5A7CA

Crystal structure of the second bromodomain of human brd3 in complex with compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 3
publication title Cancer Differentiating Agent Hexamethylene Bisacetamide Inhibits Bet Bromodomain Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a7cA00
5COIA 5CZGA 4TS8A 1E6IA 5HFQA 5BT4A 3U5PA 5EV9A 4Z1SA 2YEKA 5EPRA 4HXRA 4KCXA 2RI7A 2OUOA 3MQMA 4HXSA 3UVDA 4NQNA 3UVYA 5EWCA 5A5OA 2F6JA 5CQ8A 3MXFA 5FB0A 4QSQA 5G4SA 2DVSA 4N4GA 5ENFA 5FFVA 4NUCA 4NRCA 3UV5A 4NRAA 4NR7A 5CQ7A 5E3GA 4OGIA 4QSRA 4O75A 3O37A 5EISA 4IOQA 5DKCA 5E9YA 5D3PA 5LVRA 4IOOA 5D3SA 4YBTA 5EI4A 5D26A 4CUSA 4LR6A 4NXJA 2YYNA 5D25A 3DWYA 3UVXA 4Z1QA 3O34A 4KV1A 5H1UA 2RNXA 1N72A 4UYEA 5AMFA 4PCIA 5FFYA 4YYDA 4QSVA 5D3NA 5HRWA 3AQAA 4UYHA 4XY9A 2H60A 2I8NA 5L98A 5ENCA 4UIWA 5BT5A 4TTEA 2D82A 5LVQA 3S92A 5FH7A 5DBMA 4A9EA 4MR3A 1X0JA 4QC1A 4QSWA 3QZVA 4Q0NA 5DLXA 5F5ZA 5IIDA 5I7XA 4O78A 2R0SA 3Q2FA 5EGUA 4UIUA 5L96A 5AD3A 2R10A 4O7CA 4UYFB 4AKNA 5CUEA 4QSSA 5F25A 4MR5A 4YABA 3MULA 5I29A 5J0DA 4QR3A 5EPBA 5A5RA 3LQIA 5ENIA 2DVQA 5D3TA 4HBVA 5D3RA 4WHUA 5E0RA 5HENA 3P5OA 4O72A 2YELA 5DKDA 4UIZA 4LZ2A 4Z6IA 5HFRA 5ENEA 5A5NA 4ZC9A 4YYKA 5F3AA 5LKXA 5C89A 5DYUA 2RFJA 4UYGA 3ONIA 4PS5A 5L99A 3K2JA 4N4HA 4KV4A 4N3WA 5FH6A 5AMEA 4YYHA 2R0YA 4QSPA 4A9MA 4A9LA 5CQ4A 3HMHA 4O74A 4HXKA 5BT3A 3U5MA 5CP5A 5ENGA 5FG4A 5IBNA 4O71A 4J3IA 2F6NA 4PCEA 5FE5A 4LZRA 4IR6A 4XUAA 5A81A 5H1TA 5E9KA 4NR8A 4YADA 5HELA 4BJXA 3DAIA 5FG5A 4XYAA 5I83A 2G4AA 5E9LA 3Q2EA 5CRMA 3TLPA 4NYVA 4ALGA 5DYAA 5EM3A 4YYGA 5CQ5A 5K29A 4YK0A 4MEOA 5H85A 5E74A 5A7CA 5JWMA 4OGJA 4F3IA 4QSTA 4XY8A 3HMEA 4QEWA 4TT2A 4DONA 5HRVA 5FE7A 5HLSA 5DYXA 5CRZA 2GRCA 5HEMA 4NR4A 5I88A 3RCWA 5IGLA 2RO1A 4LYIA 5TCMA 5FB1A 5HJCA 5A5QA 4N4FA 5DX4A 3D7CA 4YYNA 5EPSA 4NYWA 3HMFA 5F60A 3LQHA 2OSSA 3IU5A 4LRGA 5DFBA 4YH4A 2YW5A 3U5KA 5D0CA 5LUUA 5DY7A 4TU6A 5HCLA 5F1HA 3SVFA 4BW2A 5A82A 5E3DA 2DVRA 3S91A 2MJVB 5EWHA 4HXOA 4A9JA 2E7OA 3QZSA 3UVWA 5FDZA 2OO1A 4QYDA 4PKLA 3LQJA 4NUEA 5E73A 5FE3A 4O76A 5L97A 5EWWA 4BW1A 5KHMA 3SVHA 5CS8A 5A83A 5CUGA 4TZ2A 4PY6A 5F36A 4NUDA 5IG6A 5FE8A 3JVJA 4MR6A 2L85A 4UITA 5CTLA 4LZSA 4WIVA 5EK9A 5ACYA 1ZS5A 5FE4A 5F61A 5DW1A 5HQ7A 5D3HA 4O7FA 5I80A 2D9EA 5E9IA 4TQNA 4XUBA 5E9MA 5I89A 3NXBA 5FFWA 5C7NA 4A9IA 2DVVA 2WP2A 5EVAA 4QSXA 4LC2A 2LSPB 4O7EA 2DWWA 2N9GA 4ZW1A 4IR3A 3O36A 4MENA 4A9KA 5EU1A 5IGMA 4X2IA 3IU6A 4C66A 5DFCA 4MEQA 3P1EA 4MEPA 5DKHA 4J0SA 5II2A 5I40A 5CUCA 5JI8A 4UYFA 4CUQA 3P1CA 4NR5A 5LKZA 5D3LA 2WP1A 1JSPB 2E7NA 4O7AA 5IGNA 3LXJA 4O7BA 5LJ1A 5A5PA 5CU8A 4HXNA 4CUPA 5AD2A 5F2PA 5II1A 5C85A 3MUKA 5TB6A 4TT6A 4BW3A 4BHWA 4QSUA 5EWVA 5FBXA 3P1FA 2YDWA 4YATA 5G4RA 5FE0A 5F63A 5F1LA 4QUUA 4CUUA 4YY6A 5C4QA 5KTXA 3U5LA 3QZTA 5KTWA 4C67A 5CY9A 2YQDA 3G0LA 5HQ5A 3SVGA 5C87A 5DW2A 3UV2A 4TT4A 4ZQLA 2KTBB 3AADA 5DLZA 2E3KA 2RNYA 4QYLA 4A9OA 4YBSA 4QBMA 4O70A 3JVLA 3MB4A 5LJ0A 5DFDA 4TZ8A 5I1QA 3U5JA 2L5EA 4YYJA 4J0RA 4HBYA 2L84A 4A9FA 4LYWA 4HBWA 5CQ6A 5D3JA 5HQ6A 4WHWA 2I7KA 4QR5A 5HM0A 5IGKA 5LJ2A 3GG3A 2YEMA 2R0VA 5E7DA 5L8UA 4CURA 5EICA 5A85A 5KTUA 4HXLA 4ALHA 3U5NA 5EQ1A 4TYLA 5EA1A 4QB3A 4IORA 4YH3A 3ZYUA 5CUDA 5C8GA 5ETDA 5A5SA 5CQTA 5HRXA 4Z6HA 4YYIA 4Y03A 3P1DA 4NR9A 4YAXA 4NYXA 5ENHA 1JM4B 5CPEA 5DYCA 4QEVA 5FE1A 3O35A 4CFLA 5I86A 3O33A 4QEUA 3I3JA 4YBMA 5CFWA 4UIXA 1EQFA 4Z93A 5E9VA 2NXBA 2DKWA 5LKTA 4J1PA 5ENBA 4CFKA 5KO4A 5FE6A 3UW9A 4RVRA 2RNWA 4NRBA 5D7XA 4CLBA 2RS9B 5CQ3A 4QZSA 4BW4A 1WUGA 4LDFA 3U5OA 3FKMX 5KU3A 4IR5A 5L8TA 3MB3A 5ENJA 4QNSA 2FSAA 4HBXA 4QY4A 4UIYA 3JVMA 3JVKA 4GPJA 4PTBA 4CUTA 4A9HA 5LKUA 4FLPA 4IR4A 4QC3A 3LJWA 5FH8A 5D24A 1WUMA 5H1VA 5EWDA 2DATA 4O77A 4YC9A 5FG6A 4YY4A 5I7YA 4CL9A 5CGPA 4QUTA 5EP7A 4MR4A 5F62A 5FE2A 4Q0OA 4E96A 1F68A 5CUAA 4NS5A 5ETBA 4NR6A 4N4IA 4TU4A 3UV4A 4YYMA 5CUBA 4HXMA 4UYDA 4UIVA 3G0JA 4HXPA 5FE9A 4NQMA 5CQAA 4OUFA 4A9NA 4QR4A 4LYSA
