;  5D3L A;  4NRC A;  5H1V A;  4LYW A;  5I29 A;  5EA1 A;  5ENJ A;  4CL9 A;  4FLP A;  3LXJ A;  3LJW A;  5KU3 A;  4HBX A;  5EM3 A;  4A9O A;  5G4R A;  4QSV A;  5FE8 A;  4QBM A;  5A85 A;  3G0J A;  4UIT A;  5CZG A;  3AAD A;  3O35 A;  5D3P A;  4CFL A;  4HXM A;  2YEK A;  2KTB B;  5F3A A;  2YQD A;  3S91 A;  3DWY A;  5ENG A;  5KTW A;  5F36 A;  4N4I A;  4TQN A;  4NS5 A;  5EWH A;  5HEL A;  2I7K A;  4YBM A;  4O7B A;  5CUB A;  3SVG A;  2RI7 A;  4UYG A;  4MEP A;  3LQI A;  5CQ5 A;  4NR7 A;  4UYH A;  3Q2E A;  3QZS A;  4QST A;  5FH6 A;  5AMF A;  4QY4 A;  4O75 A;  5HFQ A;  4Z6H A;  5EQ1 A;  4XY8 A;  4XUA A;  5HEN A;  5ENE A;  4YYI A;  4X2I A;  5ACY A;  4NR4 A;  5E73 A;  3SVF A;  3I3J A;  1WUM A;  4YYG A;  3GG3 A;  5CUA A;  4CFK A;  1JSP B;  2F6N A;  5I1Q A;  2WP2 A;  4KV1 A;  2OSS A;  5J0D A;  3UW9 A;  4TZ8 A;  4A9J A;  4CUT A;  4LZR A;  5F62 A;  4YYN A;  3P1C A;  5C85 A;  2DVS A;  4HXP A;  4ZQL A;  4BJX A;  5F1H A;  5F1L A;  4BHW A;  4YYD A;  5TCM A;  5L99 A;  5CGP A;  3S92 A;  5FFY A;  5FE9 A;  4QSU A;  4ALG A;  2FSA A;  5DX4 A;  3O37 A;  5C89 A;  5EPR A;  2H60 A;  1WUG A;  4LYS A;  5L8U A;  4ZW1 A;  5HQ7 A;  3QZV A;  5IID A;  5FB0 A;  2DWW A;  4QR4 A;  2RNY A;  4YBS A;  3U5N A;  4HBY A;  5FBX A;  4TYL A;  4NUC A;  4PCI A; 
#chains in the Genus database with same CATH topology
 5L96 A;  4N3W A;  5CQ8 A;  5F5Z A;  5LVR A;  5H1U A;  5G4S A;  2L85 A;  3ERR A;  5EPS A;  4OUF A;  1JM4 B;  4YYJ A;  4BW3 A;  4TT6 A;  4AKG A;  5A5S A;  5CUG A;  4A9H A;  4QUT A;  4MR4 A;  4YYM A;  5F60 A;  4E96 A;  4QR5 A;  4Q0N A;  2DKW A;  5LVQ A;  2DVQ A;  4OGI A;  5CS8 A;  5DKH A;  5DFD A;  4Q0O A;  2YYN A;  1ZKR A;  5D3N A;  5E7D A;  1ZS5 A;  4ALH A;  3MB4 A;  5CQ4 A;  5I40 A;  5EVA A;  5H85 A;  4QSW A;  2YEM A;  2OO1 A;  5DLZ A;  4O7A A;  3JVK A;  3D1D A;  5COI A;  4PY6 A;  3LQJ A;  3DAI A;  4HXK A;  5E74 A;  4N4F A;  4MEO A;  5FG5 A;  4AKN A;  2YW5 A;  4LDF A;  2DAT A;  5ENB A;  4A9K A;  5D7X A;  4NR5 A;  4O7E A;  5AME A;  4CUQ A;  3HMH A;  4UIW A;  4NYW A;  4DON A;  5CRM A;  