5A7CA

Crystal structure of the second bromodomain of human brd3 in complex with compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BROMODOMAIN-CONTAINING PROTEIN 3
publication title Cancer Differentiating Agent Hexamethylene Bisacetamide Inhibits Bet Bromodomain Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a7cA00
4LYSA 5E73A 5LKTA 4N4HA 3D7CA 4MEQA 4TU6A 3UVYA 4E96A 5CP5A 5HRWA 2I8NA 5F1HA 5IGLA 5CUCA 4A9FA 3P1DA 3G0LA 4PS5A 5KO4A 4BW3A 2RNXA 3QZSA 4CL9A 2YDWA 4LZRA 4N4IA 4UYFB 5E3DA 2YQDA 2N9GA 4O7FA 3HMFA 5DFBA 5FH8A 4UIXA 4CFKA 4QBMA 4IR3A 5HQ7A 4ZC9A 3U5NA 5CQ4A 4LYWA 4TTEA 5E9VA 4O70A 4HXSA 5I7XA 3JVMA 2RI7A 4UIVA 4J3IA 4XY9A 5FB1A 5I86A 2L85A 5CY9A 4QSTA 4N4GA 5D3HA 5LJ2A 4HBYA 5FE5A 5LUUA 5E9IA 4A9LA 2F6NA 5F25A 4UITA 4HXNA 5C8GA 5JWMA 4BW2A 3QZVA 4IR5A 5CQAA 4J0SA 4QSQA 5F36A 4ALHA 1N72A 4OGIA 4UIUA 4IOQA 4TT6A 5E0RA 3I3JA 4A9NA 3P1FA 4TT4A 5F2PA 2YEMA 5JI8A 3JVJA 4CLBA 4YYNA 5HM0A 5DLXA 3TLPA 4O71A 5KTXA 5J0DA 5C4QA 5H1VA 5H85A 5CQ5A 5CS8A 3G0JA 4WHWA 5I7YA 4TQNA 2KTBB 3UVDA 3P1CA 5HQ5A 3SVHA 5CQ8A 3O33A 4YBMA 5CUBA 4J1PA 5BT3A 2I7KA 2DVSA 5DBMA 4IR6A 4Z1SA 5AMFA 5EU1A 4A9KA 3LJWA 4LR6A 5D7XA 2YEKA 4NR6A 4NYWA 4O77A 5COIA 3MB4A 4HBVA 3Q2FA 4CURA 3DAIA 3Q2EA 4Z93A 5CUAA 5EGUA 4IORA 4ZW1A 3UV4A 3UVXA 5C89A 5EV9A 2L84A 5II1A 4NR5A 3U5JA 4BHWA 5HFQA 2L5EA 4A9EA 4YH4A 4CUTA 2DKWA 4CUPA 3S91A 5ENCA 4MR4A 5KU3A 4HXMA 4HBXA 4QSVA 3O35A 4NXJA 5HENA 5FFWA 5HEMA 4YATA 5D3PA 4A9JA 4XYAA 4ALGA 5L96A 2E3KA 5EICA 5I80A 5I29A 1F68A 2OO1A 5LVRA 5FH7A 5EK9A 1EQFA 4UYFA 5A5QA 3JVKA 5H1TA 4IOOA 2DATA 5LVQA 3ONIA 4NRAA 5EWVA 5HFRA 4QYDA 5C87A 4BJXA 4TU4A 5HJCA 5ETDA 2RNWA 4C67A 3S92A 5EPBA 3GG3A 5K29A 5DYAA 5IIDA 5FE4A 3MQMA 4YYIA 5L8UA 2R10A 4MEOA 4PKLA 5CZGA 5HRVA 5I83A 5DKHA 5L98A 5CQ6A 2RS9B 4Q0OA 4LZSA 2G4AA 5DX4A 3HMEA 4NR7A 4YYDA 5ETBA 2NXBA 4YYMA 4QUUA 4XUAA 2E7NA 4UIYA 5DY7A 4LDFA 4TZ8A 5EQ1A 4YY4A 5A5RA 4LC2A 4XY8A 3LQIA 4YK0A 4FLPA 4UYGA 5F1LA 3P5OA 3MB3A 5G4RA 2LSPB 4NUDA 5E74A 4HXKA 5DKCA 1ZS5A 4QSPA 2F6JA 4KCXA 5EPSA 3UV2A 5FBXA 4QEVA 4HBWA 3UVWA 5FE3A 4Y03A 5FFYA 4YH3A 4PTBA 5E9YA 3O37A 5HLSA 5EVAA 3O34A 5HQ6A 2MJVB 4MR3A 5FH6A 4QR5A 4YYKA 5ENIA 3HMHA 4QEUA 4NS5A 1E6IA 4QZSA 5F60A 5G4SA 5H1UA 2WP2A 3AQAA 4O7BA 5FDZA 4QNSA 5CRZA 2DWWA 4YBTA 5A7CA 5IG6A 5DW2A 5FG4A 5DYUA 1WUMA 5FE0A 2RNYA 4YADA 2WP1A 4NR4A 3U5PA 4Q0NA 4F3IA 5IGNA 2D82A 2DVVA 5ENGA 5D3NA 5A5OA 4YYGA 5A5SA 5IGKA 4QR4A 4QY4A 5TCMA 4A9HA 3LXJA 4QSSA 4QUTA 4BW1A 5EP7A 4Z1QA 5FE8A 5FE7A 4MR6A 4RVRA 5IBNA 3DWYA 4O75A 4WHUA 5E9KA 5CRMA 5F5ZA 5EA1A 4CUQA 4MEPA 4C66A 4NR9A 3NXBA 5I40A 4O7CA 4A9IA 4HXPA 2R0SA 4ZQLA 5KHMA 5CGPA 2YW5A 5ENFA 5BT5A 1WUGA 4QSRA 4QYLA 4O78A 5FFVA 3SVGA 5HCLA 5DKDA 4BW4A 5TB6A 5CFWA 3JVLA 5EI4A 4NRCA 2OSSA 5F62A 4PY6A 5LKUA 3LQHA 5ENHA 5L8TA 4TYLA 4GPJA 4UIWA 5EWCA 5CU8A 5A83A 5LKXA 5DYCA 5D3LA 5CUDA 2E7OA 5DYXA 5A81A 4A9OA 5DFDA 3IU5A 4NQMA 5D26A 2R0VA 5I89A 4PCIA 3U5OA 2RFJA 5ENEA 5I88A 1X0JA 2FSAA 5KTUA 4TZ2A 4HXLA 5AMEA 4IR4A 4YABA 4A9MA 5C7NA 3U5KA 5LKZA 4KV1A 5L99A 5EISA 4DONA 3SVFA 5F63A 4O74A 4YC9A 5FG6A 5EPRA 5CQ7A 4QB3A 5E7DA 4YBSA 5ENJA 5CUGA 4NYVA 3MULA 4MR5A 3QZTA 4YY6A 5FE2A 5E9MA 3LQJA 2R0YA 2GRCA 5EM3A 2DVRA 5HELA 4N4FA 4AKNA 5AD2A 4Z6IA 4O72A 4LYIA 5EWHA 4NR8A 4NQNA 4OGJA 5D3JA 5EWWA 2YELA 4UYHA 3AADA 4YYHA 1JM4B 4N3WA 4LRGA 3MUKA 4NRBA 4WIVA 5D0CA 3IU6A 4NUEA 3FKMX 4X2IA 4QSUA 5A82A 5DFCA 4UIZA 2H60A 4HXRA 4HXOA 4Z6HA 4LZ2A 5CQ3A 4QC3A 5FB0A 5HRXA 4TT2A 5A5PA 5ENBA 4PCEA 5BT4A 5CTLA 2RO1A 5AD3A 4XUBA 4UYEA 3UV5A 4O7AA 4KV4A 2D9EA 4NUCA 5CQTA 5F3AA 2OUOA 2YYNA 4MENA 4QR3A 3MXFA 4QSXA 5D3SA 4J0RA 5D25A 3UW9A 1JSPB 3P1EA 5DLZA 5D3RA 5E9LA 5FG5A 5D3TA 5IGMA 5LJ0A 4TS8A 5DW1A 4CUUA 5KTWA 4O7EA 5C85A 3U5MA 3ZYUA 4NYXA 5F61A 4QSWA 4OUFA 5ACYA 3K2JA 5A85A 3O36A 4YYJA 5FE9A 3RCWA 4UYDA 5L97A 5I1QA 2DVQA 4YAXA 5EWDA 5FE6A 3U5LA 5CPEA 5E3GA 5FE1A 5II2A 4QC1A 5A5NA 4CUSA 4O76A 4CFLA 5CUEA 5LJ1A 5D24A 4QEWA