chains in the Genus database with same CATH superfamily
5COIA 5CZGA 4TS8A 1E6IA 5HFQA 5BT4A 3U5PA 5EV9A 4Z1SA 2YEKA 5EPRA 4HXRA 4KCXA 2RI7A 2OUOA 3MQMA 4HXSA 3UVDA 4NQNA 3UVYA 5EWCA 5A5OA 2F6JA 5CQ8A 3MXFA 5FB0A 4QSQA 5G4SA 2DVSA 4N4GA 5ENFA 5FFVA 4NUCA 4NRCA 3UV5A 4NRAA 4NR7A 5CQ7A 5E3GA 4OGIA 4QSRA 4O75A 3O37A 5EISA 4IOQA 5DKCA 5E9YA 5D3PA 5LVRA 4IOOA 5D3SA 4YBTA 5EI4A 5D26A 4CUSA 4LR6A 4NXJA 2YYNA 5D25A 3DWYA 3UVXA 4AI6A 4Z1QA 3O34A 4KV1A 5H1UA 2RNXA 1N72A 4UYEA 5AMFA 4PCIA 5FFYA 4YYDA 4QSVA 5D3NA 5HRWA 3AQAA 4UYHA 4XY9A 2H60A 2I8NA 5L98A 5ENCA 4UIWA 5BT5A 4TTEA 2D82A 5LVQA 3D1BA 3S92A 5FH7A 5DBMA 4A9EA 4MR3A 1X0JA 4QC1A 4QSWA 3QZVA 4Q0NA 5DLXA 5F5ZA 5IIDA 5I7XA 4O78A 2R0SA 3Q2FA 4AKHA 5EGUA 4UIUA 5L96A 5AD3A 2R10A 4O7CA 4UYFB 4AKNA 5CUEA 4QSSA 5F25A 4MR5A 4YABA 3MULA 5I29A 5J0DA 4QR3A 5EPBA 5A5RA 3LQIA 5ENIA 2DVQA 5D3TA 4HBVA 5D3RA 4WHUA 5E0RA 5HENA 3P5OA 4O72A 2YELA 5DKDA 4UIZA 4LZ2A 4Z6IA 5HFRA 5ENEA 5A5NA 4ZC9A 4YYKA 5F3AA 5LKXA 5C89A 5DYUA 2RFJA 4UYGA 3ONIA 4PS5A 5L99A 3K2JA 4N4HA 4KV4A 4N3WA 5FH6A 5AMEA 4YYHA 2R0YA 4QSPA 4A9MA 4A9LA 5CQ4A 3HMHA 4O74A 4HXKA 5BT3A 3U5MA 5CP5A 5ENGA 5FG4A 5IBNA 4O71A 4J3IA 2F6NA 4PCEA 5FE5A 4LZRA 4IR6A 4XUAA 5A81A 5H1TA 5E9KA 4NR8A 4YADA 5HELA 4BJXA 3DAIA 5FG5A 4XYAA 5I83A 2G4AA 5E9LA 3Q2EA 5CRMA 3TLPA 4NYVA 4ALGA 5DYAA 5EM3A 4YYGA 5CQ5A 5K29A 4YK0A 4MEOA 5H85A 5E74A 3D1DA 5A7CA 5JWMA 4OGJA 4F3IA 4QSTA 4XY8A 3HMEA 4QEWA 4TT2A 4DONA 5HRVA 5FE7A 5HLSA 5DYXA 5CRZA 2GRCA 5HEMA 4NR4A 5I88A 3RCWA 5IGLA 2EJNA 2RO1A 4LYIA 5TCMA 5FB1A 5HJCA 5A5QA 4N4FA 5DX4A 3D7CA 4YYNA 5EPSA 4NYWA 3HMFA 5F60A 3LQHA 2OSSA 3IU5A 4LRGA 5DFBA 4YH4A 2YW5A 3U5KA 5D0CA 5LUUA 5DY7A 4TU6A 5HCLA 5F1HA 3SVFA 4BW2A 5A82A 5E3DA 2DVRA 3S91A 2MJVB 5EWHA 4HXOA 4A9JA 2E7OA 3QZSA 3UVWA 5FDZA 2OO1A 4QYDA 4PKLA 3LQJA 4NUEA 5E73A 5FE3A 3VKGA 4AKIA 4O76A 5L97A 5EWWA 4BW1A 5KHMA 3SVHA 5CS8A 5A83A 5CUGA 4TZ2A 4PY6A 5F36A 4NUDA 5IG6A 5FE8A 3JVJA 4MR6A 2L85A 4UITA 5CTLA 4LZSA 4WIVA 5EK9A 5ACYA 1ZS5A 5FE4A 5F61A 5DW1A 5HQ7A 5D3HA 4O7FA 5I80A 4AKGA 2D9EA 5E9IA 4TQNA 4XUBA 5E9MA 5I89A 3NXBA 5FFWA 5C7NA 4A9IA 2DVVA 2WP2A 5EVAA 4QSXA 4LC2A 2LSPB 4O7EA 2DWWA 1ZKRA 2N9GA 4ZW1A 4IR3A 3O36A 4MENA 4A9KA 5EU1A 5IGMA 4X2IA 3IU6A 4C66A 5DFCA 4MEQA 3P1EA 4MEPA 5DKHA 4J0SA 5II2A 5I40A 5CUCA 5JI8A 4UYFA 4CUQA 3P1CA 4NR5A 5LKZA 5D3LA 2WP1A 1JSPB 2E7NA 4O7AA 5IGNA 3LXJA 4O7BA 5LJ1A 5A5PA 5CU8A 4HXNA 4CUPA 5AD2A 5F2PA 5II1A 5C85A 3MUKA 5TB6A 4TT6A 4BW3A 4BHWA 4QSUA 5EWVA 5FBXA 3P1FA 2YDWA 4YATA 5G4RA 5FE0A 5F63A 5F1LA 4QUUA 4CUUA 4YY6A 5C4QA 5KTXA 3U5LA 3QZTA 5KTWA 4C67A 5CY9A 2YQDA 3G0LA 5HQ5A 3SVGA 5C87A 5DW2A 3VKHA 3UV2A 4TT4A 4ZQLA 2KTBB 3AADA 5DLZA 2E3KA 2RNYA 4QYLA 4A9OA 4YBSA 4QBMA 4O70A 3JVLA 3MB4A 5LJ0A 5DFDA 4TZ8A 5I1QA 3U5JA 2L5EA 4YYJA 4J0RA 4HBYA 2L84A 4A9FA 4LYWA 4HBWA 5CQ6A 5D3JA 5HQ6A 4WHWA 2I7KA 4QR5A 5HM0A 5IGKA 5LJ2A 3GG3A 2YEMA 2R0VA 5E7DA 5L8UA 4CURA 5EICA 5A85A 5KTUA 4HXLA 4ALHA 3U5NA 5EQ1A 4TYLA 5EA1A 4QB3A 4IORA 4YH3A 3ZYUA 5CUDA 5C8GA 5ETDA 5A5SA 5CQTA 5HRXA 4Z6HA 4YYIA 