4YYMA

Crystal structure of taf1 bd2 bromodomain bound to a butyryllysine peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
DDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 1
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 50
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yymA00
5HLSA 4LZRA 4XY9A 5E9VA 4UYFB 2E7NA 5H1UA 4O7EA 5DFCA 5C8GA 2DVRA 5I80A 5BT5A 5LJ1A 5EPSA 5F62A 4CURA 4YY6A 3S92A 4QSUA 4GPJA 4O7BA 3GG3A 5EA1A 5EU1A 3D7CA 5CUCA 4HXSA 5II1A 4XUBA 4WIVA 5D26A 5DKCA 4UIYA 5LKXA 4BJXA 5LJ2A 5D3SA 5FE2A 3LQIA 3ONIA 5DYUA 4YBMA 5EWWA 3ZYUA 5FE0A 5KO4A 1F68A 4LC2A 5I1QA 4N4HA 5FE4A 4TZ8A 4Z6HA 3LJWA 4O77A 1WUGA 5AMEA 2E7OA 3MULA 4QSRA 4TT6A 5H1VA 4IR3A 5CZGA 4MR5A 5DKDA 4CUQA 4YYKA 5CUBA 3MB3A 3O34A 2GRCA 5HELA 5LKUA 5A81A 4A9FA 2DKWA 4OGIA 4A9EA 4C67A 4HXPA 5FG4A 4HBWA 4A9HA 5C85A 5L8TA 5CY9A 5EWDA 5F61A 5CPEA 4CUSA 3MB4A 4QB3A 4TYLA 4YBTA 5A5NA 4YC9A 4IOOA 2DATA 3O36A 2G4AA 4YATA 2YW5A 4QY4A 5HRXA 5A5PA 5HM0A 2YEMA 4TS8A 4PCEA 5E9YA 4QZSA 5F60A 4MR4A 2R0YA 4BW3A 5I7YA 4QBMA 4HXOA 5A7CA 5FH7A 5G4SA 3MUKA 4O72A 5FH8A 3P1DA 4F3IA 4O7CA 5KTWA 4NYXA 5FFYA 4MENA 2OUOA 4HBXA 4Z1SA 4Y03A 4IORA 5E9MA 3JVLA 5FE8A 2YEKA 5TCMA 5KU3A 4HXMA 3RCWA 4NQMA 5FE3A 4LZSA 5EPRA 5C89A 4HBVA 5A5RA 4LRGA 4X2IA 4O7AA 5F5ZA 4A9KA 3SVGA 5F63A 4A9IA 4DONA 4UIUA 5E9LA 3MXFA 5CQ3A 5EGUA 4QEUA 5D3NA 4CLBA 4WHWA 5CU8A 4NUDA 5EISA 3NXBA 4QYLA 5L98A 5LJ0A 2D82A 4QSTA 2H60A 3HMHA 5FE5A 4LR6A 5DBMA 5E7DA 5HEMA 3UVWA 3P1FA 4NXJA 5IGNA 4O70A 4OGJA 5IG6A 3UVYA 4HXRA 5LVQA 4KV4A 5FG6A 4A9OA 5FB1A 4QNSA 4CUTA 5LUUA 2R0VA 4XY8A 5CQ4A 5CGPA 4LYSA 2YELA 5E3DA 5CFWA 5D3RA 4MR6A 4TQNA 4O76A 4LZ2A 4TTEA 4YABA 3G0LA 4BW1A 5I29A 5I86A 3U5KA 5D3LA 5CQ6A 5DFDA 5KTUA 4O7FA 5A83A 5BT4A 2I8NA 4HBYA 4TT4A 4YAXA 2E3KA 3QZVA 5ENBA 3HMEA 3AQAA 4QEVA 5H1TA 2WP2A 5FFVA 5CUGA 5CRMA 5CQ8A 5D7XA 5E3GA 2DVQA 4QSSA 4YYGA 2WP1A 2R0SA 4FLPA 4YH3A 5EICA 1N72A 2DVVA 2I7KA 5DW1A 3P1CA 4YBSA 4BHWA 4O75A 4TU6A 3LQJA 5I40A 3IU5A 5FBXA 4J0SA 4YYMA 4HXNA 4UYGA 3UV5A 4CL9A 4A9MA 5AD3A 4Z1QA 3U5MA 5TB6A 4CUPA 4QC1A 4N4IA 5D3TA 2YDWA 2RS9B 3P5OA 4TU4A 4AKNA 5DKHA 4XUAA 4NYWA 5DW2A 5CQTA 5ACYA 5E9KA 4C66A 5D25A 2D9EA 4LYWA 4NRCA 1EQFA 5DYAA 5EK9A 5IIDA 2F6NA 5HQ5A 4MEPA 4QEWA 5ENIA 3SVFA 4NUCA 1JSPB 4NR8A 4Z93A 4NR6A 4UITA 5CUAA 4KV1A 5L8UA 5A5SA 4O78A 5F2PA 2MJVB 4IR6A 4NR5A 4NQNA 5LKTA 4CUUA 4Z6IA 4NS5A 4TZ2A 5D24A 5FDZA 4QUTA 5EWHA 2DWWA 2RI7A 4QSXA 1ZS5A 4IOQA 4Q0NA 4QR5A 5EP7A 5E0RA 5L99A 3UVXA 4IR5A 5CUEA 3DWYA 4MEQA 3Q2FA 5E74A 5A5OA 5D0CA 2R10A 4NRAA 4YYIA 3UV4A 2RFJA 4N4FA 5I88A 5DFBA 4WHUA 2DVSA 5IGLA 2L5EA 4RVRA 5KTXA 2NXBA 5D3JA 3JVMA 2RO1A 5IBNA 5F1LA 5IGMA 5COIA 5HFQA 5D3HA 2F6JA 4A9JA 2LSPB 5CUDA 5DY7A 5FH6A 3K2JA 3O33A 5HENA 5HJCA 4YYNA 4PKLA 5KHMA 1X0JA 5I89A 3U5OA 5II2A 5ETDA 4TT2A 4PCIA 4QUUA 5HQ7A 5G4RA 5J0DA 4IR4A 4BW4A 4N4GA 4NR9A 4UIZA 4YYHA 5EV9A 4A9LA 3QZTA 3JVKA 5EWCA 4UIXA 5AD2A 4YK0A 5JWMA 4PY6A 5A85A 5CQ5A 5LVRA 3SVHA 4QSVA 5CQAA 4LDFA 2OSSA 5A82A 2RNYA 4XYAA 3AADA 3U5LA 5EM3A 3LQHA 4UYFA 4ZW1A 5HRVA 3S91A 2RNWA 5I83A 5LKZA 5ENCA 4UIWA 5BT3A 5CS8A 2YQDA 4J0RA 4BW2A 3P1EA 5ETBA 1WUMA 5C4QA 3O35A 3TLPA 5A5QA 5ENHA 5ENJA 4ZC9A 4YYDA 4UYDA 4O71A 4UIVA 4OUFA 3UW9A 4PTBA 3U5JA 5FE6A 5HRWA 3IU6A 5EPBA 5EWVA 4HXLA 3I3JA 4Q0OA 4NR7A 5AMFA 2YYNA 5HCLA 2OO1A 2L85A 4QR3A 5F36A 3FKMX 5K29A 5EVAA 5C7NA 3O37A 4UYEA 5F25A 5F3AA 3U5NA 3QZSA 4NYVA 4NRBA 5L96A 5ENGA 4CFKA 4A9NA 5L97A 4YADA 5FFWA 4HXKA 4ALGA 3UVDA 5DLXA 5DLZA 4CFLA 4QC3A 4O74A 5DX4A 5JI8A 2KTBB 2N9GA 4YY4A 5DYCA 4N3WA 5D3PA 5CTLA 3DAIA 4PS5A 4NUEA 4QR4A 2L84A 4J1PA 4ALHA 3HMFA 5EQ1A 5FB0A 3G0JA 5C87A 2FSAA 1JM4B 4MEOA 5IGKA 5CQ7A 3LXJA 4E96A 3Q2EA 4ZQLA 5FE9A 5DYXA 4MR3A 5F1HA 5ENEA 5I7XA 5CRZA 4UYHA 5HFRA 1E6IA 5CP5A 5E73A 5ENFA 4NR4A 2RNXA 3JVJA 5FE7A 4YH4A 5HQ6A 5EI4A 5FE1A 5FG5A 4LYIA 4QSQA 3U5PA 4QYDA 4J3IA 4QSWA 3MQMA 4QSPA 5E9IA 4YYJA 5H85A 3UV2A 4KCXA
