5A5OA

Crystal structure of human atad2 bromodomain in complex with 3-methyl- 1,2-dihydroquinolin-2-one
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5oA00
4PKLA 4UYGA 4HBVA 5D26A 4CUPA 5E9VA 5CQ3A 5HFQA 2I8NA 5JI8A 4QR4A 2RS9B 4N4IA 4N4HA 4TT4A 4J0RA 4MENA 5CP5A 5FH8A 5L99A 1JSPB 4O76A 4KV4A 4QC3A 4X2IA 3U5LA 3IU5A 4YATA 5FBXA 4NYWA 5EA1A 5F36A 5CQ6A 5FFVA 3UV4A 2D82A 5A81A 4QSPA 5DFDA 4UIZA 5HLSA 4CURA 5LVQA 5CPEA 5EWDA 4TT6A 3LQIA 3MB4A 3I3JA 4XUAA 4LC2A 5A7CA 5I88A 5HQ6A 4YYMA 5E74A 4Z93A 4BW2A 2YEMA 5FG5A 3GG3A 3S91A 1WUGA 4MEOA 5E3DA 5E7DA 5IGNA 4UIWA 2R0YA 4LDFA 4C67A 4YYHA 4NR9A 2OSSA 5DKCA 3HMEA 3HMHA 4YABA 4NXJA 2WP2A 2WP1A 5L97A 4O77A 3S92A 4NQMA 4PTBA 4LYSA 5ACYA 5HRXA 4PCEA 5EPSA 4HXRA 2YW5A 4NYVA 2L84A 4PY6A 5ETDA 5ENFA 5H1TA 5DYUA 5HEMA 4YH3A 3U5NA 5EWHA 4O75A 1X0JA 2R0VA 5A5RA 4A9FA 5D24A 5LKXA 4HBXA 5TCMA 5C7NA 4A9MA 3AADA 4NUCA 5F1HA 3U5JA 5LKTA 3JVKA 4QSTA 3SVGA 5ENIA 5ENJA 5F60A 4NUEA 5IBNA 3TLPA 3QZTA 4UIVA 5FFYA 3ONIA 3SVHA 5CRZA 4ZW1A 4KCXA 4LR6A 3G0JA 3DWYA 4CUUA 4OGIA 4QSVA 5EQ1A 4TU6A 5EPBA 5AMFA 5HJCA 5F2PA 5HQ5A 5FE5A 3P1EA 2RNYA 5CUCA 5HQ7A 4MEPA 4YBTA 1JM4B 5E0RA 4XYAA 4YBMA 5FH7A 4ZC9A 5DX4A 4YK0A 5F61A 4A9HA 4ALHA 5E9IA 4IR5A 5D3PA 2LSPB 3JVLA 5A5SA 4HXSA 5DBMA 4YYIA 4YY6A 2RI7A 3P1CA 5FG6A 4PCIA 5DYAA 5EI4A 5I83A 5LKUA 4WHUA 5L96A 4NRBA 5L8TA 5A5QA 2E7NA 5DFBA 5D3RA 5F62A 5A5PA 4CLBA 2RNWA 4NR4A 4O72A 3LQHA 3QZSA 3P1DA 4Z6HA 3MULA 5CRMA 2H60A 5EM3A 4YH4A 5CUGA 5FE7A 5CZGA 5EPRA 4O7AA 2DVRA 3IU6A 5L98A 5CTLA 4IR4A 4NR6A 4QSQA 5DW2A 5CQTA 4LYIA 5EVAA 4UIUA 3P1FA 4CFKA 5KU3A 4KV1A 5D3LA 4QUTA 5I89A 3O35A 4NYXA 4A9EA 2G4AA 5FH6A 2DATA 4NRAA 4TU4A 4QZSA 4A9JA 4MR4A 4QSUA 3Q2EA 4CFLA 5CS8A 4ZQLA 4MR6A 4YC9A 5CY9A 3UVDA 1E6IA 5HRVA 2F6NA 2L5EA 5II1A 4UYFA 4A9LA 3MXFA 4TQNA 5HM0A 5E9LA 5D0CA 2YEKA 3UVYA 