4Y03A 3P1DA 4NR9A 4YAXA 4NYXA 5ENHA 1JM4B 5CPEA 5DYCA 4QEVA 5FE1A 3O35A 4CFLA 5I86A 3O33A 4QEUA 3I3JA 4YBMA 5CFWA 4UIXA 1EQFA 4Z93A 5E9VA 2NXBA 2DKWA 5LKTA 4J1PA 5ENBA 4CFKA 5KO4A 5FE6A 3UW9A 4RVRA 2RNWA 4NRBA 5D7XA 4CLBA 2RS9B 5CQ3A 4QZSA 4BW4A 1WUGA 4LDFA 3U5OA 3FKMX 5KU3A 4IR5A 5L8TA 3MB3A 5ENJA 4QNSA 2FSAA 4HBXA 4QY4A 4UIYA 3JVMA 3JVKA 4GPJA 4PTBA 4CUTA 4A9HA 5LKUA 4FLPA 4IR4A 4QC3A 3LJWA 5FH8A 5D24A 1WUMA 5H1VA 5EWDA 3ERRA 2DATA 4O77A 4YC9A 5FG6A 4YY4A 5I7YA 4CL9A 1PUOA 5CGPA 4QUTA 5EP7A 4MR4A 5F62A 5FE2A 4Q0OA 4E96A 1F68A 5CUAA 4NS5A 5ETBA 4NR6A 4N4IA 4TU4A 3UV4A 4YYMA 5CUBA 4HXMA 4UYDA 4UIVA 3G0JA 4HXPA 5FE9A 4NQMA 5CQAA 4OUFA 4A9NA 4QR4A 4LYSA
chains in the Genus database with same CATH topology
5COIA 5CZGA 4TS8A 1E6IA 5HFQA 5BT4A 3U5PA 5EV9A 4Z1SA 2YEKA 5EPRA 4HXRA 4KCXA 2RI7A 2OUOA 3MQMA 4HXSA 3UVDA 4NQNA 3UVYA 5EWCA 5A5OA 2F6JA 5CQ8A 3MXFA 5FB0A 4QSQA 5G4SA 2DVSA 4N4GA 5ENFA 5FFVA 4NUCA 4NRCA 3UV5A 4NRAA 4NR7A 5CQ7A 5E3GA 4OGIA 4QSRA 4O75A 3O37A 5EISA 4IOQA 5DKCA 5E9YA 5D3PA 5LVRA 4IOOA 5D3SA 4YBTA 5EI4A 5D26A 4CUSA 4LR6A 4NXJA 2YYNA 5D25A 3DWYA 3UVXA 4Z1QA 3O34A 4KV1A 5H1UA 2RNXA 1N72A 4UYEA 5AMFA 4PCIA 5FFYA 4YYDA 4QSVA 5D3NA 5HRWA 3AQAA 4UYHA 4XY9A 2H60A 2I8NA 5L98A 5ENCA 4UIWA 5BT5A 4TTEA 2D82A 5LVQA 3S92A 5FH7A 5DBMA 4A9EA 4MR3A 1X0JA 4QC1A 4QSWA 3QZVA 4Q0NA 5DLXA 5F5ZA 5IIDA 5I7XA 4O78A 2R0SA 3Q2FA 5EGUA 4UIUA 5L96A 5AD3A 2R10A 4O7CA 4UYFB 4AKNA 5CUEA 4QSSA 5F25A 4MR5A 4YABA 3MULA 5I29A 5J0DA 4QR3A 5EPBA 5A5RA 3LQIA 5ENIA 2DVQA 5D3TA 4HBVA 5D3RA 4WHUA 5E0RA 5HENA 3P5OA 4O72A 2YELA 5DKDA 4UIZA 4LZ2A 4Z6IA 5HFRA 5ENEA 5A5NA 4ZC9A 4YYKA 5F3AA 5LKXA 5C89A 5DYUA 2RFJA 4UYGA 3ONIA 4PS5A 5L99A 3K2JA 4N4HA 4KV4A 4N3WA 5FH6A 5AMEA 4YYHA 2R0YA 4QSPA 4A9MA 4A9LA 5CQ4A 3HMHA 4O74A 4HXKA 5BT3A 3U5MA 5CP5A 5ENGA 5FG4A 5IBNA 4O71A 4J3IA 2F6NA 4PCEA 5FE5A 4LZRA 4IR6A 4XUAA 5A81A 5H1TA 5E9KA 4NR8A 4YADA 5HELA 4BJXA 3DAIA 5FG5A 4XYAA 5I83A 2G4AA 5E9LA 3Q2EA 5CRMA 3TLPA 4NYVA 4ALGA 5DYAA 5EM3A 4YYGA 5CQ5A 5K29A 4YK0A 4MEOA 5H85A 5E74A 5A7CA 5JWMA 4OGJA 4F3IA 4QSTA 4XY8A 3HMEA 4QEWA 4TT2A 4DONA 5HRVA 5FE7A 5HLSA 5DYXA 5CRZA 2GRCA 5HEMA 4NR4A 5I88A 3RCWA 5IGLA 2RO1A 4LYIA 5TCMA 5FB1A 5HJCA 5A5QA 4N4FA 5DX4A 3D7CA 4YYNA 5EPSA 4NYWA 3HMFA 5F60A 3LQHA 2OSSA 3IU5A 4LRGA 5DFBA 4YH4A 2YW5A 3U5KA 5D0CA 5LUUA 5DY7A 4TU6A 5HCLA 5F1HA 3SVFA 4BW2A 5A82A 5E3DA 2DVRA 3S91A 2MJVB 5EWHA 4HXOA 4A9JA 2E7OA 3QZSA 3UVWA 5FDZA 2OO1A 4QYDA 4PKLA 3LQJA 4NUEA 5E73A 5FE3A 4O76A 5L97A 5EWWA 4BW1A 5KHMA 3SVHA 5CS8A 5A83A 5CUGA 4TZ2A 4PY6A 5F36A 4NUDA 5IG6A 5FE8A 3JVJA 4MR6A 2L85A 4UITA 5CTLA 4LZSA 4WIVA 5EK9A 5ACYA 1ZS5A 5FE4A 5F61A 5DW1A 5HQ7A 5D3HA 4O7FA 5I80A 2D9EA 5E9IA 4TQNA 4XUBA 5E9MA 5I89A 3NXBA 5FFWA 5C7NA 4A9IA 2DVVA 2WP2A 5EVAA 4QSXA 4LC2A 2LSPB 4O7EA 2DWWA 2N9GA 4ZW1A 4IR3A 3O36A 4MENA 4A9KA 5EU1A 5IGMA 4X2IA 3IU6A 4C66A 5DFCA 4MEQA 3P1EA 4MEPA 5DKHA 4J0SA 5II2A 5I40A 5CUCA 5JI8A 4UYFA 4CUQA 3P1CA 4NR5A 5LKZA 5D3LA 2WP1A 1JSPB 2E7NA 4O7AA 5IGNA 3LXJA 4O7BA 5LJ1A 5A5PA 5CU8A 4HXNA 4CUPA 5AD2A 5F2PA 5II1A 5C85A 3MUKA 5TB6A 4TT6A 4BW3A 4BHWA 4QSUA 5EWVA 5FBXA 3P1FA 2YDWA 4YATA 5G4RA 5FE0A 5F63A 5F1LA 4QUUA 4CUUA 4YY6A 5C4QA 5KTXA 3U5LA 3QZTA 5KTWA 4C67A 5CY9A 2YQDA 3G0LA 5HQ5A 3SVGA 5C87A 5DW2A 3UV2A 4TT4A 4ZQLA 2KTBB 3AADA 5DLZA 2E3KA 2RNYA 4QYLA 4A9OA 4YBSA 4QBMA 4O70A 3JVLA 3MB4A 5LJ0A 5DFDA 4TZ8A 5I1QA 3U5JA 2L5EA 4YYJA 4J0RA 4HBYA 2L84A 4A9FA 4LYWA 4HBWA 5CQ6A 5D3JA 5HQ6A 4WHWA 2I7KA 4QR5A 