5KTX A;  5DYA A;  3NXB A;  3U5M A;  3ZYU A;  3RCW A;  4CLB A;  4CUS A;  5E3D A;  2G4A A;  4O74 A;  4IOQ A;  5E9Y A;  4J0S A;  5F25 A;  5E9M A;  5D3R A;  3O33 A;  3U5L A;  4O7F A;  5KO4 A;  4QSS A;  4C66 A;  5FE2 A;  4XUB A;  3FKM X;  4BW1 A;  5DFB A;  2E7O A;  5F63 A;  5IGL A;  4O72 A;  2RNX A;  5DFC A;  5LKZ A;  5D3H A;  5ENH A;  5EK9 A;  5IGK A;  4MR6 A;  4LYI A;  4TS8 A;  2YDW A;  5HCL A;  5BT4 A;  5FE4 A;  5I7X A;  5L8T A;  2NXB A;  2D9E A;  5FDZ A;  3D7C A;  5CU8 A;  5CUC A;  5BT5 A;  5LJ2 A;  3JVL A;  5A5R A;  3P1D A;  5D3S A;  5AD3 A;  4YBT A;  5C7N A;  2MJV B;  5ETD A;  5D0C A;  3MB3 A;  2RS9 B;  3IU6 A;  5EWW A;  4WHU A;  4CUU A;  4MEQ A;  2YEL A;  5I7Y A;  3UV4 A;  4NR8 A;  3TLP A;  5HRW A;  5LJ1 A;  5I86 A;  3UV2 A;  4UYF B;  3U5O A;  2L84 A;  4QYD A;  4TTE A;  5A5P A;  4Y03 A;  5LKT A;  5E9V A;  4IOR A;  4QB3 A;  4UIU A;  2DVV A;  5F61 A;  5EP7 A;  5CQ6 A;  4IR6 A;  4A9L A;  4WIV A;  5DLX A;  5DKC A;  5HQ6 A;  4XYA A;  4O76 A;  4IR4 A;  4YYK A;  3P5O A;  5EIS A;  5IBN A;  4HXO A;  2RFJ A;  1F68 A;  4J0R A;  5HRX A;  3HMF A;  4QR3 A;  5I88 A;  4MR5 A;  4HXS A;  4A9N A;  4O70 A;  5L97 A;  5ENI A;  1N72 A;  2N9G A;  5CQ3 A;  5E9L A;  5HLS A;  5HM0 A;  2R10 A;  4YYH A;  4PTB A;  5A81 A;  2F6J A;  4A9I A;  5FE5 A;  3JVJ A;  2I8N A;  4J3I A;  5FG4 A;  4YAB A;  4CUR A;  5K29 A;  4NR9 A;  4NYV A;  3HME A;  4QEV A;  4YK0 A;  4UIY A;  3P1E A;  4XY9 A;  4NUE A;  4LZS A;  4NR6 A;  5FE3 A;  3U5P A;  3O36 A;  5BT3 A;  3AQA A;  5LJ0 A;  5E9K A;  5FB1 A;  3QZT A;  5FFV A;  5CFW A;  3U5J A;  5A5Q A;  3MQM A;  4NUD A;  5C87 A;  5FG6 A;  2RNW A;  5CQA A;  1X0J A;  5HRV A;  4YC9 A;  4YAT A;  4UYD A;  4GPJ A;  4WHW A;  5IGN A;  3UVW A;  3K2J A;  4J1P A;  4O78 A;  3D1B A;  2WP1 A;  3MUK A;  4QEU A;  4QC1 A;  5EU1 A;  4NYX A;  2L5E A;  3UV5 A;  5DW1 A;  4NQN A;  4PKL A;  5JI8 A;  5FE6 A;  5EGU A;  4QUU A;  5D3J A;  5CQT A;  3LQH A;  5D3T A;  4NRB A;  5DKD A;  5CP5 A;  4QEW A;  5DW2 A;  4PCE A;  4AI6 A;  5DBM A;  4IOO A;  4MR3 A;  3O34 A;  4QSR A;  