chains in the Genus database with same CATH superfamily
5HLSA 4LZRA 4XY9A 5E9VA 4UYFB 2E7NA 5H1UA 4O7EA 5DFCA 5C8GA 4AKHA 2DVRA 5I80A 5BT5A 5LJ1A 5EPSA 5F62A 4CURA 4YY6A 3S92A 4QSUA 4GPJA 4O7BA 3GG3A 5EA1A 5EU1A 4AKIA 3D7CA 5CUCA 4HXSA 5II1A 4XUBA 4WIVA 5D26A 5DKCA 4UIYA 5LKXA 4BJXA 5LJ2A 5D3SA 5FE2A 3LQIA 1PUOA 3ONIA 5DYUA 4YBMA 5EWWA 3ZYUA 5FE0A 5KO4A 1F68A 3D1BA 4LC2A 5I1QA 4N4HA 5FE4A 4TZ8A 4Z6HA 3LJWA 4O77A 1WUGA 5AMEA 2E7OA 3MULA 4QSRA 4TT6A 5H1VA 4IR3A 5CZGA 4MR5A 5DKDA 4CUQA 4YYKA 5CUBA 3MB3A 3O34A 2GRCA 5HELA 5LKUA 5A81A 4A9FA 2DKWA 4OGIA 4A9EA 4C67A 4HXPA 5FG4A 4HBWA 4A9HA 5C85A 5L8TA 5CY9A 5EWDA 5F61A 5CPEA 4CUSA 3MB4A 4QB3A 4TYLA 4YBTA 5A5NA 4YC9A 4IOOA 2DATA 3O36A 2G4AA 4YATA 2YW5A 4QY4A 3D1DA 5HRXA 5A5PA 5HM0A 2YEMA 4TS8A 4PCEA 5E9YA 4QZSA 5F60A 4MR4A 2R0YA 4BW3A 5I7YA 4QBMA 4HXOA 5A7CA 5FH7A 5G4SA 3MUKA 4O72A 5FH8A 3P1DA 4F3IA 4O7CA 5KTWA 4NYXA 5FFYA 4MENA 2OUOA 4HBXA 4Z1SA 4Y03A 4IORA 5E9MA 3JVLA 5FE8A 2YEKA 5TCMA 5KU3A 4HXMA 3RCWA 4NQMA 5FE3A 4LZSA 5EPRA 5C89A 4HBVA 5A5RA 4LRGA 3VKGA 4X2IA 4O7AA 5F5ZA 4A9KA 3SVGA 5F63A 4A9IA 4DONA 4UIUA 5E9LA 3MXFA 5CQ3A 5EGUA 4QEUA 5D3NA 4CLBA 4WHWA 5CU8A 4NUDA 5EISA 3NXBA 4QYLA 5L98A 5LJ0A 2D82A 4QSTA 2H60A 3HMHA 5FE5A 4LR6A 5DBMA 5E7DA 5HEMA 3UVWA 3P1FA 4NXJA 5IGNA 4O70A 4OGJA 5IG6A 3UVYA 4HXRA 5LVQA 4KV4A 5FG6A 4A9OA 5FB1A 4QNSA 4CUTA 5LUUA 2R0VA 4XY8A 5CQ4A 5CGPA 4LYSA 2YELA 5E3DA 5CFWA 5D3RA 4MR6A 4TQNA 4O76A 4LZ2A 4TTEA 4YABA 3G0LA 4BW1A 5I29A 5I86A 3U5KA 5D3LA 5CQ6A 5DFDA 5KTUA 4O7FA 5A83A 5BT4A 2I8NA 4HBYA 4TT4A 4YAXA 2E3KA 3QZVA 5ENBA 3HMEA 3AQAA 4QEVA 5H1TA 2WP2A 5FFVA 5CUGA 5CRMA 5CQ8A 5D7XA 5E3GA 2DVQA 4QSSA 4YYGA 2WP1A 2R0SA 4FLPA 4YH3A 5EICA 1N72A 2DVVA 2I7KA 5DW1A 3P1CA 4YBSA 4BHWA 4O75A 4TU6A 3LQJA 5I40A 3IU5A 5FBXA 4J0SA 4YYMA 4HXNA 4UYGA 3UV5A 4CL9A 4A9MA 5AD3A 4Z1QA 3U5MA 5TB6A 4CUPA 4QC1A 4N4IA 5D3TA 2YDWA 2RS9B 4AI6A 3P5OA 4TU4A 4AKNA 5DKHA 4XUAA 4NYWA 5DW2A 5CQTA 5ACYA 5E9KA 4C66A 5D25A 2EJNA 2D9EA 4LYWA 4NRCA 1EQFA 5DYAA 5EK9A 5IIDA 2F6NA 5HQ5A 4MEPA 4QEWA 5ENIA 3SVFA 4NUCA 1JSPB 4NR8A 4Z93A 4NR6A 4UITA 5CUAA 4KV1A 5L8UA 5A5SA 4O78A 5F2PA 2MJVB 4IR6A 4NR5A 4NQNA 5LKTA 4CUUA 4Z6IA 4NS5A 4TZ2A 5D24A 5FDZA 4QUTA 5EWHA 2DWWA 2RI7A 4QSXA 1ZS5A 4IOQA 4Q0NA 4QR5A 5EP7A 5E0RA 5L99A 3UVXA 4IR5A 5CUEA 3DWYA 4MEQA 3Q2FA 5E74A 5A5OA 5D0CA 2R10A 4NRAA 4YYIA 3UV4A 2RFJA 4N4FA 5I88A 5DFBA 4WHUA 2DVSA 5IGLA 2L5EA 4RVRA 5KTXA 2NXBA 5D3JA 3JVMA 2RO1A 5IBNA 5F1LA 5IGMA 5COIA 5HFQA 5D3HA 2F6JA 4A9JA 2LSPB 5CUDA 5DY7A 5FH6A 3K2JA 3O33A 5HENA 5HJCA 4YYNA 4PKLA 5KHMA 1X0JA 5I89A 3U5OA 5II2A 5ETDA 4TT2A 4PCIA 4QUUA 5HQ7A 5G4RA 5J0DA 4IR4A 4BW4A 4N4GA 4NR9A 4UIZA 4YYHA 5EV9A 4A9LA 3QZTA 3JVKA 5EWCA 4UIXA 5AD2A 4YK0A 5JWMA 4PY6A 5A85A 5CQ5A 5LVRA 3SVHA 4QSVA 5CQAA 4LDFA 2OSSA 5A82A 2RNYA 4XYAA 3AADA 3U5LA 5EM3A 3LQHA 4UYFA 4ZW1A 5HRVA 3S91A 2RNWA 5I83A 5LKZA 5ENCA 4UIWA 5BT3A 5CS8A 2YQDA 4J0RA 4BW2A 3P1EA 5ETBA 1WUMA 5C4QA 3O35A 3TLPA 5A5QA 5ENHA 5ENJA 4ZC9A 4YYDA 4UYDA 4O71A 4UIVA 4OUFA 3UW9A 4PTBA 3U5JA 5FE6A 