5HM0A 5IGKA 5LJ2A 3GG3A 2YEMA 2R0VA 5E7DA 5L8UA 4CURA 5EICA 5A85A 5KTUA 4HXLA 4ALHA 3U5NA 5EQ1A 4TYLA 5EA1A 4QB3A 4IORA 4YH3A 3ZYUA 5CUDA 5C8GA 5ETDA 5A5SA 5CQTA 5HRXA 4Z6HA 4YYIA 4Y03A 3P1DA 4NR9A 4YAXA 4NYXA 5ENHA 1JM4B 5CPEA 5DYCA 4QEVA 5FE1A 3O35A 4CFLA 5I86A 3O33A 4QEUA 3I3JA 4YBMA 5CFWA 4UIXA 1EQFA 4Z93A 5E9VA 2NXBA 2DKWA 5LKTA 4J1PA 5ENBA 4CFKA 5KO4A 5FE6A 3UW9A 4RVRA 2RNWA 4NRBA 5D7XA 4CLBA 2RS9B 5CQ3A 4QZSA 4BW4A 1WUGA 4LDFA 3U5OA 3FKMX 5KU3A 4IR5A 5L8TA 3MB3A 5ENJA 4QNSA 2FSAA 4HBXA 4QY4A 4UIYA 3JVMA 3JVKA 4GPJA 4PTBA 4CUTA 4A9HA 5LKUA 4FLPA 4IR4A 4QC3A 3LJWA 5FH8A 5D24A 1WUMA 5H1VA 5EWDA 2DATA 4O77A 4YC9A 5FG6A 4YY4A 5I7YA 4CL9A 5CGPA 4QUTA 5EP7A 4MR4A 5F62A 5FE2A 4Q0OA 4E96A 1F68A 5CUAA 4NS5A 5ETBA 4NR6A 4N4IA 4TU4A 3UV4A 4YYMA 5CUBA 4HXMA 4UYDA 4UIVA 3G0JA 4HXPA 5FE9A 4NQMA 5CQAA 4OUFA 4A9NA 4QR4A 4LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COI A;  5CZG A;  4TS8 A;  1E6I A;  5HFQ A;  5BT4 A;  3U5P A;  5EV9 A;  4Z1S A;  2YEK A;  5EPR A;  4HXR A;  4KCX A;  2RI7 A;  2OUO A;  3MQM A;  4HXS A;  3UVD A;  4NQN A;  3UVY A;  5EWC A;  5A5O A;  2F6J A;  5CQ8 A;  3MXF A;  5FB0 A;  4QSQ A;  5G4S A;  2DVS A;  4N4G A;  5ENF A;  5FFV A;  4NUC A;  4NRC A;  3UV5 A;  4NRA A;  4NR7 A;  5CQ7 A;  5E3G A;  4OGI A;  4QSR A;  4O75 A;  3O37 A;  5EIS A;  4IOQ A;  5DKC A;  5E9Y A;  5D3P A;  5LVR A;  4IOO A;  5D3S A;  4YBT A;  5EI4 A;  5D26 A;  4CUS A;  4LR6 A;  4NXJ A;  2YYN A;  5D25 A;  3DWY A;  3UVX A;  4Z1Q A;  3O34 A;  4KV1 A;  5H1U A;  2RNX A;  1N72 A;  4UYE A;  5AMF A;  4PCI A;  5FFY A;  4YYD A;  4QSV A;  5D3N A;  5HRW A;  3AQA A;  4UYH A;  4XY9 A;  2H60 A;  2I8N A;  5L98 A;  5ENC A;  4UIW A;  5BT5 A;  4TTE A;  2D82 A;  5LVQ A;  3S92 A;  5FH7 A;  5DBM A;  4A9E A;  4MR3 A;  1X0J A;  4QC1 A;  4QSW A;  3QZV A;  4Q0N A;  5DLX A;  5F5Z A;  5IID A;  5I7X A;  4O78 A;  2R0S A;  3Q2F A;  5EGU A;  4UIU A;  5L96 A;  5AD3 A;  2R10 A;  4O7C A;  4UYF B;  4AKN A;  5CUE A;  4QSS A;  5F25 A;  4MR5 A;  4YAB A;  3MUL A;  5I29 A;  5J0D A;  4QR3 A;  5EPB A;  5A5R A;  3LQI A;  5ENI A;  2DVQ A;  5D3T A;  4HBV A;  5D3R A;  4WHU A;  5E0R A;  5HEN A;  3P5O A;  4O72 A;  2YEL A;  5DKD A;  4UIZ A;  4LZ2 A;  4Z6I A;  5HFR A;  5ENE A;  5A5N A;  4ZC9 A;  4YYK A;  5F3A A;  5LKX A;  5C89 A;  5DYU A;  2RFJ A;  4UYG A;  3ONI A;  4PS5 A;  5L99 A;  3K2J A;  4N4H A;  4KV4 A;  4N3W A;  5FH6 A;  5AME A;  4YYH A;  2R0Y A;  4QSP A;  4A9M A;  4A9L A;  5CQ4 A;  3HMH A;  4O74 A;  4HXK A;  5BT3 A;  3U5M A;  5CP5 A;  5ENG A;  5FG4 A;  5IBN A;  4O71 A;  4J3I A;  2F6N A;  4PCE A;  5FE5 A;  4LZR A;  4IR6 A;  4XUA A;  5A81 A;  5H1T A;  5E9K A;  4NR8 A;  4YAD A;  5HEL A;  4BJX A;  3DAI A;  5FG5 A;  4XYA A;  5I83 A;  2G4A A;  5E9L A;  3Q2E A;  5CRM A;  3TLP A;  4NYV A;  4ALG A;  5DYA A;  5EM3 A;  4YYG A;  5CQ5 A;  5K29 A;  4YK0 A;  4MEO A;  5H85 A;  5E74 A;  5A7C A;  5JWM A;  4OGJ A;  4F3I A;  4QST A;  4XY8 A;  3HME A;  4QEW A;  4TT2 A;  4DON A;  5HRV A;  5FE7 A;  5HLS A;  5DYX A;  5CRZ A;  2GRC A;  5HEM A;  4NR4 A;  5I88 A;  3RCW A;  5IGL A;  2RO1 A;  4LYI A;  5TCM A;  5FB1 A;  5HJC A;  5A5Q A;  4N4F A;  5DX4 A;  3D7C A;  4YYN A;  5EPS A;  4NYW A;  3HMF A;  5F60 A;  3LQH A;  2OSS A;  3IU5 A;  4LRG A;  5DFB A;  4YH4 A;  2YW5 A;  3U5K A;  5D0C A;  5LUU A;  5DY7 A;  4TU6 A;  5HCL A;  5F1H A;  3SVF A;  4BW2 A;  5A82 A;  5E3D A;  2DVR A;  3S91 A;  2MJV B;  5EWH A;  4HXO A;  4A9J A;  2E7O A;  3QZS A;  3UVW A;  5FDZ A;  2OO1 A;  