chains in the Genus database with same CATH superfamily
4LYSA 5E73A 5LKTA 4N4HA 3D7CA 4MEQA 4TU6A 3UVYA 4E96A 5CP5A 5HRWA 2I8NA 5F1HA 5IGLA 5CUCA 4A9FA 3P1DA 3G0LA 4PS5A 5KO4A 4BW3A 2RNXA 3QZSA 4CL9A 2YDWA 4LZRA 4N4IA 4UYFB 5E3DA 2YQDA 2N9GA 4O7FA 3HMFA 5DFBA 5FH8A 4UIXA 4CFKA 4QBMA 4IR3A 5HQ7A 4ZC9A 3U5NA 5CQ4A 4LYWA 4TTEA 5E9VA 4O70A 4HXSA 5I7XA 3JVMA 2RI7A 4UIVA 4J3IA 4XY9A 5FB1A 5I86A 2L85A 5CY9A 4AKIA 4QSTA 4N4GA 5D3HA 5LJ2A 4HBYA 5FE5A 5LUUA 5E9IA 4A9LA 2F6NA 5F25A 4UITA 4HXNA 5C8GA 5JWMA 4BW2A 3QZVA 4IR5A 5CQAA 4J0SA 4QSQA 5F36A 4ALHA 1N72A 4OGIA 4UIUA 4IOQA 3ERRA 4TT6A 5E0RA 3I3JA 4A9NA 3P1FA 4TT4A 5F2PA 2YEMA 5JI8A 3JVJA 4CLBA 4YYNA 5HM0A 5DLXA 3TLPA 4O71A 5KTXA 1ZKRA 3VKHA 5J0DA 5C4QA 5H1VA 5H85A 5CQ5A 5CS8A 3G0JA 4WHWA 5I7YA 4TQNA 2KTBB 3UVDA 3P1CA 5HQ5A 3SVHA 5CQ8A 3O33A 4YBMA 5CUBA 4J1PA 5BT3A 2I7KA 2DVSA 5DBMA 4IR6A 4Z1SA 5AMFA 5EU1A 4A9KA 3LJWA 4LR6A 5D7XA 2YEKA 4NR6A 4NYWA 4O77A 5COIA 3MB4A 4HBVA 3Q2FA 4CURA 3DAIA 3Q2EA 4Z93A 5CUAA 5EGUA 4IORA 4ZW1A 3UV4A 3VKGA 3UVXA 5C89A 5EV9A 2L84A 5II1A 4NR5A 3U5JA 4BHWA 5HFQA 2L5EA 4A9EA 4YH4A 4CUTA 2DKWA 4CUPA 3S91A 5ENCA 4MR4A 5KU3A 4HXMA 4HBXA 4QSVA 3O35A 4NXJA 5HENA 5FFWA 5HEMA 4YATA 5D3PA 4A9JA 4XYAA 4ALGA 5L96A 2E3KA 5EICA 5I80A 5I29A 1F68A 2OO1A 5LVRA 5FH7A 5EK9A 1EQFA 4UYFA 5A5QA 3JVKA 5H1TA 4IOOA 2DATA 5LVQA 3ONIA 4NRAA 5EWVA 5HFRA 4QYDA 5C87A 4BJXA 4TU4A 5HJCA 5ETDA 2RNWA 4C67A 3S92A 5EPBA 3GG3A 5K29A 5DYAA 5IIDA 5FE4A 3MQMA 4YYIA 5L8UA 2R10A 4MEOA 4PKLA 5CZGA 5HRVA 5I83A 5DKHA 5L98A 5CQ6A 2EJNA 2RS9B 4Q0OA 4LZSA 2G4AA 5DX4A 3HMEA 4NR7A 4YYDA 5ETBA 2NXBA 4YYMA 4QUUA 4XUAA 2E7NA 4UIYA 5DY7A 4LDFA 4TZ8A 5EQ1A 4YY4A 5A5RA 4LC2A 4XY8A 3LQIA 4YK0A 4FLPA 4UYGA 4AKHA 5F1LA 3P5OA 3MB3A 5G4RA 2LSPB 4NUDA 5E74A 4HXKA 5DKCA 1ZS5A 4QSPA 2F6JA 4KCXA 5EPSA 3UV2A 5FBXA 4QEVA 4HBWA 3UVWA 5FE3A 4Y03A 5FFYA 4YH3A 4PTBA 5E9YA 3O37A 5HLSA 5EVAA 3O34A 5HQ6A 2MJVB 4MR3A 5FH6A 4QR5A 4YYKA 5ENIA 3HMHA 4QEUA 4NS5A 1E6IA 4QZSA 5F60A 5G4SA 5H1UA 2WP2A 3AQAA 4O7BA 5FDZA 4QNSA 5CRZA 2DWWA 4YBTA 5A7CA 5IG6A 5DW2A 5FG4A 5DYUA 1WUMA 5FE0A 2RNYA 4YADA 2WP1A 4NR4A 3U5PA 4Q0NA 4F3IA 5IGNA 2D82A 2DVVA 5ENGA 5D3NA 5A5OA 4YYGA 5A5SA 5IGKA 4QR4A 4QY4A 5TCMA 4A9HA 3LXJA 4QSSA 4QUTA 4BW1A 5EP7A 4Z1QA 5FE8A 5FE7A 4MR6A 4RVRA 5IBNA 3DWYA 4AKGA 4O75A 4WHUA 5E9KA 5CRMA 5F5ZA 5EA1A 4CUQA 4MEPA 4C66A 4NR9A 3NXBA 5I40A 4O7CA 4A9IA 4HXPA 2R0SA 4ZQLA 5KHMA 5CGPA 2YW5A 5ENFA 5BT5A 1WUGA 4QSRA 4QYLA 4O78A 5FFVA 3SVGA 5HCLA 5DKDA 4BW4A 5TB6A 5CFWA 3JVLA 5EI4A 4NRCA 2OSSA 5F62A 4PY6A 5LKUA 3LQHA 5ENHA 5L8TA 4TYLA 4GPJA 4UIWA 5EWCA 5CU8A 5A83A 5LKXA 5DYCA 5D3LA 5CUDA 2E7OA 5DYXA 5A81A 4A9OA 5DFDA 3IU5A 3D1BA 4NQMA 5D26A 2R0VA 5I89A 4PCIA 3U5OA 2RFJA 5ENEA 5I88A 1X0JA 2FSAA 5KTUA 4TZ2A 4HXLA 5AMEA 4IR4A 4YABA 4A9MA 5C7NA 3U5KA 5LKZA 4KV1A 5L99A 5EISA 4DONA 3SVFA 5F63A 4O74A 4YC9A 5FG6A 5EPRA 5CQ7A 4QB3A 5E7DA 4YBSA 5ENJA 5CUGA 4AI6A 4NYVA 3MULA 4MR5A 3QZTA 4YY6A 5FE2A 5E9MA 3LQJA 2R0YA 2GRCA 5EM3A 2DVRA 5HELA 4N4FA 4AKNA 5AD2A 4Z6IA 