5HRWA 3IU6A 5EPBA 5EWVA 4HXLA 3I3JA 4Q0OA 4NR7A 5AMFA 2YYNA 5HCLA 2OO1A 2L85A 4QR3A 5F36A 3FKMX 5K29A 5EVAA 5C7NA 3O37A 1ZKRA 4UYEA 5F25A 5F3AA 3U5NA 3QZSA 3VKHA 4NYVA 4NRBA 5L96A 5ENGA 4CFKA 4A9NA 5L97A 4YADA 5FFWA 4AKGA 4HXKA 4ALGA 3UVDA 5DLXA 5DLZA 4CFLA 4QC3A 4O74A 5DX4A 5JI8A 2KTBB 2N9GA 4YY4A 5DYCA 4N3WA 5D3PA 5CTLA 3DAIA 4PS5A 4NUEA 4QR4A 2L84A 4J1PA 4ALHA 3HMFA 5EQ1A 5FB0A 3G0JA 5C87A 2FSAA 1JM4B 4MEOA 5IGKA 5CQ7A 3LXJA 4E96A 3Q2EA 4ZQLA 5FE9A 5DYXA 4MR3A 5F1HA 5ENEA 5I7XA 5CRZA 4UYHA 5HFRA 1E6IA 5CP5A 5E73A 5ENFA 4NR4A 2RNXA 3JVJA 5FE7A 4YH4A 5HQ6A 5EI4A 5FE1A 5FG5A 4LYIA 4QSQA 3U5PA 4QYDA 4J3IA 4QSWA 3MQMA 4QSPA 5E9IA 4YYJA 5H85A 3UV2A 3ERRA 4KCXA
chains in the Genus database with same CATH topology
5HLSA 4LZRA 4XY9A 5E9VA 4UYFB 2E7NA 5H1UA 4O7EA 5DFCA 5C8GA 2DVRA 5I80A 5BT5A 5LJ1A 5EPSA 5F62A 4CURA 4YY6A 3S92A 4QSUA 4GPJA 4O7BA 3GG3A 5EA1A 5EU1A 3D7CA 5CUCA 4HXSA 5II1A 4XUBA 4WIVA 5D26A 5DKCA 4UIYA 5LKXA 4BJXA 5LJ2A 5D3SA 5FE2A 3LQIA 3ONIA 5DYUA 4YBMA 5EWWA 3ZYUA 5FE0A 5KO4A 1F68A 4LC2A 5I1QA 4N4HA 5FE4A 4TZ8A 4Z6HA 3LJWA 4O77A 1WUGA 5AMEA 2E7OA 3MULA 4QSRA 4TT6A 5H1VA 4IR3A 5CZGA 4MR5A 5DKDA 4CUQA 4YYKA 5CUBA 3MB3A 3O34A 2GRCA 5HELA 5LKUA 5A81A 4A9FA 2DKWA 4OGIA 4A9EA 4C67A 4HXPA 5FG4A 4HBWA 4A9HA 5C85A 5L8TA 5CY9A 5EWDA 5F61A 5CPEA 4CUSA 3MB4A 4QB3A 4TYLA 4YBTA 5A5NA 4YC9A 4IOOA 2DATA 3O36A 2G4AA 4YATA 2YW5A 4QY4A 5HRXA 5A5PA 5HM0A 2YEMA 4TS8A 4PCEA 5E9YA 4QZSA 5F60A 4MR4A 2R0YA 4BW3A 5I7YA 4QBMA 4HXOA 5A7CA 5FH7A 5G4SA 3MUKA 4O72A 5FH8A 3P1DA 4F3IA 4O7CA 5KTWA 4NYXA 5FFYA 4MENA 2OUOA 4HBXA 4Z1SA 4Y03A 4IORA 5E9MA 3JVLA 5FE8A 2YEKA 5TCMA 5KU3A 4HXMA 3RCWA 4NQMA 5FE3A 4LZSA 5EPRA 5C89A 4HBVA 5A5RA 4LRGA 4X2IA 4O7AA 5F5ZA 4A9KA 3SVGA 5F63A 4A9IA 4DONA 4UIUA 5E9LA 3MXFA 5CQ3A 5EGUA 4QEUA 5D3NA 4CLBA 4WHWA 5CU8A 4NUDA 5EISA 3NXBA 4QYLA 5L98A 5LJ0A 2D82A 4QSTA 2H60A 3HMHA 5FE5A 4LR6A 5DBMA 5E7DA 5HEMA 3UVWA 3P1FA 4NXJA 5IGNA 4O70A 4OGJA 5IG6A 3UVYA 4HXRA 5LVQA 4KV4A 5FG6A 4A9OA 5FB1A 4QNSA 4CUTA 5LUUA 2R0VA 4XY8A 5CQ4A 5CGPA 4LYSA 2YELA 5E3DA 5CFWA 5D3RA 4MR6A 4TQNA 4O76A 4LZ2A 4TTEA 4YABA 3G0LA 4BW1A 5I29A 5I86A 3U5KA 5D3LA 5CQ6A 5DFDA 5KTUA 4O7FA 5A83A 5BT4A 2I8NA 4HBYA 4TT4A 4YAXA 2E3KA 3QZVA 5ENBA 3HMEA 3AQAA 4QEVA 5H1TA 2WP2A 5FFVA 5CUGA 5CRMA 5CQ8A 5D7XA 5E3GA 2DVQA 4QSSA 4YYGA 2WP1A 2R0SA 4FLPA 4YH3A 5EICA 1N72A 2DVVA 2I7KA 5DW1A 3P1CA 4YBSA 4BHWA 4O75A 4TU6A 3LQJA 5I40A 3IU5A 5FBXA 4J0SA 4YYMA 4HXNA 4UYGA 3UV5A 4CL9A 4A9MA 5AD3A 4Z1QA 3U5MA 5TB6A 4CUPA 4QC1A 4N4IA 5D3TA 2YDWA 2RS9B 3P5OA 4TU4A 4AKNA 5DKHA 4XUAA 4NYWA 5DW2A 5CQTA 5ACYA 5E9KA 4C66A 5D25A 2D9EA 4LYWA 4NRCA 1EQFA 5DYAA 5EK9A 5IIDA 2F6NA 5HQ5A 4MEPA 4QEWA 5ENIA 3SVFA 4NUCA 1JSPB 4NR8A 4Z93A 4NR6A 4UITA 5CUAA 4KV1A 5L8UA 5A5SA 4O78A 5F2PA 2MJVB 4IR6A 4NR5A 4NQNA 5LKTA 4CUUA 4Z6IA 4NS5A 4TZ2A 5D24A 5FDZA 4QUTA 5EWHA 2DWWA 2RI7A 4QSXA 1ZS5A 4IOQA 4Q0NA 4QR5A 5EP7A 5E0RA 5L99A 3UVXA 4IR5A 5CUEA 3DWYA 4MEQA 3Q2FA 5E74A 5A5OA 5D0CA 2R10A 4NRAA 4YYIA 3UV4A 2RFJA 4N4FA 5I88A 5DFBA 4WHUA 2DVSA 5IGLA 2L5EA 4RVRA 5KTXA 2NXBA 5D3JA 3JVMA 2RO1A 5IBNA 5F1LA 5IGMA 5COIA 5HFQA 5D3HA 2F6JA 4A9JA 2LSPB 5CUDA 5DY7A 5FH6A 3K2JA 3O33A 5HENA 5HJCA 4YYNA 4PKLA 5KHMA 1X0JA 5I89A 3U5OA 5II2A 5ETDA 4TT2A 4PCIA 4QUUA 5HQ7A 5G4RA 5J0DA 4IR4A 4BW4A 4N4GA 4NR9A 4UIZA 4YYHA 5EV9A 4A9LA 3QZTA 3JVKA 5EWCA 4UIXA 5AD2A 4YK0A 5JWMA 4PY6A 5A85A 5CQ5A 5LVRA 3SVHA 4QSVA 5CQAA 4LDFA 2OSSA 5A82A 2RNYA 4XYAA 3AADA 3U5LA 5EM3A 3LQHA 4UYFA 