5EWC A;  2R0S A;  4TZ2 A;  2R0Y A;  5D25 A;  3SVH A;  5JWM A;  4BW4 A;  4NRA A;  3UVD A;  5EI4 A;  4LZ2 A;  3UVY A;  3ONI A;  5II1 A;  5LUU A;  4NQM A;  5F2P A;  2RO1 A;  3G0L A;  4TU4 A;  4YAD A;  4UYE A;  5H1T A;  4QC3 A;  4YY6 A;  2R0V A;  4HBV A;  5CUD A;  4O71 A;  4O7C A;  5DY7 A;  4QSQ A;  1EQF A;  5C8G A;  5HQ5 A;  4CUP A;  5FH7 A;  5C4Q A;  4O77 A;  1E6I A;  5E9I A;  5L98 A;  2DVR A;  4YY4 A;  5A82 A;  4UIX A;  4Z6I A;  4YAX A;  4YH4 A;  5CRZ A;  5DYU A;  4OGJ A;  3IU5 A;  4QSX A;  4BW2 A;  5FFW A;  5A7C A;  5AD2 A;  3JVM A;  3MUL A;  5E3G A;  3Q2F A;  3U5K A;  5D26 A;  4TT4 A;  4HXN A;  5CTL A;  5HEM A;  5HFR A;  4HBW A;  5II2 A;  5A83 A;  2E3K A;  4HXR A;  4F3I A;  5KTU A;  4IR3 A;  5FE0 A;  4KV4 A;  3UVX A;  4NXJ A;  5A5O A;  4ZC9 A;  4QNS A;  4IR5 A;  5TB6 A;  4LRG A;  2EJN A;  4YH3 A;  4N4H A;  5EPB A;  2GRC A;  4Z93 A;  5ENF A;  4A9M A;  5LKX A;  5FE7 A;  4QZS A;  5D24 A;  4Z1Q A;  4PS5 A;  4Z1S A;  5EWD A;  4LC2 A;  2D82 A;  5I83 A;  4TU6 A;  5E0R A;  4HXL A;  4TT2 A;  4N4G A;  5I80 A;  5DYX A;  4A9F A;  4C67 A;  5I89 A;  5HJC A;  5ENC A;  4QYL A;  4UIV A;  3VKG A;  5LKU A;  5A5N A;  4MEN A;  2LSP B;  5EIC A;  5CY9 A;  4UYF A;  5DYC A;  5KHM A;  4A9E A;  5ETB A;  5FH8 A;  5CUE A;  5FE1 A;  4QSP A;  3MXF A;  5IG6 A;  4LR6 A;  5EV9 A;  5CPE A;  4KCX A;  2OUO A;  5IGM A;  4RVR A;  2E7N A;  3P1F A;  4UIZ A;  5EWV A;  5CQ7 A;  5D3L A;  4NRC A;  5H1V A;  4LYW A;  5I29 A;  5EA1 A;  5ENJ A;  4CL9 A;  3VKH A;  4FLP A;  3LXJ A;  3LJW A;  5KU3 A;  4HBX A;  5EM3 A;  4A9O A;  5G4R A;  4QSV A;  5FE8 A;  4QBM A;  5A85 A;  3G0J A;  4UIT A;  5CZG A;  3AAD A;  3O35 A;  5D3P A;  4CFL A;  4HXM A;  2YEK A;  2KTB B;  5F3A A;  2YQD A;  3S91 A;  3DWY A;  5ENG A;  5KTW A;  5F36 A;  4N4I A;  4TQN A;  4NS5 A;  5EWH A;  5HEL A;  2I7K A;  4YBM A;  4O7B A;  5CUB A;  3SVG A;  2RI7 A;  4UYG A;  4MEP A;  3LQI A;  5CQ5 A;  4NR7 A;  4UYH A;  3Q2E A;  3QZS A;  4QST A;  5FH6 A;  5AMF A;  4QY4 A;  4O75 A;  5HFQ A;  4Z6H A;  5EQ1 A;  4AKH A;  4XY8 A;  4XUA A;  5HEN