4O72A 4LYIA 5EWHA 4NR8A 4NQNA 4OGJA 5D3JA 5EWWA 2YELA 4UYHA 3AADA 4YYHA 1JM4B 4N3WA 4LRGA 3MUKA 4NRBA 4WIVA 5D0CA 3IU6A 4NUEA 3FKMX 3D1DA 4X2IA 4QSUA 5A82A 5DFCA 4UIZA 2H60A 4HXRA 4HXOA 4Z6HA 4LZ2A 5CQ3A 4QC3A 5FB0A 5HRXA 4TT2A 5A5PA 5ENBA 4PCEA 5BT4A 5CTLA 2RO1A 5AD3A 4XUBA 4UYEA 3UV5A 4O7AA 4KV4A 2D9EA 4NUCA 5CQTA 5F3AA 2OUOA 2YYNA 4MENA 4QR3A 3MXFA 4QSXA 5D3SA 4J0RA 5D25A 1PUOA 3UW9A 1JSPB 3P1EA 5DLZA 5D3RA 5E9LA 5FG5A 5D3TA 5IGMA 5LJ0A 4TS8A 5DW1A 4CUUA 5KTWA 4O7EA 5C85A 3U5MA 3ZYUA 4NYXA 5F61A 4QSWA 4OUFA 5ACYA 3K2JA 5A85A 3O36A 4YYJA 5FE9A 3RCWA 4UYDA 5L97A 5I1QA 2DVQA 4YAXA 5EWDA 5FE6A 3U5LA 5CPEA 5E3GA 5FE1A 5II2A 4QC1A 5A5NA 4CUSA 4O76A 4CFLA 5CUEA 5LJ1A 5D24A 4QEWA
chains in the Genus database with same CATH topology
4LYSA 5E73A 5LKTA 4N4HA 3D7CA 4MEQA 4TU6A 3UVYA 4E96A 5CP5A 5HRWA 2I8NA 5F1HA 5IGLA 5CUCA 4A9FA 3P1DA 3G0LA 4PS5A 5KO4A 4BW3A 2RNXA 3QZSA 4CL9A 2YDWA 4LZRA 4N4IA 4UYFB 5E3DA 2YQDA 2N9GA 4O7FA 3HMFA 5DFBA 5FH8A 4UIXA 4CFKA 4QBMA 4IR3A 5HQ7A 4ZC9A 3U5NA 5CQ4A 4LYWA 4TTEA 5E9VA 4O70A 4HXSA 5I7XA 3JVMA 2RI7A 4UIVA 4J3IA 4XY9A 5FB1A 5I86A 2L85A 5CY9A 4QSTA 4N4GA 5D3HA 5LJ2A 4HBYA 5FE5A 5LUUA 5E9IA 4A9LA 2F6NA 5F25A 4UITA 4HXNA 5C8GA 5JWMA 4BW2A 3QZVA 4IR5A 5CQAA 4J0SA 4QSQA 5F36A 4ALHA 1N72A 4OGIA 4UIUA 4IOQA 4TT6A 5E0RA 3I3JA 4A9NA 3P1FA 4TT4A 5F2PA 2YEMA 5JI8A 3JVJA 4CLBA 4YYNA 5HM0A 5DLXA 3TLPA 4O71A 5KTXA 5J0DA 5C4QA 5H1VA 5H85A 5CQ5A 5CS8A 3G0JA 4WHWA 5I7YA 4TQNA 2KTBB 3UVDA 3P1CA 5HQ5A 3SVHA 5CQ8A 3O33A 4YBMA 5CUBA 4J1PA 5BT3A 2I7KA 2DVSA 5DBMA 4IR6A 4Z1SA 5AMFA 5EU1A 4A9KA 3LJWA 4LR6A 5D7XA 2YEKA 4NR6A 4NYWA 4O77A 5COIA 3MB4A 4HBVA 3Q2FA 4CURA 3DAIA 3Q2EA 4Z93A 5CUAA 5EGUA 4IORA 4ZW1A 3UV4A 3UVXA 5C89A 5EV9A 2L84A 5II1A 4NR5A 3U5JA 4BHWA 5HFQA 2L5EA 4A9EA 4YH4A 4CUTA 2DKWA 4CUPA 3S91A 5ENCA 4MR4A 5KU3A 4HXMA 4HBXA 4QSVA 3O35A 4NXJA 5HENA 5FFWA 5HEMA 4YATA 5D3PA 4A9JA 4XYAA 4ALGA 5L96A 2E3KA 5EICA 5I80A 5I29A 1F68A 2OO1A 5LVRA 5FH7A 5EK9A 1EQFA 4UYFA 5A5QA 3JVKA 5H1TA 4IOOA 2DATA 5LVQA 3ONIA 4NRAA 5EWVA 5HFRA 4QYDA 5C87A 4BJXA 4TU4A 5HJCA 5ETDA 2RNWA 4C67A 3S92A 5EPBA 3GG3A 5K29A 5DYAA 5IIDA 5FE4A 3MQMA 4YYIA 5L8UA 2R10A 4MEOA 4PKLA 5CZGA 5HRVA 5I83A 5DKHA 5L98A 5CQ6A 2RS9B 4Q0OA 4LZSA 2G4AA 5DX4A 3HMEA 4NR7A 4YYDA 5ETBA 2NXBA 4YYMA 4QUUA 4XUAA 2E7NA 4UIYA 5DY7A 4LDFA 4TZ8A 5EQ1A 4YY4A 5A5RA 4LC2A 4XY8A 3LQIA 4YK0A 4FLPA 4UYGA 5F1LA 3P5OA 3MB3A 5G4RA 2LSPB 4NUDA 5E74A 4HXKA 5DKCA 1ZS5A 4QSPA 2F6JA 4KCXA 5EPSA 3UV2A 5FBXA 4QEVA 4HBWA 3UVWA 5FE3A 4Y03A 5FFYA 4YH3A 4PTBA 5E9YA 3O37A 5HLSA 5EVAA 3O34A 5HQ6A 2MJVB 4MR3A 5FH6A 4QR5A 4YYKA 5ENIA 3HMHA 4QEUA 4NS5A 1E6IA 4QZSA 5F60A 5G4SA 5H1UA 2WP2A 3AQAA 4O7BA 5FDZA 4QNSA 5CRZA 2DWWA 4YBTA 5A7CA 5IG6A 5DW2A 5FG4A 5DYUA 1WUMA 5FE0A 2RNYA 4YADA 2WP1A 4NR4A 3U5PA 4Q0NA 4F3IA 5IGNA 2D82A 2DVVA 5ENGA 5D3NA 5A5OA 4YYGA 5A5SA 5IGKA 4QR4A 4QY4A 5TCMA 4A9HA 3LXJA 4QSSA 4QUTA 4BW1A 5EP7A 4Z1QA 5FE8A 5FE7A 4MR6A 4RVRA 5IBNA 3DWYA 4O75A 4WHUA 5E9KA 5CRMA 5F5ZA 5EA1A 4CUQA 4MEPA 4C66A 4NR9A 3NXBA 5I40A 4O7CA 4A9IA 4HXPA 2R0SA 4ZQLA 5KHMA 5CGPA 2YW5A 5ENFA 5BT5A 1WUGA 4QSRA 4QYLA 4O78A 5FFVA 3SVGA 5HCLA 5DKDA 4BW4A 5TB6A 5CFWA 3JVLA 5EI4A 4NRCA 2OSSA 5F62A 4PY6A 5LKUA 3LQHA 5ENHA 5L8TA 4TYLA 4GPJA 4UIWA 5EWCA 5CU8A 5A83A 5LKXA 5DYCA 5D3LA 5CUDA 2E7OA 5DYXA 5A81A 4A9OA 5DFDA 3IU5A 4NQMA 5D26A 2R0VA 5I89A 4PCIA 3U5OA 2RFJA 5ENEA 5I88A 1X0JA 2FSAA 5KTUA 4TZ2A 4HXLA 5AMEA 4IR4A 4YABA 4A9MA 5C7NA 3U5KA 5LKZA 4KV1A 5L99A 5EISA 4DONA 