4QYD A;  4PKL A;  3LQJ A;  4NUE A;  5E73 A;  5FE3 A;  4O76 A;  5L97 A;  5EWW A;  4BW1 A;  5KHM A;  3SVH A;  5CS8 A;  5A83 A;  5CUG A;  4TZ2 A;  4PY6 A;  5F36 A;  4NUD A;  5IG6 A;  5FE8 A;  3JVJ A;  4MR6 A;  2L85 A;  4UIT A;  5CTL A;  4LZS A;  4WIV A;  5EK9 A;  5ACY A;  1ZS5 A;  5FE4 A;  5F61 A;  5DW1 A;  5HQ7 A;  5D3H A;  4O7F A;  5I80 A;  2D9E A;  5E9I A;  4TQN A;  4XUB A;  5E9M A;  5I89 A;  3NXB A;  5FFW A;  5C7N A;  4A9I A;  2DVV A;  2WP2 A;  5EVA A;  4QSX A;  4LC2 A;  2LSP B;  4O7E A;  2DWW A;  2N9G A;  4ZW1 A;  4IR3 A;  3O36 A;  4MEN A;  4A9K A;  5EU1 A;  5IGM A;  4X2I A;  3IU6 A;  4C66 A;  5DFC A;  4MEQ A;  3P1E A;  4MEP A;  5DKH A;  4J0S A;  5II2 A;  5I40 A;  5CUC A;  5JI8 A;  4UYF A;  4CUQ A;  3P1C A;  4NR5 A;  5LKZ A;  5D3L A;  2WP1 A;  1JSP B;  2E7N A;  4O7A A;  5IGN A;  3LXJ A;  4O7B A;  5LJ1 A;  5A5P A;  5CU8 A;  4HXN A;  4CUP A;  5AD2 A;  5F2P A;  5II1 A;  5C85 A;  3MUK A;  5TB6 A;  4TT6 A;  4BW3 A;  4BHW A;  4QSU A;  5EWV A;  5FBX A;  3P1F A;  2YDW A;  4YAT A;  5G4R A;  5FE0 A;  5F63 A;  5F1L A;  4QUU A;  4CUU A;  4YY6 A;  5C4Q A;  5KTX A;  3U5L A;  3QZT A;  5KTW A;  4C67 A;  5CY9 A;  2YQD A;  3G0L A;  5HQ5 A;  3SVG A;  5C87 A;  5DW2 A;  3UV2 A;  4TT4 A;  4ZQL A;  2KTB B;  3AAD A;  5DLZ A;  2E3K A;  2RNY A;  4QYL A;  4A9O A;  4YBS A;  4QBM A;  4O70 A;  3JVL A;  3MB4 A;  5LJ0 A;  5DFD A;  4TZ8 A;  5I1Q A;  3U5J A;  2L5E A;  4YYJ A;  4J0R A;  4HBY A;  2L84 A;  4A9F A;  4LYW A;  4HBW A;  5CQ6 A;  5D3J A;  5HQ6 A;  4WHW A;  2I7K A;  4QR5 A;  5HM0 A;  5IGK A;  5LJ2 A;  3GG3 A;  2YEM A;  2R0V A;  5E7D A;  5L8U A;  4CUR A;  5EIC A;  5A85 A;  5KTU A;  4HXL A;  4ALH A;  3U5N A;  5EQ1 A;  4TYL A;  5EA1 A;  4QB3 A;  4IOR A;  4YH3 A;  3ZYU A;  5CUD A;  5C8G A;  5ETD A;  5A5S A;  5CQT A;  5HRX A;  4Z6H A;  4YYI A;  4Y03 A;  3P1D A;  4NR9 A;  4YAX A;  4NYX A;  5ENH A;  1JM4 B;  5CPE A;  5DYC A;  4QEV A;  5FE1 A;  3O35 A;  4CFL A;  5I86 A;  3O33 A;  4QEU A;  3I3J A;  4YBM A;  5CFW A;  4UIX A;  1EQF A;  4Z93 A;  5E9V A;  2NXB A;  2DKW A;  5LKT A;  4J1P A;  5ENB A;  4CFK A;  5KO4 A;  5FE6 A;  3UW9 A;  4RVR A;  2RNW A;  4NRB A;  5D7X A;  4CLB A;  2RS9 B;  5CQ3 A;  4QZS A;  4BW4 A;  1WUG A;  4LDF A;  3U5O A;  3FKM X;  5KU3 A;  4IR5 A;  5L8T A;  3MB3 A;  5ENJ A;  4QNS A;  2FSA A;  4HBX A;  4QY4 A;  4UIY A;  3JVM A;  3JVK A;  4GPJ A;  4PTB A;  4CUT A;  4A9H A;  5LKU A;  4FLP A;  4IR4 A;  4QC3 A;  3LJW A;  5FH8 A;  5D24 A;  1WUM A;  5H1V A;  5EWD A;  2DAT A;  4O77 A;  4YC9 A;  5FG6 A;  4YY4 A;  5I7Y A;  4CL9 A;  5CGP A;  4QUT A;  5EP7 A;  4MR4 A;  5F62 A;  5FE2 A;  4Q0O A;  4E96 A;  1F68 A;  5CUA A;  4NS5 A;  5ETB A;  4NR6 A;  4N4I A;  4TU4 A;  3UV4 A;  4YYM A;  5CUB A;  4HXM A;  4UYD A;  4UIV A;  3G0J A;  4HXP A;  5FE9 A;  4NQM A;  5CQA A;  4OUF A;  4A9N A;  4QR4 A;  4LYS A; 
#chains in the Genus database with same CATH topology
 5COI A;  5CZG A;  4TS8 A;  1E6I A;  5HFQ A;  5BT4 A;  3U5P A;  5EV9 A;  4Z1S A;  2YEK A;  5EPR A;  4HXR A;  4KCX A;  2RI7 A;  2OUO A;  3MQM A;  4HXS A;  3UVD A;  4NQN A;  3UVY A;  5EWC A;  5A5O A;  2F6J A;  5CQ8 A;  3MXF A;  5FB0 A;  4QSQ A;  5G4S A;  2DVS A;  4N4G A;  5ENF A;  5FFV A;  4NUC A;  4NRC A;  3UV5 A;  4NRA A;  4NR7 A;  5CQ7 A;  5E3G A;  4OGI A;  4QSR A;  4O75 A;  3O37 A;  5EIS A;  4IOQ A;  5DKC A;  5E9Y A;  5D3P A;  5LVR A;  4IOO A;  5D3S A;  4YBT A;  5EI4 A;  5D26 A;  4CUS A;  4LR6 A;  4NXJ A;  2YYN A;  5D25 A;  3DWY A;  3UVX A;  4AI6 A;  4Z1Q