A;  5ENE A;  4YYI A;  4X2I A;  5ACY A;  4NR4 A;  5E73 A;  3SVF A;  3I3J A;  1WUM A;  4YYG A;  3GG3 A;  5CUA A;  4CFK A;  1JSP B;  2F6N A;  5I1Q A;  2WP2 A;  4KV1 A;  2OSS A;  5J0D A;  3UW9 A;  4TZ8 A;  4A9J A;  4CUT A;  4LZR A;  5F62 A;  4YYN A;  1PUO A;  3P1C A;  5C85 A;  2DVS A;  4HXP A;  4ZQL A;  4BJX A;  5F1H A;  5F1L A;  4BHW A;  4YYD A;  5TCM A;  5L99 A;  5CGP A;  3S92 A;  5FFY A;  5FE9 A;  4QSU A;  4ALG A;  2FSA A;  5DX4 A;  3O37 A;  5C89 A;  5EPR A;  2H60 A;  1WUG A;  4LYS A;  5L8U A;  4ZW1 A;  5HQ7 A;  3QZV A;  5IID A;  5FB0 A;  2DWW A;  4QR4 A;  2RNY A;  4YBS A;  3U5N A;  4AKI A;  4HBY A;  5FBX A;  4TYL A;  4NUC A;  4PCI A; 
#chains in the Genus database with same CATH homology
 5L96 A;  4N3W A;  5CQ8 A;  5F5Z A;  5LVR A;  5H1U A;  5G4S A;  2L85 A;  5EPS A;  4OUF A;  1JM4 B;  4YYJ A;  4BW3 A;  4TT6 A;  5A5S A;  5CUG A;  4A9H A;  4QUT A;  4MR4 A;  4YYM A;  5F60 A;  4E96 A;  4QR5 A;  4Q0N A;  2DKW A;  5LVQ A;  2DVQ A;  4OGI A;  5CS8 A;  5DKH A;  5DFD A;  4Q0O A;  2YYN A;  5D3N A;  5E7D A;  1ZS5 A;  4ALH A;  3MB4 A;  5CQ4 A;  5I40 A;  5EVA A;  5H85 A;  4QSW A;  2YEM A;  2OO1 A;  5DLZ A;  4O7A A;  3JVK A;  5COI A;  4PY6 A;  3LQJ A;  3DAI A;  4HXK A;  5E74 A;  4N4F A;  4MEO A;  5FG5 A;  4AKN A;  2YW5 A;  4LDF A;  2DAT A;  5ENB A;  4A9K A;  5D7X A;  4NR5 A;  4O7E A;  5AME A;  4CUQ A;  3HMH A;  4UIW A;  4NYW A;  4DON A;  5CRM A;  5KTX A;  5DYA A;  3NXB A;  3U5M A;  3ZYU A;  3RCW A;  4CLB A;  4CUS A;  5E3D A;  2G4A A;  4O74 A;  4IOQ A;  5E9Y A;  4J0S A;  5F25 A;  5E9M A;  5D3R A;  3O33 A;  3U5L A;  4O7F A;  5KO4 A;  4QSS A;  4C66 A;  5FE2 A;  4XUB A;  3FKM X;  4BW1 A;  5DFB A;  2E7O A;  5F63 A;  5IGL A;  4O72 A;  2RNX A;  5DFC A;  5LKZ A;  5D3H A;  5ENH A;  5EK9 A;  5IGK A;  4MR6 A;  4LYI A;  4TS8 A;  2YDW A;  5HCL A;  5BT4 A;  5FE4 A;  5I7X A;  5L8T A;  2NXB A;  2D9E A;  5FDZ A;  3D7C A;  5CU8 A;  5CUC A;  5BT5 A;  5LJ2 A;  3JVL A;  5A5R A;  3P1D A;  5D3S A;  5AD3 A;  4YBT A;  5C7N A;  2MJV B;  5ETD A;  5D0C A;  3MB3 A;  2RS9 B;  3IU6 A;  