3SVFA 5F63A 4O74A 4YC9A 5FG6A 5EPRA 5CQ7A 4QB3A 5E7DA 4YBSA 5ENJA 5CUGA 4NYVA 3MULA 4MR5A 3QZTA 4YY6A 5FE2A 5E9MA 3LQJA 2R0YA 2GRCA 5EM3A 2DVRA 5HELA 4N4FA 4AKNA 5AD2A 4Z6IA 4O72A 4LYIA 5EWHA 4NR8A 4NQNA 4OGJA 5D3JA 5EWWA 2YELA 4UYHA 3AADA 4YYHA 1JM4B 4N3WA 4LRGA 3MUKA 4NRBA 4WIVA 5D0CA 3IU6A 4NUEA 3FKMX 4X2IA 4QSUA 5A82A 5DFCA 4UIZA 2H60A 4HXRA 4HXOA 4Z6HA 4LZ2A 5CQ3A 4QC3A 5FB0A 5HRXA 4TT2A 5A5PA 5ENBA 4PCEA 5BT4A 5CTLA 2RO1A 5AD3A 4XUBA 4UYEA 3UV5A 4O7AA 4KV4A 2D9EA 4NUCA 5CQTA 5F3AA 2OUOA 2YYNA 4MENA 4QR3A 3MXFA 4QSXA 5D3SA 4J0RA 5D25A 3UW9A 1JSPB 3P1EA 5DLZA 5D3RA 5E9LA 5FG5A 5D3TA 5IGMA 5LJ0A 4TS8A 5DW1A 4CUUA 5KTWA 4O7EA 5C85A 3U5MA 3ZYUA 4NYXA 5F61A 4QSWA 4OUFA 5ACYA 3K2JA 5A85A 3O36A 4YYJA 5FE9A 3RCWA 4UYDA 5L97A 5I1QA 2DVQA 4YAXA 5EWDA 5FE6A 3U5LA 5CPEA 5E3GA 5FE1A 5II2A 4QC1A 5A5NA 4CUSA 4O76A 4CFLA 5CUEA 5LJ1A 5D24A 4QEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYS A;  5E73 A;  5LKT A;  4N4H A;  3D7C A;  4MEQ A;  4TU6 A;  3UVY A;  4E96 A;  5CP5 A;  5HRW A;  2I8N A;  5F1H A;  5IGL A;  5CUC A;  4A9F A;  3P1D A;  3G0L A;  4PS5 A;  5KO4 A;  4BW3 A;  2RNX A;  3QZS A;  4CL9 A;  2YDW A;  4LZR A;  4N4I A;  4UYF B;  5E3D A;  2YQD A;  2N9G A;  4O7F A;  3HMF A;  5DFB A;  5FH8 A;  4UIX A;  4CFK A;  4QBM A;  4IR3 A;  5HQ7 A;  4ZC9 A;  3U5N A;  5CQ4 A;  4LYW A;  4TTE A;  5E9V A;  4O70 A;  4HXS A;  5I7X A;  3JVM A;  2RI7 A;  4UIV A;  4J3I A;  4XY9 A;  5FB1 A;  5I86 A;  2L85 A;  5CY9 A;  4QST A;  4N4G A;  5D3H A;  5LJ2 A;  4HBY A;  5FE5 A;  5LUU A;  5E9I A;  4A9L A;  2F6N A;  5F25 A;  4UIT A;  4HXN A;  5C8G A;  5JWM A;  4BW2 A;  3QZV A;  4IR5 A;  5CQA A;  4J0S A;  4QSQ A;  5F36 A;  4ALH A;  1N72 A;  4OGI A;  4UIU A;  4IOQ A;  4TT6 A;  5E0R A;  3I3J A;  4A9N A;  3P1F A;  4TT4 A;  5F2P A;  2YEM A;  5JI8 A;  3JVJ A;  4CLB A;  4YYN A;  5HM0 A;  5DLX A;  3TLP A;  4O71 A;  5KTX A;  5J0D A;  5C4Q A;  5H1V A;  5H85 A;  5CQ5 A;  5CS8 A;  3G0J A;  4WHW A;  5I7Y A;  4TQN A;  2KTB B;  3UVD A;  3P1C A;  5HQ5 A;  3SVH A;  5CQ8 A;  3O33 A;  4YBM A;  5CUB A;  4J1P A;  5BT3 A;  2I7K A;  2DVS A;  5DBM A;  4IR6 A;  4Z1S A;  5AMF A;  5EU1 A;  4A9K A;  3LJW A;  4LR6 A;  5D7X A;  2YEK A;  4NR6 A;  4NYW A;  4O77 A;  5COI A;  3MB4 A;  4HBV A;  3Q2F A;  4CUR A;  3DAI A;  3Q2E A;  4Z93 A;  5CUA A;  5EGU A;  4IOR A;  4ZW1 A;  3UV4 A;  3UVX A;  5C89 A;  5EV9 A;  2L84 A;  5II1 A;  4NR5 A;  3U5J A;  4BHW A;  5HFQ A;  2L5E A;  4A9E A;  4YH4 A;  4CUT A;  2DKW A;  4CUP A;  3S91 A;  5ENC A;  4MR4 A;  5KU3 A;  4HXM A;  4HBX A;  4QSV A;  3O35 A;  4NXJ A;  5HEN A;  5FFW A;  5HEM A;  4YAT A;  5D3P A;  4A9J A;  4XYA A;  4ALG A;  5L96 A;  2E3K A;  5EIC A;  5I80 A;  5I29 A;  1F68 A;  2OO1 A;  5LVR A;  5FH7 A;  5EK9 A;  1EQF A;  4UYF A;  5A5Q A;  3JVK A;  5H1T A;  4IOO A;  2DAT A;  5LVQ A;  3ONI A;  4NRA A;  5EWV A;  5HFR A;  4QYD A;  5C87 A;  4BJX A;  4TU4 A;  5HJC A;  5ETD A;  2RNW A;  4C67 A;  3S92 A;  5EPB A;  3GG3 A;  5K29 A;  5DYA A;  5IID A;  5FE4 A;  3MQM A;  4YYI A;  5L8U A;  2R10 A;  4MEO A;  4PKL A;  5CZG A;  5HRV A;  5I83 A;  5DKH A;  5L98 A;  5CQ6 A;  2RS9 B;  4Q0O A;  4LZS A;  2G4A A;  5DX4 A;  3HME A;  4NR7 A;  4YYD A;  5ETB A;  2NXB A;  4YYM A;  4QUU A;  4XUA A;  2E7N A;  4UIY A;  5DY7 A;  4LDF A;  4TZ8 A;  5EQ1 A;  4YY4 A;  5A5R A;  4LC2 A;  4XY8 A;  3LQI A;  4YK0 A;  4FLP A;  4UYG A;  5F1L A;  3P5O A;  3MB3 A;  5G4R A;  2LSP B;  4NUD A;  5E74 A;  4HXK A;  5DKC A;  1ZS5 A;  4QSP A;  2F6J A;  4KCX