4ZW1A 5HRVA 3S91A 2RNWA 5I83A 5LKZA 5ENCA 4UIWA 5BT3A 5CS8A 2YQDA 4J0RA 4BW2A 3P1EA 5ETBA 1WUMA 5C4QA 3O35A 3TLPA 5A5QA 5ENHA 5ENJA 4ZC9A 4YYDA 4UYDA 4O71A 4UIVA 4OUFA 3UW9A 4PTBA 3U5JA 5FE6A 5HRWA 3IU6A 5EPBA 5EWVA 4HXLA 3I3JA 4Q0OA 4NR7A 5AMFA 2YYNA 5HCLA 2OO1A 2L85A 4QR3A 5F36A 3FKMX 5K29A 5EVAA 5C7NA 3O37A 4UYEA 5F25A 5F3AA 3U5NA 3QZSA 4NYVA 4NRBA 5L96A 5ENGA 4CFKA 4A9NA 5L97A 4YADA 5FFWA 4HXKA 4ALGA 3UVDA 5DLXA 5DLZA 4CFLA 4QC3A 4O74A 5DX4A 5JI8A 2KTBB 2N9GA 4YY4A 5DYCA 4N3WA 5D3PA 5CTLA 3DAIA 4PS5A 4NUEA 4QR4A 2L84A 4J1PA 4ALHA 3HMFA 5EQ1A 5FB0A 3G0JA 5C87A 2FSAA 1JM4B 4MEOA 5IGKA 5CQ7A 3LXJA 4E96A 3Q2EA 4ZQLA 5FE9A 5DYXA 4MR3A 5F1HA 5ENEA 5I7XA 5CRZA 4UYHA 5HFRA 1E6IA 5CP5A 5E73A 5ENFA 4NR4A 2RNXA 3JVJA 5FE7A 4YH4A 5HQ6A 5EI4A 5FE1A 5FG5A 4LYIA 4QSQA 3U5PA 4QYDA 4J3IA 4QSWA 3MQMA 4QSPA 5E9IA 4YYJA 5H85A 3UV2A 4KCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLS A;  4LZR A;  4XY9 A;  5E9V A;  4UYF B;  2E7N A;  5H1U A;  4O7E A;  5DFC A;  5C8G A;  2DVR A;  5I80 A;  5BT5 A;  5LJ1 A;  5EPS A;  5F62 A;  4CUR A;  4YY6 A;  3S92 A;  4QSU A;  4GPJ A;  4O7B A;  3GG3 A;  5EA1 A;  5EU1 A;  3D7C A;  5CUC A;  4HXS A;  5II1 A;  4XUB A;  4WIV A;  5D26 A;  5DKC A;  4UIY A;  5LKX A;  4BJX A;  5LJ2 A;  5D3S A;  5FE2 A;  3LQI A;  3ONI A;  5DYU A;  4YBM A;  5EWW A;  3ZYU A;  5FE0 A;  5KO4 A;  1F68 A;  4LC2 A;  5I1Q A;  4N4H A;  5FE4 A;  4TZ8 A;  4Z6H A;  3LJW A;  4O77 A;  1WUG A;  5AME A;  2E7O A;  3MUL A;  4QSR A;  4TT6 A;  5H1V A;  4IR3 A;  5CZG A;  4MR5 A;  5DKD A;  4CUQ A;  4YYK A;  5CUB A;  3MB3 A;  3O34 A;  2GRC A;  5HEL A;  5LKU A;  5A81 A;  4A9F A;  2DKW A;  4OGI A;  4A9E A;  4C67 A;  4HXP A;  5FG4 A;  4HBW A;  4A9H A;  5C85 A;  5L8T A;  5CY9 A;  5EWD A;  5F61 A;  5CPE A;  4CUS A;  3MB4 A;  4QB3 A;  4TYL A;  4YBT A;  5A5N A;  4YC9 A;  4IOO A;  2DAT A;  3O36 A;  2G4A A;  4YAT A;  2YW5 A;  4QY4 A;  5HRX A;  5A5P A;  5HM0 A;  2YEM A;  4TS8 A;  4PCE A;  5E9Y A;  4QZS A;  5F60 A;  4MR4 A;  2R0Y A;  4BW3 A;  5I7Y A;  4QBM A;  4HXO A;  5A7C A;  5FH7 A;  5G4S A;  3MUK A;  4O72 A;  5FH8 A;  3P1D A;  4F3I A;  4O7C A;  5KTW A;  4NYX A;  5FFY A;  4MEN A;  2OUO A;  4HBX A;  4Z1S A;  4Y03 A;  4IOR A;  5E9M A;  3JVL A;  5FE8 A;  2YEK A;  5TCM A;  5KU3 A;  4HXM A;  3RCW A;  4NQM A;  5FE3 A;  4LZS A;  5EPR A;  5C89 A;  4HBV A;  5A5R A;  4LRG A;  4X2I A;  4O7A A;  5F5Z A;  4A9K A;  3SVG A;  5F63 A;  4A9I A;  4DON A;  4UIU A;  5E9L A;  3MXF A;  5CQ3 A;  5EGU A;  4QEU A;  5D3N A;  4CLB A;  4WHW A;  5CU8 A;  4NUD A;  5EIS A;  3NXB A;  4QYL A;  5L98 A;  5LJ0 A;  2D82 A;  4QST A;  2H60 A;  3HMH A;  5FE5 A;  4LR6 A;  5DBM A;  5E7D A;  5HEM A;  3UVW A;  3P1F A;  4NXJ A;  5IGN A;  4O70 A;  4OGJ A;  5IG6 A;  3UVY A;  4HXR A;  5LVQ A;  4KV4 A;  5FG6 A;  4A9O A;  5FB1 A;  4QNS A;  4CUT A;  5LUU A;  2R0V A;  4XY8 A;  5CQ4 A;  5CGP A;  4LYS A;  2YEL A;  5E3D A;  5CFW A;  5D3R A;  4MR6 A;  4TQN A;  4O76 A;  4LZ2 A;  4TTE A;  4YAB A;  3G0L A;  4BW1 A;  5I29 A;  5I86 A;  3U5K A;  5D3L A;  5CQ6 A;  5DFD A;  5KTU A;  4O7F A;  5A83 A;  5BT4 A;  2I8N A;  4HBY A;  4TT4 A;  4YAX A;  2E3K A;  3QZV A;  5ENB A;  3HME A;  3AQA A;  4QEV A;  5H1T A;  2WP2 A;  5FFV A;  5CUG A;  5CRM A;  5CQ8 A;  5D7X A;  5E3G A;  2DVQ A;  4QSS A;  4YYG A;  2WP1 A;  2R0S A;  4FLP A;  4YH3 A;  5EIC A;  1N72 A;  2DVV A;  2I7K A;  5DW1 A;  3P1C A;  4YBS A;  4BHW A;  4O75 A;  4TU6 A;  3LQJ A;  5I40 A;  3IU5 A;  5FBX A;  4J0S A;  4YYM A;  4HXN