4RVRA 4BJXA 5G4SA 5CFWA 5D3JA 5FE2A 5ENBA 5KTUA 3NXBA 5HRWA 4Q0NA 5H1VA 3MUKA 2L85A 4XY8A 2OUOA 4YYNA 4CUTA 2D9EA 4IR3A 5FE6A 3AQAA 3FKMX 4O74A 2I7KA 5CQ5A 5HFRA 1N72A 4TZ2A 5C89A 4QEUA 5BT4A 3K2JA 5FFWA 5LJ0A 4QSXA 4N3WA 4TTEA 5K29A 5CQ4A 4NQNA 5FE8A 4QR5A 5FE4A 5LUUA 2DVSA 4A9IA 4OGJA 4QB3A 5D25A 5C8GA 5FB0A 4PS5A 3HMFA 4QR3A 5KTXA 4HXNA 4LZSA 4MR5A 5LVRA 5EICA 2MJVB 4Z6IA 4J0SA 3JVMA 5L8UA 5J0DA 4QBMA 2RNXA 4HXMA 3U5OA 3UW9A 5AD2A 4O70A 3G0LA 4A9NA 4IR6A 4O7EA 5IGKA 2YELA 4UIYA 5F5ZA 4MEQA 5CU8A 4Z1QA 5DYXA 3O34A 5LJ2A 5E3GA 5IG6A 5A85A 4QSSA 5I86A 4OUFA 3DAIA 4QYLA 5F25A 4NR8A 5CUAA 4YAXA 5FE0A 5EP7A 4IOOA 5FB1A 4IOQA 5EV9A 4YYKA 4YADA 4IORA 3Q2FA 5DW1A 4XY9A 5H1UA 4NS5A 5EISA 4Q0OA 3D7CA 5F63A 5DFCA 5EWVA 5FE9A 2E3KA 4HXKA 4LYWA 1ZS5A 5KHMA 3O37A 2N9GA 5CQ7A 4YY4A 4O78A 3P5OA 4QSWA 5CUBA 4NRCA 5FE3A 5E73A 2KTBB 2R0SA 4AKNA 5C4QA 5TB6A 5D3SA 5JWMA 5A5OA 3O36A 4N4FA 5DLZA 5E9KA 4UYEA 4O7CA 4BW3A 4QNSA 5IGLA 5C85A 5LJ1A 4YBSA 5I40A 5I7YA 4DONA 4HXOA 2DKWA 4GPJA 5I1QA 5H85A 4LZRA 3ZYUA 2YQDA 4QEVA 2YDWA 4TYLA 5D3HA 4BW1A 3LQJA 5A82A 5EGUA 1EQFA 4UYHA 2RO1A 4N4GA 5FE1A 5FG4A 4LZ2A 4QEWA 3JVJA 2DVQA 4QSRA 2FSAA 5HENA 5D3NA 4Y03A 2YYNA 2RFJA 5CQAA 3UV5A 5BT3A 5A83A 5AMEA 4BHWA 5IGMA 5HELA 5I7XA 4TZ8A 3MQMA 5E9MA 5CQ8A 3UV2A 5ETBA 4HBYA 5ENHA 5F3AA 4YYGA 3U5MA 5C87A 5IIDA 4FLPA 5DKHA 4NR7A 5EWCA 4HXLA 5DLXA 4HXPA 4O7FA 2NXBA 4YYDA 2E7OA 5HCLA 4QC1A 5E9YA 4UIXA 4C66A 5DY7A 4CUQA 5LKZA 4MR3A 5ENCA 5BT5A 5ENEA 4UYDA 4F3IA 4UYFB 4TS8A 4QYDA 4XUBA 3SVFA 5FDZA 5II2A 4E96A 4A9OA 4UITA 4O7BA 2DWWA 4CUSA 4LRGA 4NR5A 1F68A 3LJWA 5KO4A 5CUEA 4NUDA 1WUMA 5I29A 4J1PA 5D7XA 3O33A 3QZVA 4A9KA 2F6JA 5COIA 5F1LA 2OO1A 5EK9A 4WIVA 4J3IA 5EWWA 3UVXA 3U5KA 4HBWA 5ENGA 5D3TA 2GRCA 2R10A 5DYCA 4CL9A 4WHWA 5G4RA 5I80A 3UVWA 4YYJA 4ALGA 5CUDA 4O71A 5CGPA 5A5NA 3MB3A 5DKDA 4QUUA 2DVVA 4TT2A 5EU1A 3LXJA 3RCWA 4Z1SA 5AD3A 5KTWA 4BW4A 3U5PA 4QY4A