5EWW A;  4WHU A;  4CUU A;  4MEQ A;  2YEL A;  5I7Y A;  3UV4 A;  4NR8 A;  3TLP A;  5HRW A;  5LJ1 A;  5I86 A;  3UV2 A;  4UYF B;  3U5O A;  2L84 A;  4QYD A;  4TTE A;  5A5P A;  4Y03 A;  5LKT A;  5E9V A;  4IOR A;  4QB3 A;  4UIU A;  2DVV A;  5F61 A;  5EP7 A;  5CQ6 A;  4IR6 A;  4A9L A;  4WIV A;  5DLX A;  5DKC A;  5HQ6 A;  4XYA A;  4O76 A;  4IR4 A;  4YYK A;  3P5O A;  5EIS A;  5IBN A;  4HXO A;  2RFJ A;  1F68 A;  4J0R A;  5HRX A;  3HMF A;  4QR3 A;  5I88 A;  4MR5 A;  4HXS A;  4A9N A;  4O70 A;  5L97 A;  5ENI A;  1N72 A;  2N9G A;  5CQ3 A;  5E9L A;  5HLS A;  5HM0 A;  2R10 A;  4YYH A;  4PTB A;  5A81 A;  2F6J A;  4A9I A;  5FE5 A;  3JVJ A;  2I8N A;  4J3I A;  5FG4 A;  4YAB A;  4CUR A;  5K29 A;  4NR9 A;  4NYV A;  3HME A;  4QEV A;  4YK0 A;  4UIY A;  3P1E A;  4XY9 A;  4NUE A;  4LZS A;  4NR6 A;  5FE3 A;  3U5P A;  3O36 A;  5BT3 A;  3AQA A;  5LJ0 A;  5E9K A;  5FB1 A;  3QZT A;  5FFV A;  5CFW A;  3U5J A;  5A5Q A;  3MQM A;  4NUD A;  5C87 A;  5FG6 A;  2RNW A;  5CQA A;  1X0J A;  5HRV A;  4YC9 A;  4YAT A;  4UYD A;  4GPJ A;  4WHW A;  5IGN A;  3UVW A;  3K2J A;  4J1P A;  4O78 A;  2WP1 A;  3MUK A;  4QEU A;  4QC1 A;  5EU1 A;  4NYX A;  2L5E A;  3UV5 A;  5DW1 A;  4NQN A;  4PKL A;  5JI8 A;  5FE6 A;  5EGU A;  4QUU A;  5D3J A;  5CQT A;  3LQH A;  5D3T A;  4NRB A;  5DKD A;  5CP5 A;  4QEW A;  5DW2 A;  4PCE A;  5DBM A;  4IOO A;  4MR3 A;  3O34 A;  4QSR A;  5EWC A;  2R0S A;  4TZ2 A;  2R0Y A;  5D25 A;  3SVH A;  5JWM A;  4BW4 A;  4NRA A;  3UVD A;  5EI4 A;  4LZ2 A;  3UVY A;  3ONI A;  5II1 A;  5LUU A;  4NQM A;  5F2P A;  2RO1 A;  3G0L A;  4TU4 A;  4YAD A;  4UYE A;  5H1T A;  4QC3 A;  4YY6 A;  2R0V A;  4HBV A;  5CUD A;  4O71 A;  4O7C A;  5DY7 A;  4QSQ A;  1EQF A;  5C8G A;  5HQ5 A;  4CUP A;  5FH7 A;  5C4Q A;  4O77 A;  1E6I A;  5E9I A;  5L98 A;  2DVR A;  4YY4 A;  5A82 A;  4UIX A;  4Z6I A;  4YAX A;  4YH4 A;  5CRZ A;  5DYU A;  4OGJ A;  3IU5 A;  4QSX A;  4BW2 A;  5FFW A;  5A7C A;  5AD2 A;  3JVM A;  3MUL A;  5E3G A;  3Q2F A;  3U5K A;  5D26 A;  4TT4 A;  4HXN A;  5CTL A;  5HEM A;  5HFR A;  4HBW A;  