A;  4UYG A;  3UV5 A;  4CL9 A;  4A9M A;  5AD3 A;  4Z1Q A;  3U5M A;  5TB6 A;  4CUP A;  4QC1 A;  4N4I A;  5D3T A;  2YDW A;  2RS9 B;  3P5O A;  4TU4 A;  4AKN A;  5DKH A;  4XUA A;  4NYW A;  5DW2 A;  5CQT A;  5ACY A;  5E9K A;  4C66 A;  5D25 A;  2D9E A;  4LYW A;  4NRC A;  1EQF A;  5DYA A;  5EK9 A;  5IID A;  2F6N A;  5HQ5 A;  4MEP A;  4QEW A;  5ENI A;  3SVF A;  4NUC A;  1JSP B;  4NR8 A;  4Z93 A;  4NR6 A;  4UIT A;  5CUA A;  4KV1 A;  5L8U A;  5A5S A;  4O78 A;  5F2P A;  2MJV B;  4IR6 A;  4NR5 A;  4NQN A;  5LKT A;  4CUU A;  4Z6I A;  4NS5 A;  4TZ2 A;  5D24 A;  5FDZ A;  4QUT A;  5EWH A;  2DWW A;  2RI7 A;  4QSX A;  1ZS5 A;  4IOQ A;  4Q0N A;  4QR5 A;  5EP7 A;  5E0R A;  5L99 A;  3UVX A;  4IR5 A;  5CUE A;  3DWY A;  4MEQ A;  3Q2F A;  5E74 A;  5A5O A;  5D0C A;  2R10 A;  4NRA A;  4YYI A;  3UV4 A;  2RFJ A;  4N4F A;  5I88 A;  5DFB A;  4WHU A;  2DVS A;  5IGL A;  2L5E A;  4RVR A;  5KTX A;  2NXB A;  5D3J A;  3JVM A;  2RO1 A;  5IBN A;  5F1L A;  5IGM A;  5COI A;  5HFQ A;  5D3H A;  2F6J A;  4A9J A;  2LSP B;  5CUD A;  5DY7 A;  5FH6 A;  3K2J A;  3O33 A;  5HEN A;  5HJC A;  4YYN A;  4PKL A;  5KHM A;  1X0J A;  5I89 A;  3U5O A;  5II2 A;  5ETD A;  4TT2 A;  4PCI A;  4QUU A;  5HQ7 A;  5G4R A;  5J0D A;  4IR4 A;  4BW4 A;  4N4G A;  4NR9 A;  4UIZ A;  4YYH A;  5EV9 A;  4A9L A;  3QZT A;  3JVK A;  5EWC A;  4UIX A;  5AD2 A;  4YK0 A;  5JWM A;  4PY6 A;  5A85 A;  5CQ5 A;  5LVR A;  3SVH A;  4QSV A;  5CQA A;  4LDF A;  2OSS A;  5A82 A;  2RNY A;  4XYA A;  3AAD A;  3U5L A;  5EM3 A;  3LQH A;  4UYF A;  4ZW1 A;  5HRV A;  3S91 A;  2RNW A;  5I83 A;  5LKZ A;  5ENC A;  4UIW A;  5BT3 A;  5CS8 A;  2YQD A;  4J0R A;  4BW2 A;  3P1E A;  5ETB A;  1WUM A;  5C4Q A;  3O35 A;  3TLP A;  5A5Q A;  5ENH A;  5ENJ A;  4ZC9 A;  4YYD A;  4UYD A;  4O71 A;  4UIV A;  4OUF A;  3UW9 A;  4PTB A;  3U5J A;  5FE6 A;  5HRW A;  3IU6 A;  5EPB A;  5EWV A;  4HXL A;  3I3J A;  4Q0O A;  4NR7 A;  5AMF A;  2YYN A;  5HCL A;  2OO1 A;  2L85 A;  4QR3 A;  5F36 A;  3FKM X;  5K29 A;  5EVA A;  5C7N A;  3O37 A;  4UYE A;  5F25 A;  5F3A A;  3U5N A;  3QZS A;  4NYV A;  4NRB A;  5L96 A;  5ENG A;  4CFK A;  4A9N A;  5L97 A;  4YAD A;  5FFW A;  4HXK A;  4ALG A;  3UVD A;  5DLX A;  5DLZ A;  4CFL A;  4QC3 A;  4O74 A;  5DX4 A;  5JI8 A;  2KTB B;  2N9G A;  4YY4 A;  5DYC A;  4N3W A;  5D3P A;  5CTL A;  3DAI A;  4PS5 A;  4NUE A;  4QR4 A;  2L84 A;  4J1P A;  4ALH A;  3HMF A;  5EQ1 A;  5FB0 A;  3G0J A;  5C87 A;  2FSA A;  1JM4 B;  4MEO A;  5IGK A;  5CQ7 A;  3LXJ A;  4E96 A;  3Q2E A;  4ZQL A;  5FE9 A;  5DYX A;  4MR3 A;  5F1H A;  5ENE A;  5I7X A;  5CRZ A;  4UYH A;  5HFR A;  1E6I A;  5CP5 A;  5E73 A;  5ENF A;  4NR4 A;  2RNX A;  3JVJ A;  5FE7 A;  4YH4 A;  5HQ6 A;  5EI4 A;  5FE1 A;  5FG5 A;  4LYI A;  4QSQ A;  3U5P A;  4QYD A;  4J3I A;  4QSW A;  3MQM A;  4QSP A;  5E9I A;  4YYJ A;  5H85 A;  3UV2 A;  4KCX A; 
#chains in the Genus database with same CATH topology
 5HLS A;  4LZR A;  4XY9 A;  5E9V A;  4UYF B;  2E7N A;  5H1U A;  4O7E A;  5DFC A;  5C8G A;  4AKH A;  2DVR A;  5I80 A;  5BT5 A;  5LJ1 A;  5EPS A;  5F62 A;  4CUR A;  4YY6 A;  3S92 A;  4QSU A;  4GPJ A;  4O7B A;  3GG3 A;  5EA1 A;  5EU1 A;  4AKI A;  3D7C A;  5CUC A;  4HXS A;  5II1 A;  4XUB A;  4WIV A;  5D26 A;  5DKC A;  4UIY A;  5LKX A;  4BJX A;  5LJ2 A;  5D3S A;  5FE2 A;  3LQI A;  1PUO A;  3ONI A;  5DYU A;  4YBM A;  5EWW A;  3ZYU A;  5FE0 A;  5KO4 A;  1F68 A;  3D1B A;  4LC2 A;  5I1Q A;  4N4H A;  5FE4 A;  4TZ8 A;  4Z6H A;  3LJW A;  4O77 A;  1WUG A;  5AME A;  