chains in the Genus database with same CATH superfamily
4PKLA 4UYGA 4HBVA 5D26A 4CUPA 5E9VA 5CQ3A 5HFQA 2I8NA 5JI8A 4QR4A 2RS9B 4N4IA 4N4HA 4TT4A 4J0RA 4MENA 5CP5A 5FH8A 5L99A 1JSPB 4O76A 4KV4A 4QC3A 4X2IA 3U5LA 3IU5A 4YATA 5FBXA 4NYWA 5EA1A 5F36A 5CQ6A 5FFVA 3UV4A 2D82A 5A81A 4QSPA 5DFDA 4UIZA 5HLSA 4CURA 5LVQA 5CPEA 5EWDA 4TT6A 3LQIA 3MB4A 4AI6A 3I3JA 4XUAA 4LC2A 5A7CA 5I88A 5HQ6A 4YYMA 5E74A 4Z93A 4BW2A 2YEMA 5FG5A 3GG3A 3S91A 1WUGA 4MEOA 5E3DA 5E7DA 5IGNA 4UIWA 2R0YA 4LDFA 4C67A 4YYHA 4NR9A 2OSSA 5DKCA 3HMEA 3HMHA 4YABA 4NXJA 2WP2A 2WP1A 5L97A 4O77A 3S92A 4NQMA 3D1BA 4PTBA 4AKHA 4LYSA 5ACYA 5HRXA 4PCEA 5EPSA 4HXRA 2YW5A 4NYVA 2L84A 4PY6A 5ETDA 5ENFA 5H1TA 5DYUA 5HEMA 4YH3A 3U5NA 5EWHA 4O75A 1X0JA 2R0VA 5A5RA 4A9FA 5D24A 5LKXA 4HBXA 5TCMA 5C7NA 4A9MA 3AADA 4NUCA 5F1HA 3U5JA 5LKTA 3JVKA 4QSTA 3SVGA 5ENIA 5ENJA 5F60A 4NUEA 5IBNA 3TLPA 3QZTA 4UIVA 5FFYA 3ONIA 3SVHA 5CRZA 4ZW1A 4KCXA 4LR6A 3G0JA 3DWYA 4CUUA 4OGIA 4QSVA 5EQ1A 4TU6A 5EPBA 5AMFA 5HJCA 5F2PA 5HQ5A 5FE5A 3P1EA 2RNYA 5CUCA 5HQ7A 4MEPA 4YBTA 1JM4B 5E0RA 4XYAA 4YBMA 5FH7A 4ZC9A 5DX4A 4YK0A 5F61A 4A9HA 4ALHA 5E9IA 4IR5A 5D3PA 2LSPB 3JVLA 5A5SA 4HXSA 5DBMA 4YYIA 4YY6A 2RI7A 3P1CA 5FG6A 4PCIA 5DYAA 5EI4A 5I83A 5LKUA 4WHUA 5L96A 4NRBA 5L8TA 5A5QA 2E7NA 5DFBA 5D3RA 5F62A 5A5PA 4CLBA 2RNWA 1ZKRA 4NR4A 4O72A 3LQHA 3QZSA 3P1DA 4Z6HA 3MULA 5CRMA 2H60A 5EM3A 4YH4A 5CUGA 5FE7A 5CZGA 5EPRA 4O7AA 2DVRA 3IU6A 5L98A 5CTLA 4IR4A 4NR6A 4QSQA 5DW2A 5CQTA 4LYIA 5EVAA 4UIUA 3P1FA 4CFKA 4AKIA 5KU3A 4KV1A 5D3LA 4QUTA 5I89A 3O35A 4NYXA 4A9EA 2G4AA 5FH6A 2DATA 4NRAA 4TU4A 4QZSA 4A9JA 4MR4A 4QSUA 3Q2EA 4CFLA 5CS8A 4ZQLA 4MR6A 4YC9A 5CY9A 3UVDA 1E6IA 5HRVA 2F6NA 2L5EA 5II1A 4UYFA 4A9LA 3MXFA 4TQNA 5HM0A 5E9LA 5D0CA 2YEKA 