A;  3O34 A;  4KV1 A;  5H1U A;  2RNX A;  1N72 A;  4UYE A;  5AMF A;  4PCI A;  5FFY A;  4YYD A;  4QSV A;  5D3N A;  5HRW A;  3AQA A;  4UYH A;  4XY9 A;  2H60 A;  2I8N A;  5L98 A;  5ENC A;  4UIW A;  5BT5 A;  4TTE A;  2D82 A;  5LVQ A;  3D1B A;  3S92 A;  5FH7 A;  5DBM A;  4A9E A;  4MR3 A;  1X0J A;  4QC1 A;  4QSW A;  3QZV A;  4Q0N A;  5DLX A;  5F5Z A;  5IID A;  5I7X A;  4O78 A;  2R0S A;  3Q2F A;  4AKH A;  5EGU A;  4UIU A;  5L96 A;  5AD3 A;  2R10 A;  4O7C A;  4UYF B;  4AKN A;  5CUE A;  4QSS A;  5F25 A;  4MR5 A;  4YAB A;  3MUL A;  5I29 A;  5J0D A;  4QR3 A;  5EPB A;  5A5R A;  3LQI A;  5ENI A;  2DVQ A;  5D3T A;  4HBV A;  5D3R A;  4WHU A;  5E0R A;  5HEN A;  3P5O A;  4O72 A;  2YEL A;  5DKD A;  4UIZ A;  4LZ2 A;  4Z6I A;  5HFR A;  5ENE A;  5A5N A;  4ZC9 A;  4YYK A;  5F3A A;  5LKX A;  5C89 A;  5DYU A;  2RFJ A;  4UYG A;  3ONI A;  4PS5 A;  5L99 A;  3K2J A;  4N4H A;  4KV4 A;  4N3W A;  5FH6 A;  5AME A;  4YYH A;  2R0Y A;  4QSP A;  4A9M A;  4A9L A;  5CQ4 A;  3HMH A;  4O74 A;  4HXK A;  5BT3 A;  3U5M A;  5CP5 A;  5ENG A;  5FG4 A;  5IBN A;  4O71 A;  4J3I A;  2F6N A;  4PCE A;  5FE5 A;  4LZR A;  4IR6 A;  4XUA A;  5A81 A;  5H1T A;  5E9K A;  4NR8 A;  4YAD A;  5HEL A;  4BJX A;  3DAI A;  5FG5 A;  4XYA A;  5I83 A;  2G4A A;  5E9L A;  3Q2E A;  5CRM A;  3TLP A;  4NYV A;  4ALG A;  5DYA A;  5EM3 A;  4YYG A;  5CQ5 A;  5K29 A;  4YK0 A;  4MEO A;  5H85 A;  5E74 A;  3D1D A;  5A7C A;  5JWM A;  4OGJ A;  4F3I A;  4QST A;  4XY8 A;  3HME A;  4QEW A;  4TT2 A;  4DON A;  5HRV A;  5FE7 A;  5HLS A;  5DYX A;  5CRZ A;  2GRC A;  5HEM A;  4NR4 A;  5I88 A;  3RCW A;  5IGL A;  2EJN A;  2RO1 A;  4LYI A;  5TCM A;  5FB1 A;  5HJC A;  5A5Q A;  4N4F A;  5DX4 A;  3D7C A;  4YYN A;  5EPS A;  4NYW A;  3HMF A;  5F60 A;  3LQH A;  2OSS A;  3IU5 A;  4LRG A;  5DFB A;  4YH4 A;  2YW5 A;  3U5K A;  5D0C A;  5LUU A;  5DY7 A;  4TU6 A;  5HCL A;  5F1H A;  3SVF A;  4BW2 A;  5A82 A;  5E3D A;  2DVR A;  3S91 A;  2MJV B;  5EWH A;  4HXO A;  4A9J A;  2E7O A;  3QZS A;  3UVW A;  5FDZ A;  2OO1 A;  4QYD A;  4PKL A;  3LQJ A;  4NUE A;  5E73 A;  5FE3 A;  3VKG A;  4AKI A;  4O76 A;  5L97 A;  5EWW A;  4BW1 A;  5KHM A;  3SVH A;  5CS8 A;  5A83 A;  5CUG A;  4TZ2 A;  4PY6 A;  5F36 A;  4NUD A;  5IG6 A;  5FE8 A;  3JVJ A;  4MR6 A;  2L85 A;  4UIT A;  5CTL A;  4LZS A;  4WIV A;  5EK9 A;  5ACY A;  1ZS5 A;  5FE4 A;  5F61 A;  5DW1 A;  5HQ7 A;  5D3H A;  4O7F A;  5I80 A;  4AKG A;  2D9E A;  5E9I A;  4TQN A;  4XUB A;  5E9M A;  5I89 A;  3NXB A;  5FFW A;  5C7N A;  4A9I A;  2DVV A;  2WP2 A;  5EVA A;  4QSX A;  4LC2 A;  2LSP B;  4O7E A;  2DWW A;  1ZKR A;  2N9G A;  4ZW1 A;  4IR3 A;  3O36 A;  4MEN A;  4A9K A;  5EU1 A;  5IGM A;  4X2I A;  3IU6 A;  4C66 A;  5DFC A;  4MEQ A;  3P1E A;  4MEP A;  5DKH A;  4J0S A;  5II2 A;  5I40 A;  5CUC A;  5JI8 A;  4UYF A;  4CUQ A;  3P1C A;  4NR5 A;  5LKZ A;  5D3L A;  2WP1 A;  1JSP B;  2E7N A;  4O7A A;  5IGN A;  3LXJ A;  4O7B A;  5LJ1 A;  5A5P A;  5CU8 A;  4HXN A;  4CUP A;  5AD2 A;  5F2P A;  5II1 A;  5C85 A;  3MUK A;  5TB6 A;  4TT6 A;  4BW3 A;  4BHW A;  4QSU A;  5EWV A;  5FBX A;  3P1F A;  2YDW A;  4YAT A;  5G4R A;  5FE0 A;  5F63 A;  5F1L A;  4QUU A;  4CUU A;  4YY6 A;  5C4Q A;  5KTX A;  3U5L A;  3QZT A;  5KTW A;  4C67 A;  5CY9 A;  2YQD A;  3G0L A;  5HQ5 A;  3SVG A;  5C87 A;  5DW2 A;  3VKH A;  3UV2 A;  4TT4 A;  4ZQL A;  2KTB B;  3AAD A;  5DLZ A;  2E3K A;  2RNY A;  4QYL A;  4A9O A;  4YBS A;  4QBM A;  4O70 A;  3JVL A;  3MB4 A;  5LJ0 A;  5DFD A;  4TZ8 A;  5I1Q A;  3U5J