2E7O A;  3MUL A;  4QSR A;  4TT6 A;  5H1V A;  4IR3 A;  5CZG A;  4MR5 A;  5DKD A;  4CUQ A;  4YYK A;  5CUB A;  3MB3 A;  3O34 A;  2GRC A;  5HEL A;  5LKU A;  5A81 A;  4A9F A;  2DKW A;  4OGI A;  4A9E A;  4C67 A;  4HXP A;  5FG4 A;  4HBW A;  4A9H A;  5C85 A;  5L8T A;  5CY9 A;  5EWD A;  5F61 A;  5CPE A;  4CUS A;  3MB4 A;  4QB3 A;  4TYL A;  4YBT A;  5A5N A;  4YC9 A;  4IOO A;  2DAT A;  3O36 A;  2G4A A;  4YAT A;  2YW5 A;  4QY4 A;  3D1D A;  5HRX A;  5A5P A;  5HM0 A;  2YEM A;  4TS8 A;  4PCE A;  5E9Y A;  4QZS A;  5F60 A;  4MR4 A;  2R0Y A;  4BW3 A;  5I7Y A;  4QBM A;  4HXO A;  5A7C A;  5FH7 A;  5G4S A;  3MUK A;  4O72 A;  5FH8 A;  3P1D A;  4F3I A;  4O7C A;  5KTW A;  4NYX A;  5FFY A;  4MEN A;  2OUO A;  4HBX A;  4Z1S A;  4Y03 A;  4IOR A;  5E9M A;  3JVL A;  5FE8 A;  2YEK A;  5TCM A;  5KU3 A;  4HXM A;  3RCW A;  4NQM A;  5FE3 A;  4LZS A;  5EPR A;  5C89 A;  4HBV A;  5A5R A;  4LRG A;  3VKG A;  4X2I A;  4O7A A;  5F5Z A;  4A9K A;  3SVG A;  5F63 A;  4A9I A;  4DON A;  4UIU A;  5E9L A;  3MXF A;  5CQ3 A;  5EGU A;  4QEU A;  5D3N A;  4CLB A;  4WHW A;  5CU8 A;  4NUD A;  5EIS A;  3NXB A;  4QYL A;  5L98 A;  5LJ0 A;  2D82 A;  4QST A;  2H60 A;  3HMH A;  5FE5 A;  4LR6 A;  5DBM A;  5E7D A;  5HEM A;  3UVW A;  3P1F A;  4NXJ A;  5IGN A;  4O70 A;  4OGJ A;  5IG6 A;  3UVY A;  4HXR A;  5LVQ A;  4KV4 A;  5FG6 A;  4A9O A;  5FB1 A;  4QNS A;  4CUT A;  5LUU A;  2R0V A;  4XY8 A;  5CQ4 A;  5CGP A;  4LYS A;  2YEL A;  5E3D A;  5CFW A;  5D3R A;  4MR6 A;  4TQN A;  4O76 A;  4LZ2 A;  4TTE A;  4YAB A;  3G0L A;  4BW1 A;  5I29 A;  5I86 A;  3U5K A;  5D3L A;  5CQ6 A;  5DFD A;  5KTU A;  4O7F A;  5A83 A;  5BT4 A;  2I8N A;  4HBY A;  4TT4 A;  4YAX A;  2E3K A;  3QZV A;  5ENB A;  3HME A;  3AQA A;  4QEV A;  5H1T A;  2WP2 A;  5FFV A;  5CUG A;  5CRM A;  5CQ8 A;  5D7X A;  5E3G A;  2DVQ A;  4QSS A;  4YYG A;  2WP1 A;  2R0S A;  4FLP A;  4YH3 A;  5EIC A;  1N72 A;  2DVV A;  2I7K A;  5DW1 A;  3P1C A;  4YBS A;  4BHW A;  4O75 A;  4TU6 A;  3LQJ A;  5I40 A;  3IU5 A;  5FBX A;  4J0S A;  4YYM A;  4HXN A;  4UYG A;  3UV5 A;  4CL9 A;  4A9M A;  5AD3 A;  4Z1Q A;  3U5M A;  5TB6 A;  4CUP A;  4QC1 A;  4N4I A;  5D3T A;  2YDW A;  2RS9 B;  4AI6 A;  3P5O A;  4TU4 A;  4AKN A;  5DKH A;  4XUA A;  4NYW A;  5DW2 A;  5CQT A;  5ACY A;  5E9K A;  4C66 A;  5D25 A;  2EJN A;  2D9E A;  4LYW A;  4NRC A;  1EQF A;  5DYA A;  5EK9 A;  5IID A;  2F6N A;  5HQ5 A;  4MEP A;  4QEW A;  5ENI A;  3SVF A;  4NUC A;  1JSP B;  4NR8 A;  4Z93 A;  4NR6 A;  4UIT A;  5CUA A;  4KV1 A;  5L8U A;  5A5S A;  4O78 A;  5F2P A;  2MJV B;  4IR6 A;  4NR5 A;  4NQN A;  5LKT A;  4CUU A;  4Z6I A;  4NS5 A;  4TZ2 A;  5D24 A;  5FDZ A;  4QUT A;  5EWH A;  2DWW A;  2RI7 A;  4QSX A;  1ZS5 A;  4IOQ A;  4Q0N A;  4QR5 A;  5EP7 A;  5E0R A;  5L99 A;  3UVX A;  4IR5 A;  5CUE A;  3DWY A;  4MEQ A;  3Q2F A;  5E74 A;  5A5O A;  5D0C A;  2R10 A;  4NRA A;  4YYI A;  3UV4 A;  2RFJ A;  4N4F A;  5I88 A;  5DFB A;  4WHU A;  2DVS A;  5IGL A;  2L5E A;  4RVR A;  5KTX A;  2NXB A;  5D3J A;  3JVM A;  2RO1 A;  5IBN A;  5F1L A;  5IGM A;  5COI A;  5HFQ A;  5D3H A;  2F6J A;  4A9J A;  2LSP B;  5CUD A;  5DY7 A;  5FH6 A;  3K2J A;  3O33 A;  5HEN A;  5HJC A;  4YYN A;  4PKL A;  5KHM A;  1X0J A;  5I89 A;  3U5O A;  5II2 A;  5ETD A;  4TT2 A;  4PCI A;  4QUU A;  5HQ7 A;  5G4R A;  5J0D A;  4IR4 A;  4BW4 A;  4N4G A;  4NR9 A;  4UIZ A;  4YYH A;  5EV9 A;  4A9L A;  3QZT A;  3JVK A;  5EWC A;  4UIX A;  5AD2 A;  4YK0 A;  5JWM A;  4PY6 A;  5A85 A;  5CQ5 A;  5LVR A;  3SVH A;  4QSV