A;  5EPS A;  3UV2 A;  5FBX A;  4QEV A;  4HBW A;  3UVW A;  5FE3 A;  4Y03 A;  5FFY A;  4YH3 A;  4PTB A;  5E9Y A;  3O37 A;  5HLS A;  5EVA A;  3O34 A;  5HQ6 A;  2MJV B;  4MR3 A;  5FH6 A;  4QR5 A;  4YYK A;  5ENI A;  3HMH A;  4QEU A;  4NS5 A;  1E6I A;  4QZS A;  5F60 A;  5G4S A;  5H1U A;  2WP2 A;  3AQA A;  4O7B A;  5FDZ A;  4QNS A;  5CRZ A;  2DWW A;  4YBT A;  5A7C A;  5IG6 A;  5DW2 A;  5FG4 A;  5DYU A;  1WUM A;  5FE0 A;  2RNY A;  4YAD A;  2WP1 A;  4NR4 A;  3U5P A;  4Q0N A;  4F3I A;  5IGN A;  2D82 A;  2DVV A;  5ENG A;  5D3N A;  5A5O A;  4YYG A;  5A5S A;  5IGK A;  4QR4 A;  4QY4 A;  5TCM A;  4A9H A;  3LXJ A;  4QSS A;  4QUT A;  4BW1 A;  5EP7 A;  4Z1Q A;  5FE8 A;  5FE7 A;  4MR6 A;  4RVR A;  5IBN A;  3DWY A;  4O75 A;  4WHU A;  5E9K A;  5CRM A;  5F5Z A;  5EA1 A;  4CUQ A;  4MEP A;  4C66 A;  4NR9 A;  3NXB A;  5I40 A;  4O7C A;  4A9I A;  4HXP A;  2R0S A;  4ZQL A;  5KHM A;  5CGP A;  2YW5 A;  5ENF A;  5BT5 A;  1WUG A;  4QSR A;  4QYL A;  4O78 A;  5FFV A;  3SVG A;  5HCL A;  5DKD A;  4BW4 A;  5TB6 A;  5CFW A;  3JVL A;  5EI4 A;  4NRC A;  2OSS A;  5F62 A;  4PY6 A;  5LKU A;  3LQH A;  5ENH A;  5L8T A;  4TYL A;  4GPJ A;  4UIW A;  5EWC A;  5CU8 A;  5A83 A;  5LKX A;  5DYC A;  5D3L A;  5CUD A;  2E7O A;  5DYX A;  5A81 A;  4A9O A;  5DFD A;  3IU5 A;  4NQM A;  5D26 A;  2R0V A;  5I89 A;  4PCI A;  3U5O A;  2RFJ A;  5ENE A;  5I88 A;  1X0J A;  2FSA A;  5KTU A;  4TZ2 A;  4HXL A;  5AME A;  4IR4 A;  4YAB A;  4A9M A;  5C7N A;  3U5K A;  5LKZ A;  4KV1 A;  5L99 A;  5EIS A;  4DON A;  3SVF A;  5F63 A;  4O74 A;  4YC9 A;  5FG6 A;  5EPR A;  5CQ7 A;  4QB3 A;  5E7D A;  4YBS A;  5ENJ A;  5CUG A;  4NYV A;  3MUL A;  4MR5 A;  3QZT A;  4YY6 A;  5FE2 A;  5E9M A;  3LQJ A;  2R0Y A;  2GRC A;  5EM3 A;  2DVR A;  5HEL A;  4N4F A;  4AKN A;  5AD2 A;  4Z6I A;  4O72 A;  4LYI A;  5EWH A;  4NR8 A;  4NQN A;  4OGJ A;  5D3J A;  5EWW A;  2YEL A;  4UYH A;  3AAD A;  4YYH A;  1JM4 B;  4N3W A;  4LRG A;  3MUK A;  4NRB A;  4WIV A;  5D0C A;  3IU6 A;  4NUE A;  3FKM X;  4X2I A;  4QSU A;  5A82 A;  5DFC A;  4UIZ A;  2H60 A;  4HXR A;  4HXO A;  4Z6H A;  4LZ2 A;  5CQ3 A;  4QC3 A;  5FB0 A;  5HRX A;  4TT2 A;  5A5P A;  5ENB A;  4PCE A;  5BT4 A;  5CTL A;  2RO1 A;  5AD3 A;  4XUB A;  4UYE A;  3UV5 A;  4O7A A;  4KV4 A;  2D9E A;  4NUC A;  5CQT A;  5F3A A;  2OUO A;  2YYN A;  4MEN A;  4QR3 A;  3MXF A;  4QSX A;  5D3S A;  4J0R A;  5D25 A;  3UW9 A;  1JSP B;  3P1E A;  5DLZ A;  5D3R A;  5E9L A;  5FG5 A;  5D3T A;  5IGM A;  5LJ0 A;  4TS8 A;  5DW1 A;  4CUU A;  5KTW A;  4O7E A;  5C85 A;  3U5M A;  3ZYU A;  4NYX A;  5F61 A;  4QSW A;  4OUF A;  5ACY A;  3K2J A;  5A85 A;  3O36 A;  4YYJ A;  5FE9 A;  3RCW A;  4UYD A;  5L97 A;  5I1Q A;  2DVQ A;  4YAX A;  5EWD A;  5FE6 A;  3U5L A;  5CPE A;  5E3G A;  5FE1 A;  5II2 A;  4QC1 A;  5A5N A;  4CUS A;  4O76 A;  4CFL A;  5CUE A;  5LJ1 A;  5D24 A;  4QEW A; 
#chains in the Genus database with same CATH topology
 4LYS A;  5E73 A;  5LKT A;  4N4H A;  3D7C A;  4MEQ A;  4TU6 A;  3UVY A;  4E96 A;  5CP5 A;  5HRW A;  2I8N A;  5F1H A;  5IGL A;  5CUC A;  4A9F A;  3P1D A;  3G0L A;  4PS5 A;  5KO4 A;  4BW3 A;  2RNX A;  3QZS A;  4CL9 A;  2YDW A;  4LZR A;  4N4I A;  4UYF B;  5E3D A;  2YQD A;  2N9G A;  4O7F A;  3HMF A;  5DFB A;  5FH8 A;  4UIX A;  4CFK A;  4QBM A;  4IR3 A;  5HQ7 A;  4ZC9 A;  3U5N A;  5CQ4 A;  4LYW A;  4TTE A;  5E9V A;  4O70 A;  4HXS A;  5I7X A;  3JVM A;  2RI7 A;  4UIV A;  4J3I A;  4XY9 A;  5FB1 A;  5I86 A;  2L85 A;  5CY9 A;  4AKI A;  4QST A;  4N4G A;  