3UVYA 4RVRA 4BJXA 5G4SA 5CFWA 5D3JA 5FE2A 5ENBA 5KTUA 3NXBA 5HRWA 4Q0NA 5H1VA 3MUKA 2L85A 4XY8A 2OUOA 4YYNA 4CUTA 2D9EA 4IR3A 5FE6A 3AQAA 3FKMX 4O74A 2I7KA 5CQ5A 5HFRA 1N72A 4TZ2A 5C89A 4QEUA 5BT4A 3K2JA 5FFWA 5LJ0A 4QSXA 4N3WA 4TTEA 5K29A 5CQ4A 4NQNA 5FE8A 4QR5A 5FE4A 5LUUA 2DVSA 4A9IA 4OGJA 4QB3A 5D25A 5C8GA 5FB0A 4PS5A 3HMFA 4QR3A 5KTXA 4HXNA 4LZSA 4MR5A 5LVRA 5EICA 2MJVB 4Z6IA 4J0SA 3JVMA 5L8UA 5J0DA 4QBMA 2RNXA 4HXMA 3U5OA 3UW9A 5AD2A 4O70A 3G0LA 4A9NA 4IR6A 4O7EA 5IGKA 2YELA 4UIYA 5F5ZA 4MEQA 5CU8A 4Z1QA 5DYXA 3O34A 5LJ2A 5E3GA 5IG6A 5A85A 4QSSA 5I86A 4OUFA 3DAIA 4QYLA 5F25A 4NR8A 5CUAA 4YAXA 5FE0A 5EP7A 4IOOA 5FB1A 4IOQA 5EV9A 4YYKA 4YADA 4IORA 3Q2FA 5DW1A 4XY9A 1PUOA 5H1UA 4NS5A 5EISA 4Q0OA 3D7CA 5F63A 5DFCA 5EWVA 3VKHA 5FE9A 2E3KA 4HXKA 4LYWA 1ZS5A 5KHMA 3O37A 2N9GA 5CQ7A 4YY4A 4O78A 3P5OA 4QSWA 5CUBA 4NRCA 5FE3A 5E73A 2KTBB 2R0SA 4AKNA 5C4QA 5TB6A 5D3SA 5JWMA 5A5OA 3O36A 4N4FA 5DLZA 5E9KA 4UYEA 4O7CA 4BW3A 4QNSA 5IGLA 5C85A 5LJ1A 4YBSA 5I40A 5I7YA 4DONA 4HXOA 2DKWA 4GPJA 5I1QA 5H85A 4LZRA 3ZYUA 2YQDA 3ERRA 4QEVA 2YDWA 4TYLA 5D3HA 4BW1A 3LQJA 5A82A 5EGUA 1EQFA 4UYHA 2RO1A 4N4GA 5FE1A 5FG4A 4LZ2A 4QEWA 3JVJA 2DVQA 4QSRA 2FSAA 5HENA 5D3NA 4Y03A 2YYNA 2RFJA 5CQAA 3UV5A 5BT3A 5A83A 5AMEA 4BHWA 5IGMA 5HELA 4AKGA 3VKGA 5I7XA 4TZ8A 3MQMA 5E9MA 5CQ8A 3UV2A 5ETBA 4HBYA 5ENHA 5F3AA 4YYGA 3D1DA 3U5MA 5C87A 5IIDA 4FLPA 5DKHA 4NR7A 5EWCA 4HXLA 5DLXA 4HXPA 4O7FA 2NXBA 4YYDA 2E7OA 5HCLA 4QC1A 5E9YA 4UIXA 4C66A 5DY7A 4CUQA 5LKZA 4MR3A 5ENCA 5BT5A 5ENEA 4UYDA 4F3IA 4UYFB 4TS8A 4QYDA 4XUBA 3SVFA 5FDZA 5II2A 4E96A 4A9OA 4UITA 4O7BA 2DWWA 4CUSA 4LRGA 4NR5A 1F68A 3LJWA 5KO4A 5CUEA 4NUDA 1WUMA 5I29A 4J1PA 3O33A 3QZVA 5D7XA 4A9KA 2F6JA 5COIA 5F1LA 2OO1A 5EK9A 4WIVA 4J3IA 5EWWA 3UVXA 2EJNA 3U5KA 4HBWA 5ENGA 5D3TA 2GRCA 2R10A 5DYCA 4CL9A 4WHWA 5G4RA 5I80A 3UVWA 4YYJA 4ALGA 5CUDA 4O71A 5CGPA 5A5NA 3MB3A 5DKDA 4QUUA 2DVVA 4TT2A 5EU1A 3LXJA 3RCWA 4Z1SA 5AD3A 5KTWA 4BW4A 3U5PA 4QY4A