5II2 A;  5A83 A;  2E3K A;  4HXR A;  4F3I A;  5KTU A;  4IR3 A;  5FE0 A;  4KV4 A;  3UVX A;  4NXJ A;  5A5O A;  4ZC9 A;  4QNS A;  4IR5 A;  5TB6 A;  4LRG A;  4YH3 A;  4N4H A;  5EPB A;  2GRC A;  4Z93 A;  5ENF A;  4A9M A;  5LKX A;  5FE7 A;  4QZS A;  5D24 A;  4Z1Q A;  4PS5 A;  4Z1S A;  5EWD A;  4LC2 A;  2D82 A;  5I83 A;  4TU6 A;  5E0R A;  4HXL A;  4TT2 A;  4N4G A;  5I80 A;  5DYX A;  4A9F A;  4C67 A;  5I89 A;  5HJC A;  5ENC A;  4QYL A;  4UIV A;  5LKU A;  5A5N A;  4MEN A;  2LSP B;  5EIC A;  5CY9 A;  4UYF A;  5DYC A;  5KHM A;  4A9E A;  5ETB A;  5FH8 A;  5CUE A;  5FE1 A;  4QSP A;  3MXF A;  5IG6 A;  4LR6 A;  5EV9 A;  5CPE A;  4KCX A;  2OUO A;  5IGM A;  4RVR A;  2E7N A;  3P1F A;  4UIZ A;  5EWV A;  5CQ7 A;  5D3L A;  4NRC A;  5H1V A;  4LYW A;  5I29 A;  5EA1 A;  5ENJ A;  4CL9 A;  4FLP A;  3LXJ A;  3LJW A;  5KU3 A;  4HBX A;  5EM3 A;  4A9O A;  5G4R A;  4QSV A;  5FE8 A;  4QBM A;  5A85 A;  3G0J A;  4UIT A;  5CZG A;  3AAD A;  3O35 A;  5D3P A;  4CFL A;  4HXM A;  2YEK A;  2KTB B;  5F3A A;  2YQD A;  3S91 A;  3DWY A;  5ENG A;  5KTW A;  5F36 A;  4N4I A;  4TQN A;  4NS5 A;  5EWH A;  5HEL A;  2I7K A;  4YBM A;  4O7B A;  5CUB A;  3SVG A;  2RI7 A;  4UYG A;  4MEP A;  3LQI A;  5CQ5 A;  4NR7 A;  4UYH A;  3Q2E A;  3QZS A;  4QST A;  5FH6 A;  5AMF A;  4QY4 A;  4O75 A;  5HFQ A;  4Z6H A;  5EQ1 A;  4XY8 A;  4XUA A;  5HEN A;  5ENE A;  4YYI A;  4X2I A;  5ACY A;  4NR4 A;  5E73 A;  3SVF A;  3I3J A;  1WUM A;  4YYG A;  3GG3 A;  5CUA A;  4CFK A;  1JSP B;  2F6N A;  5I1Q A;  2WP2 A;  4KV1 A;  2OSS A;  5J0D A;  3UW9 A;  4TZ8 A;  4A9J A;  4CUT A;  4LZR A;  5F62 A;  4YYN A;  3P1C A;  5C85 A;  2DVS A;  4HXP A;  4ZQL A;  4BJX A;  5F1H A;  5F1L A;  4BHW A;  4YYD A;  5TCM A;  5L99 A;  5CGP A;  3S92 A;  5FFY A;  5FE9 A;  4QSU A;  4ALG A;  2FSA A;  5DX4 A;  3O37 A;  5C89 A;  5EPR A;  2H60 A;  1WUG A;  4LYS A;  5L8U A;  4ZW1 A;  5HQ7 A;  3QZV A;  5IID A;  5FB0 A;  2DWW A;  4QR4 A;  2RNY A;  4YBS A;  3U5N A;  4HBY A;  5FBX A;  4TYL A;  4NUC A;  4PCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...