A;  2L5E A;  4YYJ A;  4J0R A;  4HBY A;  2L84 A;  4A9F A;  4LYW A;  4HBW A;  5CQ6 A;  5D3J A;  5HQ6 A;  4WHW A;  2I7K A;  4QR5 A;  5HM0 A;  5IGK A;  5LJ2 A;  3GG3 A;  2YEM A;  2R0V A;  5E7D A;  5L8U A;  4CUR A;  5EIC A;  5A85 A;  5KTU A;  4HXL A;  4ALH A;  3U5N A;  5EQ1 A;  4TYL A;  5EA1 A;  4QB3 A;  4IOR A;  4YH3 A;  3ZYU A;  5CUD A;  5C8G A;  5ETD A;  5A5S A;  5CQT A;  5HRX A;  4Z6H A;  4YYI A;  4Y03 A;  3P1D A;  4NR9 A;  4YAX A;  4NYX A;  5ENH A;  1JM4 B;  5CPE A;  5DYC A;  4QEV A;  5FE1 A;  3O35 A;  4CFL A;  5I86 A;  3O33 A;  4QEU A;  3I3J A;  4YBM A;  5CFW A;  4UIX A;  1EQF A;  4Z93 A;  5E9V A;  2NXB A;  2DKW A;  5LKT A;  4J1P A;  5ENB A;  4CFK A;  5KO4 A;  5FE6 A;  3UW9 A;  4RVR A;  2RNW A;  4NRB A;  5D7X A;  4CLB A;  2RS9 B;  5CQ3 A;  4QZS A;  4BW4 A;  1WUG A;  4LDF A;  3U5O A;  3FKM X;  5KU3 A;  4IR5 A;  5L8T A;  3MB3 A;  5ENJ A;  4QNS A;  2FSA A;  4HBX A;  4QY4 A;  4UIY A;  3JVM A;  3JVK A;  4GPJ A;  4PTB A;  4CUT A;  4A9H A;  5LKU A;  4FLP A;  4IR4 A;  4QC3 A;  3LJW A;  5FH8 A;  5D24 A;  1WUM A;  5H1V A;  5EWD A;  3ERR A;  2DAT A;  4O77 A;  4YC9 A;  5FG6 A;  4YY4 A;  5I7Y A;  4CL9 A;  1PUO A;  5CGP A;  4QUT A;  5EP7 A;  4MR4 A;  5F62 A;  5FE2 A;  4Q0O A;  4E96 A;  1F68 A;  5CUA A;  4NS5 A;  5ETB A;  4NR6 A;  4N4I A;  4TU4 A;  3UV4 A;  4YYM A;  5CUB A;  4HXM A;  4UYD A;  4UIV A;  3G0J A;  4HXP A;  5FE9 A;  4NQM A;  5CQA A;  4OUF A;  4A9N A;  4QR4 A;  4LYS A; 
#chains in the Genus database with same CATH homology
 5COI A;  5CZG A;  4TS8 A;  1E6I A;  5HFQ A;  5BT4 A;  3U5P A;  5EV9 A;  4Z1S A;  2YEK A;  5EPR A;  4HXR A;  4KCX A;  2RI7 A;  2OUO A;  3MQM A;  4HXS A;  3UVD A;  4NQN A;  3UVY A;  5EWC A;  5A5O A;  2F6J A;  5CQ8 A;  3MXF A;  5FB0 A;  4QSQ A;  5G4S A;  2DVS A;  4N4G A;  5ENF A;  5FFV A;  4NUC A;  4NRC A;  3UV5 A;  4NRA A;  4NR7 A;  5CQ7 A;  5E3G A;  4OGI A;  4QSR A;  4O75 A;  3O37 A;  5EIS A;  4IOQ A;  5DKC A;  5E9Y A;  5D3P A;  5LVR A;  4IOO A;  5D3S A;  4YBT A;  5EI4 A;  5D26 A;  4CUS A;  4LR6 A;  4NXJ A;  2YYN A;  5D25 A;  3DWY A;  3UVX A;  4Z1Q A;  3O34 A;  4KV1 A;  5H1U A;  2RNX A;  1N72 A;  4UYE A;  5AMF A;  4PCI A;  5FFY A;  4YYD A;  4QSV A;  5D3N A;  5HRW A;  3AQA A;  4UYH A;  4XY9 A;  2H60 A;  2I8N A;  5L98 A;  5ENC A;  4UIW A;  5BT5 A;  4TTE A;  2D82 A;  5LVQ A;  3S92 A;  5FH7 A;  5DBM A;  4A9E A;  4MR3 A;  1X0J A;  4QC1 A;  4QSW A;  3QZV A;  4Q0N A;  5DLX A;  5F5Z A;  5IID A;  5I7X A;  4O78 A;  2R0S A;  3Q2F A;  5EGU A;  4UIU A;  5L96 A;  5AD3 A;  2R10 A;  4O7C A;  4UYF B;  4AKN A;  5CUE A;  4QSS A;  5F25 A;  4MR5 A;  4YAB A;  3MUL A;  5I29 A;  5J0D A;  4QR3 A;  5EPB A;  5A5R A;  3LQI A;  5ENI A;  2DVQ A;  5D3T A;  4HBV A;  5D3R A;  4WHU A;  5E0R A;  5HEN A;  3P5O A;  4O72 A;  2YEL A;  5DKD A;  4UIZ A;  4LZ2 A;  4Z6I A;  5HFR A;  5ENE A;  5A5N A;  4ZC9 A;  4YYK A;  5F3A A;  5LKX A;  5C89 A;  5DYU A;  2RFJ A;  4UYG A;  3ONI A;  4PS5 A;  5L99 A;  3K2J A;  4N4H A;  4KV4 A;  4N3W A;  5FH6 A;  5AME A;  4YYH A;  2R0Y A;  4QSP A;  4A9M A;  4A9L A;  5CQ4 A;  3HMH A;  4O74 A;  4HXK A;  5BT3 A;  3U5M A;  5CP5 A;  5ENG A;  5FG4 A;  5IBN A;  4O71 A;  4J3I A;  2F6N A;  4PCE A;  5FE5 A;  4LZR A;  4IR6 A;  4XUA A;  5A81 A;  5H1T A;  5E9K A;  4NR8 A;  4YAD A;  5HEL A;  4BJX A;  3DAI A;  5FG5 A;  4XYA A;  5I83 A;  2G4A A;  5E9L A;  3Q2E A;  5CRM A;  3TLP A;  4NYV A;  4ALG A;  5DYA A;  5EM3 A;  4YYG A;  5CQ5 A;  5K29 A;  4YK0 A;  4MEO A;  5H85 A;  5E74 A;  5A7C A;  