chains in the Genus database with same CATH topology
4PKLA 4UYGA 4HBVA 5D26A 4CUPA 5E9VA 5CQ3A 5HFQA 2I8NA 5JI8A 4QR4A 2RS9B 4N4IA 4N4HA 4TT4A 4J0RA 4MENA 5CP5A 5FH8A 5L99A 1JSPB 4O76A 4KV4A 4QC3A 4X2IA 3U5LA 3IU5A 4YATA 5FBXA 4NYWA 5EA1A 5F36A 5CQ6A 5FFVA 3UV4A 2D82A 5A81A 4QSPA 5DFDA 4UIZA 5HLSA 4CURA 5LVQA 5CPEA 5EWDA 4TT6A 3LQIA 3MB4A 3I3JA 4XUAA 4LC2A 5A7CA 5I88A 5HQ6A 4YYMA 5E74A 4Z93A 4BW2A 2YEMA 5FG5A 3GG3A 3S91A 1WUGA 4MEOA 5E3DA 5E7DA 5IGNA 4UIWA 2R0YA 4LDFA 4C67A 4YYHA 4NR9A 2OSSA 5DKCA 3HMEA 3HMHA 4YABA 4NXJA 2WP2A 2WP1A 5L97A 4O77A 3S92A 4NQMA 4PTBA 4LYSA 5ACYA 5HRXA 4PCEA 5EPSA 4HXRA 2YW5A 4NYVA 2L84A 4PY6A 5ETDA 5ENFA 5H1TA 5DYUA 5HEMA 4YH3A 3U5NA 5EWHA 4O75A 1X0JA 2R0VA 5A5RA 4A9FA 5D24A 5LKXA 4HBXA 5TCMA 5C7NA 4A9MA 3AADA 4NUCA 5F1HA 3U5JA 5LKTA 3JVKA 4QSTA 3SVGA 5ENIA 5ENJA 5F60A 4NUEA 5IBNA 3TLPA 3QZTA 4UIVA 5FFYA 3ONIA 3SVHA 5CRZA 4ZW1A 4KCXA 4LR6A 3G0JA 3DWYA 4CUUA 4OGIA 4QSVA 5EQ1A 4TU6A 5EPBA 5AMFA 5HJCA 5F2PA 5HQ5A 5FE5A 3P1EA 2RNYA 5CUCA 5HQ7A 4MEPA 4YBTA 1JM4B 5E0RA 4XYAA 4YBMA 5FH7A 4ZC9A 5DX4A 4YK0A 5F61A 4A9HA 4ALHA 5E9IA 4IR5A 5D3PA 2LSPB 3JVLA 5A5SA 4HXSA 5DBMA 4YYIA 4YY6A 2RI7A 3P1CA 5FG6A 4PCIA 5DYAA 5EI4A 5I83A 5LKUA 4WHUA 5L96A 4NRBA 5L8TA 5A5QA 2E7NA 5DFBA 5D3RA 5F62A 5A5PA 4CLBA 2RNWA 4NR4A 4O72A 3LQHA 3QZSA 3P1DA 4Z6HA 3MULA 5CRMA 2H60A 5EM3A 4YH4A 5CUGA 5FE7A 5CZGA 5EPRA 4O7AA 2DVRA 3IU6A 5L98A 5CTLA 4IR4A 4NR6A 4QSQA 5DW2A 5CQTA 4LYIA 5EVAA 4UIUA 3P1FA 4CFKA 5KU3A 4KV1A 5D3LA 4QUTA 5I89A 3O35A 4NYXA 4A9EA 2G4AA 5FH6A 2DATA 4NRAA 4TU4A 4QZSA 4A9JA 4MR4A 4QSUA 3Q2EA 4CFLA 5CS8A 4ZQLA 4MR6A 4YC9A 5CY9A 3UVDA 1E6IA 5HRVA 2F6NA 2L5EA 5II1A 4UYFA 4A9LA 3MXFA 4TQNA 5HM0A 5E9LA 