A;  5CQA A;  4LDF A;  2OSS A;  5A82 A;  2RNY A;  4XYA A;  3AAD A;  3U5L A;  5EM3 A;  3LQH A;  4UYF A;  4ZW1 A;  5HRV A;  3S91 A;  2RNW A;  5I83 A;  5LKZ A;  5ENC A;  4UIW A;  5BT3 A;  5CS8 A;  2YQD A;  4J0R A;  4BW2 A;  3P1E A;  5ETB A;  1WUM A;  5C4Q A;  3O35 A;  3TLP A;  5A5Q A;  5ENH A;  5ENJ A;  4ZC9 A;  4YYD A;  4UYD A;  4O71 A;  4UIV A;  4OUF A;  3UW9 A;  4PTB A;  3U5J A;  5FE6 A;  5HRW A;  3IU6 A;  5EPB A;  5EWV A;  4HXL A;  3I3J A;  4Q0O A;  4NR7 A;  5AMF A;  2YYN A;  5HCL A;  2OO1 A;  2L85 A;  4QR3 A;  5F36 A;  3FKM X;  5K29 A;  5EVA A;  5C7N A;  3O37 A;  1ZKR A;  4UYE A;  5F25 A;  5F3A A;  3U5N A;  3QZS A;  3VKH A;  4NYV A;  4NRB A;  5L96 A;  5ENG A;  4CFK A;  4A9N A;  5L97 A;  4YAD A;  5FFW A;  4AKG A;  4HXK A;  4ALG A;  3UVD A;  5DLX A;  5DLZ A;  4CFL A;  4QC3 A;  4O74 A;  5DX4 A;  5JI8 A;  2KTB B;  2N9G A;  4YY4 A;  5DYC A;  4N3W A;  5D3P A;  5CTL A;  3DAI A;  4PS5 A;  4NUE A;  4QR4 A;  2L84 A;  4J1P A;  4ALH A;  3HMF A;  5EQ1 A;  5FB0 A;  3G0J A;  5C87 A;  2FSA A;  1JM4 B;  4MEO A;  5IGK A;  5CQ7 A;  3LXJ A;  4E96 A;  3Q2E A;  4ZQL A;  5FE9 A;  5DYX A;  4MR3 A;  5F1H A;  5ENE A;  5I7X A;  5CRZ A;  4UYH A;  5HFR A;  1E6I A;  5CP5 A;  5E73 A;  5ENF A;  4NR4 A;  2RNX A;  3JVJ A;  5FE7 A;  4YH4 A;  5HQ6 A;  5EI4 A;  5FE1 A;  5FG5 A;  4LYI A;  4QSQ A;  3U5P A;  4QYD A;  4J3I A;  4QSW A;  3MQM A;  4QSP A;  5E9I A;  4YYJ A;  5H85 A;  3UV2 A;  3ERR A;  4KCX A; 
#chains in the Genus database with same CATH homology
 5HLS A;  4LZR A;  4XY9 A;  5E9V A;  4UYF B;  2E7N A;  5H1U A;  4O7E A;  5DFC A;  5C8G A;  2DVR A;  5I80 A;  5BT5 A;  5LJ1 A;  5EPS A;  5F62 A;  4CUR A;  4YY6 A;  3S92 A;  4QSU A;  4GPJ A;  4O7B A;  3GG3 A;  5EA1 A;  5EU1 A;  3D7C A;  5CUC A;  4HXS A;  5II1 A;  4XUB A;  4WIV A;  5D26 A;  5DKC A;  4UIY A;  5LKX A;  4BJX A;  5LJ2 A;  5D3S A;  5FE2 A;  3LQI A;  3ONI A;  5DYU A;  4YBM A;  5EWW A;  3ZYU A;  5FE0 A;  5KO4 A;  1F68 A;  4LC2 A;  5I1Q A;  4N4H A;  5FE4 A;  4TZ8 A;  4Z6H A;  3LJW A;  4O77 A;  1WUG A;  5AME A;  2E7O A;  3MUL A;  4QSR A;  4TT6 A;  5H1V A;  4IR3 A;  5CZG A;  4MR5 A;  5DKD A;  4CUQ A;  4YYK A;  5CUB A;  3MB3 A;  3O34 A;  2GRC A;  5HEL A;  5LKU A;  5A81 A;  4A9F A;  2DKW A;  4OGI A;  4A9E A;  4C67 A;  4HXP A;  5FG4 A;  4HBW A;  4A9H A;  5C85 A;  5L8T A;  5CY9 A;  5EWD A;  5F61 A;  5CPE A;  4CUS A;  3MB4 A;  4QB3 A;  4TYL A;  4YBT A;  5A5N A;  4YC9 A;  4IOO A;  2DAT A;  3O36 A;  2G4A A;  4YAT A;  2YW5 A;  4QY4 A;  5HRX A;  5A5P A;  5HM0 A;  2YEM A;  4TS8 A;  4PCE A;  5E9Y A;  4QZS A;  5F60 A;  4MR4 A;  2R0Y A;  4BW3 A;  5I7Y A;  4QBM A;  4HXO A;  5A7C A;  5FH7 A;  5G4S A;  3MUK A;  4O72 A;  5FH8 A;  3P1D A;  4F3I A;  4O7C A;  5KTW A;  4NYX A;  5FFY A;  4MEN A;  2OUO A;  4HBX A;  4Z1S A;  4Y03 A;  4IOR A;  5E9M A;  3JVL A;  5FE8 A;  2YEK A;  5TCM A;  5KU3 A;  4HXM A;  3RCW A;  4NQM A;  5FE3 A;  4LZS A;  5EPR A;  5C89 A;  4HBV A;  5A5R A;  4LRG A;  4X2I A;  4O7A A;  5F5Z A;  4A9K A;  3SVG A;  5F63 A;  4A9I A;  4DON A;  4UIU A;  5E9L A;  3MXF A;  5CQ3 A;  5EGU A;  4QEU A;  5D3N A;  4CLB A;  4WHW A;  5CU8 A;  4NUD A;  5EIS A;  3NXB A;  4QYL A;  5L98 A;  5LJ0 A;  2D82 A;  4QST A;  2H60 A;  3HMH A;  5FE5 A;  4LR6 A;  5DBM A;  5E7D A;  5HEM A;  3UVW A;  3P1F A;  4NXJ A;  5IGN A;  4O70 A;  4OGJ A;  5IG6 A;  3UVY A;  4HXR A;  5LVQ A;  4KV4 A;  5FG6 A;  4A9O A;  5FB1 A;  4QNS A;  4CUT A;  5LUU A;  2R0V A;  4XY8 A;  5CQ4 A;  5CGP A;  4LYS A;  2YEL A;  