5JWM A;  4OGJ A;  4F3I A;  4QST A;  4XY8 A;  3HME A;  4QEW A;  4TT2 A;  4DON A;  5HRV A;  5FE7 A;  5HLS A;  5DYX A;  5CRZ A;  2GRC A;  5HEM A;  4NR4 A;  5I88 A;  3RCW A;  5IGL A;  2RO1 A;  4LYI A;  5TCM A;  5FB1 A;  5HJC A;  5A5Q A;  4N4F A;  5DX4 A;  3D7C A;  4YYN A;  5EPS A;  4NYW A;  3HMF A;  5F60 A;  3LQH A;  2OSS A;  3IU5 A;  4LRG A;  5DFB A;  4YH4 A;  2YW5 A;  3U5K A;  5D0C A;  5LUU A;  5DY7 A;  4TU6 A;  5HCL A;  5F1H A;  3SVF A;  4BW2 A;  5A82 A;  5E3D A;  2DVR A;  3S91 A;  2MJV B;  5EWH A;  4HXO A;  4A9J A;  2E7O A;  3QZS A;  3UVW A;  5FDZ A;  2OO1 A;  4QYD A;  4PKL A;  3LQJ A;  4NUE A;  5E73 A;  5FE3 A;  4O76 A;  5L97 A;  5EWW A;  4BW1 A;  5KHM A;  3SVH A;  5CS8 A;  5A83 A;  5CUG A;  4TZ2 A;  4PY6 A;  5F36 A;  4NUD A;  5IG6 A;  5FE8 A;  3JVJ A;  4MR6 A;  2L85 A;  4UIT A;  5CTL A;  4LZS A;  4WIV A;  5EK9 A;  5ACY A;  1ZS5 A;  5FE4 A;  5F61 A;  5DW1 A;  5HQ7 A;  5D3H A;  4O7F A;  5I80 A;  2D9E A;  5E9I A;  4TQN A;  4XUB A;  5E9M A;  5I89 A;  3NXB A;  5FFW A;  5C7N A;  4A9I A;  2DVV A;  2WP2 A;  5EVA A;  4QSX A;  4LC2 A;  2LSP B;  4O7E A;  2DWW A;  2N9G A;  4ZW1 A;  4IR3 A;  3O36 A;  4MEN A;  4A9K A;  5EU1 A;  5IGM A;  4X2I A;  3IU6 A;  4C66 A;  5DFC A;  4MEQ A;  3P1E A;  4MEP A;  5DKH A;  4J0S A;  5II2 A;  5I40 A;  5CUC A;  5JI8 A;  4UYF A;  4CUQ A;  3P1C A;  4NR5 A;  5LKZ A;  5D3L A;  2WP1 A;  1JSP B;  2E7N A;  4O7A A;  5IGN A;  3LXJ A;  4O7B A;  5LJ1 A;  5A5P A;  5CU8 A;  4HXN A;  4CUP A;  5AD2 A;  5F2P A;  5II1 A;  5C85 A;  3MUK A;  5TB6 A;  4TT6 A;  4BW3 A;  4BHW A;  4QSU A;  5EWV A;  5FBX A;  3P1F A;  2YDW A;  4YAT A;  5G4R A;  5FE0 A;  5F63 A;  5F1L A;  4QUU A;  4CUU A;  4YY6 A;  5C4Q A;  5KTX A;  3U5L A;  3QZT A;  5KTW A;  4C67 A;  5CY9 A;  2YQD A;  3G0L A;  5HQ5 A;  3SVG A;  5C87 A;  5DW2 A;  3UV2 A;  4TT4 A;  4ZQL A;  2KTB B;  3AAD A;  5DLZ A;  2E3K A;  2RNY A;  4QYL A;  4A9O A;  4YBS A;  4QBM A;  4O70 A;  3JVL A;  3MB4 A;  5LJ0 A;  5DFD A;  4TZ8 A;  5I1Q A;  3U5J A;  2L5E A;  4YYJ A;  4J0R A;  4HBY A;  2L84 A;  4A9F A;  4LYW A;  4HBW A;  5CQ6 A;  5D3J A;  5HQ6 A;  4WHW A;  2I7K A;  4QR5 A;  5HM0 A;  5IGK A;  5LJ2 A;  3GG3 A;  2YEM A;  2R0V A;  5E7D A;  5L8U A;  4CUR A;  5EIC A;  5A85 A;  5KTU A;  4HXL A;  4ALH A;  3U5N A;  5EQ1 A;  4TYL A;  5EA1 A;  4QB3 A;  4IOR A;  4YH3 A;  3ZYU A;  5CUD A;  5C8G A;  5ETD A;  5A5S A;  5CQT A;  5HRX A;  4Z6H A;  4YYI A;  4Y03 A;  3P1D A;  4NR9 A;  4YAX A;  4NYX A;  5ENH A;  1JM4 B;  5CPE A;  5DYC A;  4QEV A;  5FE1 A;  3O35 A;  4CFL A;  5I86 A;  3O33 A;  4QEU A;  3I3J A;  4YBM A;  5CFW A;  4UIX A;  1EQF A;  4Z93 A;  5E9V A;  2NXB A;  2DKW A;  5LKT A;  4J1P A;  5ENB A;  4CFK A;  5KO4 A;  5FE6 A;  3UW9 A;  4RVR A;  2RNW A;  4NRB A;  5D7X A;  4CLB A;  2RS9 B;  5CQ3 A;  4QZS A;  4BW4 A;  1WUG A;  4LDF A;  3U5O A;  3FKM X;  5KU3 A;  4IR5 A;  5L8T A;  3MB3 A;  5ENJ A;  4QNS A;  2FSA A;  4HBX A;  4QY4 A;  4UIY A;  3JVM A;  3JVK A;  4GPJ A;  4PTB A;  4CUT A;  4A9H A;  5LKU A;  4FLP A;  4IR4 A;  4QC3 A;  3LJW A;  5FH8 A;  5D24 A;  1WUM A;  5H1V A;  5EWD A;  2DAT A;  4O77 A;  4YC9 A;  5FG6 A;  4YY4 A;  5I7Y A;  4CL9 A;  5CGP A;  4QUT A;  5EP7 A;  4MR4 A;  5F62 A;  5FE2 A;  4Q0O A;  4E96 A;  1F68 A;  5CUA A;  4NS5 A;  5ETB A;  4NR6 A;  4N4I A;  4TU4 A;  3UV4 A;  4YYM A;  5CUB A;  4HXM A;  4UYD A;  4UIV A;  3G0J A;  4HXP A;  5FE9 A;  4NQM A;  5CQA A;  4OUF A;  4A9N A;  4QR4 A;  4LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...