5D3H A;  5LJ2 A;  4HBY A;  5FE5 A;  5LUU A;  5E9I A;  4A9L A;  2F6N A;  5F25 A;  4UIT A;  4HXN A;  5C8G A;  5JWM A;  4BW2 A;  3QZV A;  4IR5 A;  5CQA A;  4J0S A;  4QSQ A;  5F36 A;  4ALH A;  1N72 A;  4OGI A;  4UIU A;  4IOQ A;  3ERR A;  4TT6 A;  5E0R A;  3I3J A;  4A9N A;  3P1F A;  4TT4 A;  5F2P A;  2YEM A;  5JI8 A;  3JVJ A;  4CLB A;  4YYN A;  5HM0 A;  5DLX A;  3TLP A;  4O71 A;  5KTX A;  1ZKR A;  3VKH A;  5J0D A;  5C4Q A;  5H1V A;  5H85 A;  5CQ5 A;  5CS8 A;  3G0J A;  4WHW A;  5I7Y A;  4TQN A;  2KTB B;  3UVD A;  3P1C A;  5HQ5 A;  3SVH A;  5CQ8 A;  3O33 A;  4YBM A;  5CUB A;  4J1P A;  5BT3 A;  2I7K A;  2DVS A;  5DBM A;  4IR6 A;  4Z1S A;  5AMF A;  5EU1 A;  4A9K A;  3LJW A;  4LR6 A;  5D7X A;  2YEK A;  4NR6 A;  4NYW A;  4O77 A;  5COI A;  3MB4 A;  4HBV A;  3Q2F A;  4CUR A;  3DAI A;  3Q2E A;  4Z93 A;  5CUA A;  5EGU A;  4IOR A;  4ZW1 A;  3UV4 A;  3VKG A;  3UVX A;  5C89 A;  5EV9 A;  2L84 A;  5II1 A;  4NR5 A;  3U5J A;  4BHW A;  5HFQ A;  2L5E A;  4A9E A;  4YH4 A;  4CUT A;  2DKW A;  4CUP A;  3S91 A;  5ENC A;  4MR4 A;  5KU3 A;  4HXM A;  4HBX A;  4QSV A;  3O35 A;  4NXJ A;  5HEN A;  5FFW A;  5HEM A;  4YAT A;  5D3P A;  4A9J A;  4XYA A;  4ALG A;  5L96 A;  2E3K A;  5EIC A;  5I80 A;  5I29 A;  1F68 A;  2OO1 A;  5LVR A;  5FH7 A;  5EK9 A;  1EQF A;  4UYF A;  5A5Q A;  3JVK A;  5H1T A;  4IOO A;  2DAT A;  5LVQ A;  3ONI A;  4NRA A;  5EWV A;  5HFR A;  4QYD A;  5C87 A;  4BJX A;  4TU4 A;  5HJC A;  5ETD A;  2RNW A;  4C67 A;  3S92 A;  5EPB A;  3GG3 A;  5K29 A;  5DYA A;  5IID A;  5FE4 A;  3MQM A;  4YYI A;  5L8U A;  2R10 A;  4MEO A;  4PKL A;  5CZG A;  5HRV A;  5I83 A;  5DKH A;  5L98 A;  5CQ6 A;  2EJN A;  2RS9 B;  4Q0O A;  4LZS A;  2G4A A;  5DX4 A;  3HME A;  4NR7 A;  4YYD A;  5ETB A;  2NXB A;  4YYM A;  4QUU A;  4XUA A;  2E7N A;  4UIY A;  5DY7 A;  4LDF A;  4TZ8 A;  5EQ1 A;  4YY4 A;  5A5R A;  4LC2 A;  4XY8 A;  3LQI A;  4YK0 A;  4FLP A;  4UYG A;  4AKH A;  5F1L A;  3P5O A;  3MB3 A;  5G4R A;  2LSP B;  4NUD A;  5E74 A;  4HXK A;  5DKC A;  1ZS5 A;  4QSP A;  2F6J A;  4KCX A;  5EPS A;  3UV2 A;  5FBX A;  4QEV A;  4HBW A;  3UVW A;  5FE3 A;  4Y03 A;  5FFY A;  4YH3 A;  4PTB A;  5E9Y A;  3O37 A;  5HLS A;  5EVA A;  3O34 A;  5HQ6 A;  2MJV B;  4MR3 A;  5FH6 A;  4QR5 A;  4YYK A;  5ENI A;  3HMH A;  4QEU A;  4NS5 A;  1E6I A;  4QZS A;  5F60 A;  5G4S A;  5H1U A;  2WP2 A;  3AQA A;  4O7B A;  5FDZ A;  4QNS A;  5CRZ A;  2DWW A;  4YBT A;  5A7C A;  5IG6 A;  5DW2 A;  5FG4 A;  5DYU A;  1WUM A;  5FE0 A;  2RNY A;  4YAD A;  2WP1 A;  4NR4 A;  3U5P A;  4Q0N A;  4F3I A;  5IGN A;  2D82 A;  2DVV A;  5ENG A;  5D3N A;  5A5O A;  4YYG A;  5A5S A;  5IGK A;  4QR4 A;  4QY4 A;  5TCM A;  4A9H A;  3LXJ A;  4QSS A;  4QUT A;  4BW1 A;  5EP7 A;  4Z1Q A;  5FE8 A;  5FE7 A;  4MR6 A;  4RVR A;  5IBN A;  3DWY A;  4AKG A;  4O75 A;  4WHU A;  5E9K A;  5CRM A;  5F5Z A;  5EA1 A;  4CUQ A;  4MEP A;  4C66 A;  4NR9 A;  3NXB A;  5I40 A;  4O7C A;  4A9I A;  4HXP A;  2R0S A;  4ZQL A;  5KHM A;  5CGP A;  2YW5 A;  5ENF A;  5BT5 A;  1WUG A;  4QSR A;  4QYL A;  4O78 A;  5FFV A;  3SVG A;  5HCL A;  5DKD A;  4BW4 A;  5TB6 A;  5CFW A;  3JVL A;  5EI4 A;  4NRC A;  2OSS A;  5F62 A;  4PY6 A;  5LKU A;  3LQH A;  5ENH A;  5L8T A;  4TYL A;  4GPJ A;  4UIW A;  5EWC A;  5CU8 A;  5A83 A;  5LKX A;  5DYC A;  5D3L A;  5CUD A;  2E7O A;  5DYX A;  5A81 A;  4A9O A;  5DFD A;  3IU5 A;  3D1B A;  4NQM A;  5D26 A;  2R0V A;  5I89 A;  4PCI A;  3U5O A;  2RFJ A;  5ENE A;  5I88 A;  1X0J A;  2FSA A;  5KTU A;  4TZ2 A;  4HXL A;  