5E3D A;  5CFW A;  5D3R A;  4MR6 A;  4TQN A;  4O76 A;  4LZ2 A;  4TTE A;  4YAB A;  3G0L A;  4BW1 A;  5I29 A;  5I86 A;  3U5K A;  5D3L A;  5CQ6 A;  5DFD A;  5KTU A;  4O7F A;  5A83 A;  5BT4 A;  2I8N A;  4HBY A;  4TT4 A;  4YAX A;  2E3K A;  3QZV A;  5ENB A;  3HME A;  3AQA A;  4QEV A;  5H1T A;  2WP2 A;  5FFV A;  5CUG A;  5CRM A;  5CQ8 A;  5D7X A;  5E3G A;  2DVQ A;  4QSS A;  4YYG A;  2WP1 A;  2R0S A;  4FLP A;  4YH3 A;  5EIC A;  1N72 A;  2DVV A;  2I7K A;  5DW1 A;  3P1C A;  4YBS A;  4BHW A;  4O75 A;  4TU6 A;  3LQJ A;  5I40 A;  3IU5 A;  5FBX A;  4J0S A;  4YYM A;  4HXN A;  4UYG A;  3UV5 A;  4CL9 A;  4A9M A;  5AD3 A;  4Z1Q A;  3U5M A;  5TB6 A;  4CUP A;  4QC1 A;  4N4I A;  5D3T A;  2YDW A;  2RS9 B;  3P5O A;  4TU4 A;  4AKN A;  5DKH A;  4XUA A;  4NYW A;  5DW2 A;  5CQT A;  5ACY A;  5E9K A;  4C66 A;  5D25 A;  2D9E A;  4LYW A;  4NRC A;  1EQF A;  5DYA A;  5EK9 A;  5IID A;  2F6N A;  5HQ5 A;  4MEP A;  4QEW A;  5ENI A;  3SVF A;  4NUC A;  1JSP B;  4NR8 A;  4Z93 A;  4NR6 A;  4UIT A;  5CUA A;  4KV1 A;  5L8U A;  5A5S A;  4O78 A;  5F2P A;  2MJV B;  4IR6 A;  4NR5 A;  4NQN A;  5LKT A;  4CUU A;  4Z6I A;  4NS5 A;  4TZ2 A;  5D24 A;  5FDZ A;  4QUT A;  5EWH A;  2DWW A;  2RI7 A;  4QSX A;  1ZS5 A;  4IOQ A;  4Q0N A;  4QR5 A;  5EP7 A;  5E0R A;  5L99 A;  3UVX A;  4IR5 A;  5CUE A;  3DWY A;  4MEQ A;  3Q2F A;  5E74 A;  5A5O A;  5D0C A;  2R10 A;  4NRA A;  4YYI A;  3UV4 A;  2RFJ A;  4N4F A;  5I88 A;  5DFB A;  4WHU A;  2DVS A;  5IGL A;  2L5E A;  4RVR A;  5KTX A;  2NXB A;  5D3J A;  3JVM A;  2RO1 A;  5IBN A;  5F1L A;  5IGM A;  5COI A;  5HFQ A;  5D3H A;  2F6J A;  4A9J A;  2LSP B;  5CUD A;  5DY7 A;  5FH6 A;  3K2J A;  3O33 A;  5HEN A;  5HJC A;  4YYN A;  4PKL A;  5KHM A;  1X0J A;  5I89 A;  3U5O A;  5II2 A;  5ETD A;  4TT2 A;  4PCI A;  4QUU A;  5HQ7 A;  5G4R A;  5J0D A;  4IR4 A;  4BW4 A;  4N4G A;  4NR9 A;  4UIZ A;  4YYH A;  5EV9 A;  4A9L A;  3QZT A;  3JVK A;  5EWC A;  4UIX A;  5AD2 A;  4YK0 A;  5JWM A;  4PY6 A;  5A85 A;  5CQ5 A;  5LVR A;  3SVH A;  4QSV A;  5CQA A;  4LDF A;  2OSS A;  5A82 A;  2RNY A;  4XYA A;  3AAD A;  3U5L A;  5EM3 A;  3LQH A;  4UYF A;  4ZW1 A;  5HRV A;  3S91 A;  2RNW A;  5I83 A;  5LKZ A;  5ENC A;  4UIW A;  5BT3 A;  5CS8 A;  2YQD A;  4J0R A;  4BW2 A;  3P1E A;  5ETB A;  1WUM A;  5C4Q A;  3O35 A;  3TLP A;  5A5Q A;  5ENH A;  5ENJ A;  4ZC9 A;  4YYD A;  4UYD A;  4O71 A;  4UIV A;  4OUF A;  3UW9 A;  4PTB A;  3U5J A;  5FE6 A;  5HRW A;  3IU6 A;  5EPB A;  5EWV A;  4HXL A;  3I3J A;  4Q0O A;  4NR7 A;  5AMF A;  2YYN A;  5HCL A;  2OO1 A;  2L85 A;  4QR3 A;  5F36 A;  3FKM X;  5K29 A;  5EVA A;  5C7N A;  3O37 A;  4UYE A;  5F25 A;  5F3A A;  3U5N A;  3QZS A;  4NYV A;  4NRB A;  5L96 A;  5ENG A;  4CFK A;  4A9N A;  5L97 A;  4YAD A;  5FFW A;  4HXK A;  4ALG A;  3UVD A;  5DLX A;  5DLZ A;  4CFL A;  4QC3 A;  4O74 A;  5DX4 A;  5JI8 A;  2KTB B;  2N9G A;  4YY4 A;  5DYC A;  4N3W A;  5D3P A;  5CTL A;  3DAI A;  4PS5 A;  4NUE A;  4QR4 A;  2L84 A;  4J1P A;  4ALH A;  3HMF A;  5EQ1 A;  5FB0 A;  3G0J A;  5C87 A;  2FSA A;  1JM4 B;  4MEO A;  5IGK A;  5CQ7 A;  3LXJ A;  4E96 A;  3Q2E A;  4ZQL A;  5FE9 A;  5DYX A;  4MR3 A;  5F1H A;  5ENE A;  5I7X A;  5CRZ A;  4UYH A;  5HFR A;  1E6I A;  5CP5 A;  5E73 A;  5ENF A;  4NR4 A;  2RNX A;  3JVJ A;  5FE7 A;  4YH4 A;  5HQ6 A;  5EI4 A;  5FE1 A;  5FG5 A;  4LYI A;  4QSQ A;  3U5P A;  4QYD A;  4J3I A;  4QSW A;  3MQM A;  4QSP A;  5E9I A;  4YYJ A;  5H85 A;  3UV2 A;  4KCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...