5D0CA 2YEKA 3UVYA 4RVRA 4BJXA 5G4SA 5CFWA 5D3JA 5FE2A 5ENBA 5KTUA 3NXBA 5HRWA 4Q0NA 5H1VA 3MUKA 2L85A 4XY8A 2OUOA 4YYNA 4CUTA 2D9EA 4IR3A 5FE6A 3AQAA 3FKMX 4O74A 2I7KA 5CQ5A 5HFRA 1N72A 4TZ2A 5C89A 4QEUA 5BT4A 3K2JA 5FFWA 5LJ0A 4QSXA 4N3WA 4TTEA 5K29A 5CQ4A 4NQNA 5FE8A 4QR5A 5FE4A 5LUUA 2DVSA 4A9IA 4OGJA 4QB3A 5D25A 5C8GA 5FB0A 4PS5A 3HMFA 4QR3A 5KTXA 4HXNA 4LZSA 4MR5A 5LVRA 5EICA 2MJVB 4Z6IA 4J0SA 3JVMA 5L8UA 5J0DA 4QBMA 2RNXA 4HXMA 3U5OA 3UW9A 5AD2A 4O70A 3G0LA 4A9NA 4IR6A 4O7EA 5IGKA 2YELA 4UIYA 5F5ZA 4MEQA 5CU8A 4Z1QA 5DYXA 3O34A 5LJ2A 5E3GA 5IG6A 5A85A 4QSSA 5I86A 4OUFA 3DAIA 4QYLA 5F25A 4NR8A 5CUAA 4YAXA 5FE0A 5EP7A 4IOOA 5FB1A 4IOQA 5EV9A 4YYKA 4YADA 4IORA 3Q2FA 5DW1A 4XY9A 5H1UA 4NS5A 5EISA 4Q0OA 3D7CA 5F63A 5DFCA 5EWVA 5FE9A 2E3KA 4HXKA 4LYWA 1ZS5A 5KHMA 3O37A 2N9GA 5CQ7A 4YY4A 4O78A 3P5OA 4QSWA 5CUBA 4NRCA 5FE3A 5E73A 2KTBB 2R0SA 4AKNA 5C4QA 5TB6A 5D3SA 5JWMA 5A5OA 3O36A 4N4FA 5DLZA 5E9KA 4UYEA 4O7CA 4BW3A 4QNSA 5IGLA 5C85A 5LJ1A 4YBSA 5I40A 5I7YA 4DONA 4HXOA 2DKWA 4GPJA 5I1QA 5H85A 4LZRA 3ZYUA 2YQDA 4QEVA 2YDWA 4TYLA 5D3HA 4BW1A 3LQJA 5A82A 5EGUA 1EQFA 4UYHA 2RO1A 4N4GA 5FE1A 5FG4A 4LZ2A 4QEWA 3JVJA 2DVQA 4QSRA 2FSAA 5HENA 5D3NA 4Y03A 2YYNA 2RFJA 5CQAA 3UV5A 5BT3A 5A83A 5AMEA 4BHWA 5IGMA 5HELA 5I7XA 4TZ8A 3MQMA 5E9MA 5CQ8A 3UV2A 5ETBA 4HBYA 5ENHA 5F3AA 4YYGA 3U5MA 5C87A 5IIDA 4FLPA 5DKHA 4NR7A 5EWCA 4HXLA 5DLXA 4HXPA 4O7FA 2NXBA 4YYDA 2E7OA 5HCLA 4QC1A 5E9YA 4UIXA 4C66A 5DY7A 4CUQA 5LKZA 4MR3A 5ENCA 5BT5A 5ENEA 4UYDA 4F3IA 4UYFB 4TS8A 4QYDA 4XUBA 3SVFA 5FDZA 5II2A 4E96A 4A9OA 4UITA 4O7BA 2DWWA 4CUSA 4LRGA 4NR5A 1F68A 3LJWA 5KO4A 5CUEA 4NUDA 1WUMA 5I29A 4J1PA 5D7XA 3O33A 3QZVA 4A9KA 2F6JA 5COIA 5F1LA 2OO1A 5EK9A 4WIVA 4J3IA 5EWWA 3UVXA 3U5KA 4HBWA 5ENGA 5D3TA 2GRCA 2R10A 5DYCA 4CL9A 4WHWA 5G4RA 5I80A 3UVWA 4YYJA 4ALGA 5CUDA 