5AME A;  4IR4 A;  4YAB A;  4A9M A;  5C7N A;  3U5K A;  5LKZ A;  4KV1 A;  5L99 A;  5EIS A;  4DON A;  3SVF A;  5F63 A;  4O74 A;  4YC9 A;  5FG6 A;  5EPR A;  5CQ7 A;  4QB3 A;  5E7D A;  4YBS A;  5ENJ A;  5CUG A;  4AI6 A;  4NYV A;  3MUL A;  4MR5 A;  3QZT A;  4YY6 A;  5FE2 A;  5E9M A;  3LQJ A;  2R0Y A;  2GRC A;  5EM3 A;  2DVR A;  5HEL A;  4N4F A;  4AKN A;  5AD2 A;  4Z6I A;  4O72 A;  4LYI A;  5EWH A;  4NR8 A;  4NQN A;  4OGJ A;  5D3J A;  5EWW A;  2YEL A;  4UYH A;  3AAD A;  4YYH A;  1JM4 B;  4N3W A;  4LRG A;  3MUK A;  4NRB A;  4WIV A;  5D0C A;  3IU6 A;  4NUE A;  3FKM X;  3D1D A;  4X2I A;  4QSU A;  5A82 A;  5DFC A;  4UIZ A;  2H60 A;  4HXR A;  4HXO A;  4Z6H A;  4LZ2 A;  5CQ3 A;  4QC3 A;  5FB0 A;  5HRX A;  4TT2 A;  5A5P A;  5ENB A;  4PCE A;  5BT4 A;  5CTL A;  2RO1 A;  5AD3 A;  4XUB A;  4UYE A;  3UV5 A;  4O7A A;  4KV4 A;  2D9E A;  4NUC A;  5CQT A;  5F3A A;  2OUO A;  2YYN A;  4MEN A;  4QR3 A;  3MXF A;  4QSX A;  5D3S A;  4J0R A;  5D25 A;  1PUO A;  3UW9 A;  1JSP B;  3P1E A;  5DLZ A;  5D3R A;  5E9L A;  5FG5 A;  5D3T A;  5IGM A;  5LJ0 A;  4TS8 A;  5DW1 A;  4CUU A;  5KTW A;  4O7E A;  5C85 A;  3U5M A;  3ZYU A;  4NYX A;  5F61 A;  4QSW A;  4OUF A;  5ACY A;  3K2J A;  5A85 A;  3O36 A;  4YYJ A;  5FE9 A;  3RCW A;  4UYD A;  5L97 A;  5I1Q A;  2DVQ A;  4YAX A;  5EWD A;  5FE6 A;  3U5L A;  5CPE A;  5E3G A;  5FE1 A;  5II2 A;  4QC1 A;  5A5N A;  4CUS A;  4O76 A;  4CFL A;  5CUE A;  5LJ1 A;  5D24 A;  4QEW A; 
#chains in the Genus database with same CATH homology
 4LYS A;  5E73 A;  5LKT A;  4N4H A;  3D7C A;  4MEQ A;  4TU6 A;  3UVY A;  4E96 A;  5CP5 A;  5HRW A;  2I8N A;  5F1H A;  5IGL A;  5CUC A;  4A9F A;  3P1D A;  3G0L A;  4PS5 A;  5KO4 A;  4BW3 A;  2RNX A;  3QZS A;  4CL9 A;  2YDW A;  4LZR A;  4N4I A;  4UYF B;  5E3D A;  2YQD A;  2N9G A;  4O7F A;  3HMF A;  5DFB A;  5FH8 A;  4UIX A;  4CFK A;  4QBM A;  4IR3 A;  5HQ7 A;  4ZC9 A;  3U5N A;  5CQ4 A;  4LYW A;  4TTE A;  5E9V A;  4O70 A;  4HXS A;  5I7X A;  3JVM A;  2RI7 A;  4UIV A;  4J3I A;  4XY9 A;  5FB1 A;  5I86 A;  2L85 A;  5CY9 A;  4QST A;  4N4G A;  5D3H A;  5LJ2 A;  4HBY A;  5FE5 A;  5LUU A;  5E9I A;  4A9L A;  2F6N A;  5F25 A;  4UIT A;  4HXN A;  5C8G A;  5JWM A;  4BW2 A;  3QZV A;  4IR5 A;  5CQA A;  4J0S A;  4QSQ A;  5F36 A;  4ALH A;  1N72 A;  4OGI A;  4UIU A;  4IOQ A;  4TT6 A;  5E0R A;  3I3J A;  4A9N A;  3P1F A;  4TT4 A;  5F2P A;  2YEM A;  5JI8 A;  3JVJ A;  4CLB A;  4YYN A;  5HM0 A;  5DLX A;  3TLP A;  4O71 A;  5KTX A;  5J0D A;  5C4Q A;  5H1V A;  5H85 A;  5CQ5 A;  5CS8 A;  3G0J A;  4WHW A;  5I7Y A;  4TQN A;  2KTB B;  3UVD A;  3P1C A;  5HQ5 A;  3SVH A;  5CQ8 A;  3O33 A;  4YBM A;  5CUB A;  4J1P A;  5BT3 A;  2I7K A;  2DVS A;  5DBM A;  4IR6 A;  4Z1S A;  5AMF A;  5EU1 A;  4A9K A;  3LJW A;  4LR6 A;  5D7X A;  2YEK A;  4NR6 A;  4NYW A;  4O77 A;  5COI A;  3MB4 A;  4HBV A;  3Q2F A;  4CUR A;  3DAI A;  3Q2E A;  4Z93 A;  5CUA A;  5EGU A;  4IOR A;  4ZW1 A;  3UV4 A;  3UVX A;  5C89 A;  5EV9 A;  2L84 A;  5II1 A;  4NR5 A;  3U5J A;  4BHW A;  5HFQ A;  2L5E A;  4A9E A;  4YH4 A;  4CUT A;  2DKW A;  4CUP A;  3S91 A;  5ENC A;  4MR4 A;  5KU3 A;  4HXM A;  4HBX A;  4QSV A;  3O35 A;  4NXJ A;  5HEN A;  5FFW A;  5HEM A;  4YAT A;  5D3P A;  4A9J A;  4XYA A;  4ALG A;  5L96 A;  2E3K A;  5EIC A;  5I80 A;  5I29 A;  1F68 A;  2OO1 A;  5LVR A;  5FH7 A;  5EK9 A;  1EQF A;  4UYF A;  5A5Q A;  3JVK A;  5H1T A;  4IOO A;  2DAT A;  5LVQ A;  3ONI A;  4NRA A;  5EWV A;  5HFR A;  4QYD A;  5C87 A;  4BJX A;  4TU4 A;  5HJC A;  5ETD A;  2RNW A;  4C67 A;  3S92 A;  5EPB A;  3GG3 A;  5K29 A;  5DYA A;  5IID A;  5FE4 A;  3MQM A;  4YYI A;  5L8U A;  2R10 A;  4MEO A;  4PKL A;  5CZG A;  5HRV A;  5I83 A;  5DKH A;  5L98 A;  5CQ6 A;  2RS9 B;  4Q0O A;  4LZS A;  2G4A A;  5DX4 A;  3HME A;  4NR7 A;  4YYD A;  5ETB A;  2NXB A;  4YYM A;  4QUU A;  4XUA A;  2E7N A;  4UIY A;  5DY7 A;  4LDF A;  4TZ8 A;  5EQ1 A;  4YY4 A;  5A5R A;  4LC2 A;  4XY8 A;  3LQI A;  4YK0 A;  4FLP A;  4UYG A;  5F1L A;  3P5O A;  3MB3 A;  5G4R A;  2LSP B;  4NUD A;  5E74 A;  4HXK A;  5DKC A;  1ZS5 A;  4QSP A;  2F6J A;  4KCX A;  5EPS A;  3UV2 A;  5FBX A;  4QEV A;  4HBW A;  3UVW A;  5FE3 A;  4Y03 A;  5FFY A;  4YH3 A;  4PTB A;  5E9Y A;  3O37 A;  5HLS A;  5EVA A;  3O34 A;  5HQ6 A;  2MJV B;  4MR3 A;  5FH6 A;  4QR5 A;  4YYK A;  5ENI A;  3HMH A;  4QEU A;  4NS5 A;  1E6I A;  4QZS A;  5F60 A;  5G4S A;  5H1U A;  2WP2 A;  3AQA A;  4O7B A;  5FDZ A;  4QNS A;  5CRZ A;  2DWW A;  4YBT A;  5A7C A;  5IG6 A;  5DW2 A;  5FG4 A;  5DYU A;  1WUM A;  5FE0 A;  2RNY A;  4YAD A;  2WP1 A;  4NR4 A;  3U5P A;  4Q0N A;  4F3I A;  5IGN A;  2D82 A;  2DVV A;  5ENG A;  5D3N A;  5A5O A;  4YYG A;  5A5S A;  5IGK A;  4QR4 A;  4QY4 A;  5TCM A;  4A9H A;  3LXJ A;  4QSS A;  4QUT A;  4BW1 A;  5EP7 A;  4Z1Q A;  5FE8 A;  5FE7 A;  4MR6 A;  4RVR A;  5IBN A;  3DWY A;  4O75 A;  4WHU A;  5E9K A;  5CRM A;  5F5Z A;  5EA1 A;  4CUQ A;  4MEP A;  4C66 A;  4NR9 A;  3NXB A;  5I40 A;  4O7C A;  4A9I A;  4HXP A;  2R0S A;  4ZQL A;  5KHM A;  5CGP A;  2YW5 A;  5ENF A;  5BT5 A;  1WUG A;  4QSR A;  4QYL A;  4O78 A;  5FFV A;  3SVG A;  5HCL A;  5DKD A;  4BW4 A;  5TB6 A;  5CFW A;  3JVL A;  5EI4 A;  4NRC A;  2OSS A;  5F62 A;  4PY6 A;  5LKU A;  3LQH A;  5ENH A;  5L8T A;  4TYL A;  4GPJ A;  4UIW A;  5EWC A;  5CU8 A;  5A83 A;  5LKX A;  5DYC A;  5D3L A;  5CUD A;  2E7O A;  5DYX A;  5A81 A;  4A9O A;  5DFD A;  3IU5 A;  4NQM A;  5D26 A;  2R0V A;  5I89 A;  4PCI A;  3U5O A;  2RFJ A;  5ENE A;  5I88 A;  1X0J A;  2FSA A;  5KTU A;  4TZ2 A;  4HXL A;  5AME A;  4IR4 A;  4YAB A;  4A9M A;  5C7N A;  3U5K A;  5LKZ A;  4KV1 A;  5L99 A;  5EIS A;  4DON A;  3SVF A;  5F63 A;  4O74 A;  4YC9 A;  5FG6 A;  5EPR A;  5CQ7 A;  4QB3 A;  5E7D A;  4YBS A;  5ENJ A;  5CUG A;  4NYV A;  3MUL A;  4MR5 A;  3QZT A;  4YY6 A;  5FE2 A;  5E9M A;  3LQJ A;  2R0Y A;  2GRC A;  5EM3 A;  2DVR A;  5HEL A;  4N4F A;  4AKN A;  5AD2 A;  4Z6I A;  4O72 A;  4LYI A;  5EWH A;  4NR8 A;  4NQN A;  4OGJ A;  5D3J A;  5EWW A;  2YEL A;  4UYH A;  3AAD A;  4YYH A;  1JM4 B;  4N3W A;  4LRG A;  3MUK A;  4NRB A;  4WIV A;  5D0C A;  3IU6 A;  4NUE A;  3FKM X;  4X2I A;  4QSU A;  5A82 A;  5DFC A;  4UIZ A;  2H60 A;  4HXR A;  4HXO A;  4Z6H A;  4LZ2 A;  5CQ3 A;  4QC3 A;  5FB0 A;  5HRX A;  4TT2 A;  5A5P A;  5ENB A;  4PCE A;  5BT4 A;  5CTL A;  2RO1 A;  5AD3 A;  4XUB A;  4UYE A;  3UV5 A;  4O7A A;  4KV4 A;  2D9E A;  4NUC A;  5CQT A;  5F3A A;  2OUO A;  2YYN A;  4MEN A;  4QR3 A;  3MXF A;  4QSX A;  5D3S A;  4J0R A;  5D25 A;  3UW9 A;  1JSP B;  3P1E A;  5DLZ A;  5D3R A;  5E9L A;  5FG5 A;  5D3T A;  5IGM A;  5LJ0 A;  4TS8 A;  5DW1 A;  4CUU A;  5KTW A;  4O7E A;  5C85 A;  3U5M A;  3ZYU A;  4NYX A;  5F61 A;  4QSW A;  4OUF A;  5ACY A;  3K2J A;  5A85 A;  3O36 A;  4YYJ A;  5FE9 A;  3RCW A;  4UYD A;  5L97 A;  5I1Q A;  2DVQ A;  4YAX A;  5EWD A;  5FE6 A;  3U5L A;  5CPE A;  5E3G A;  5FE1 A;  5II2 A;  4QC1 A;  5A5N A;  4CUS A;  4O76 A;  4CFL A;  5CUE A;  5LJ1 A;  5D24 A;  4QEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...