4O71A 5CGPA 5A5NA 3MB3A 5DKDA 4QUUA 2DVVA 4TT2A 5EU1A 3LXJA 3RCWA 4Z1SA 5AD3A 5KTWA 4BW4A 3U5PA 4QY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKL A;  4UYG A;  4HBV A;  5D26 A;  4CUP A;  5E9V A;  5CQ3 A;  5HFQ A;  2I8N A;  5JI8 A;  4QR4 A;  2RS9 B;  4N4I A;  4N4H A;  4TT4 A;  4J0R A;  4MEN A;  5CP5 A;  5FH8 A;  5L99 A;  1JSP B;  4O76 A;  4KV4 A;  4QC3 A;  4X2I A;  3U5L A;  3IU5 A;  4YAT A;  5FBX A;  4NYW A;  5EA1 A;  5F36 A;  5CQ6 A;  5FFV A;  3UV4 A;  2D82 A;  5A81 A;  4QSP A;  5DFD A;  4UIZ A;  5HLS A;  4CUR A;  5LVQ A;  5CPE A;  5EWD A;  4TT6 A;  3LQI A;  3MB4 A;  3I3J A;  4XUA A;  4LC2 A;  5A7C A;  5I88 A;  5HQ6 A;  4YYM A;  5E74 A;  4Z93 A;  4BW2 A;  2YEM A;  5FG5 A;  3GG3 A;  3S91 A;  1WUG A;  4MEO A;  5E3D A;  5E7D A;  5IGN A;  4UIW A;  2R0Y A;  4LDF A;  4C67 A;  4YYH A;  4NR9 A;  2OSS A;  5DKC A;  3HME A;  3HMH A;  4YAB A;  4NXJ A;  2WP2 A;  2WP1 A;  5L97 A;  4O77 A;  3S92 A;  4NQM A;  4PTB A;  4LYS A;  5ACY A;  5HRX A;  4PCE A;  5EPS A;  4HXR A;  2YW5 A;  4NYV A;  2L84 A;  4PY6 A;  5ETD A;  5ENF A;  5H1T A;  5DYU A;  5HEM A;  4YH3 A;  3U5N A;  5EWH A;  4O75 A;  1X0J A;  2R0V A;  5A5R A;  4A9F A;  5D24 A;  5LKX A;  4HBX A;  5TCM A;  5C7N A;  4A9M A;  3AAD A;  4NUC A;  5F1H A;  3U5J A;  5LKT A;  3JVK A;  4QST A;  3SVG A;  5ENI A;  5ENJ A;  5F60 A;  4NUE A;  5IBN A;  3TLP A;  3QZT A;  4UIV A;  5FFY A;  3ONI A;  3SVH A;  5CRZ A;  4ZW1 A;  4KCX A;  4LR6 A;  3G0J A;  3DWY A;  4CUU A;  4OGI A;  4QSV A;  5EQ1 A;  4TU6 A;  5EPB A;  5AMF A;  5HJC A;  5F2P A;  5HQ5 A;  5FE5 A;  3P1E A;  2RNY A;  5CUC A;  5HQ7 A;  4MEP A;  4YBT A;  1JM4 B;  5E0R A;  4XYA A;  4YBM A;  5FH7 A;  4ZC9 A;  5DX4 A;  4YK0 A;  5F61 A;  4A9H A;  4ALH A;  5E9I A;  4IR5 A;  5D3P A;  2LSP B;  3JVL A;  5A5S A;  4HXS A;  5DBM A;  4YYI A;  4YY6 A;  2RI7 A;  3P1C A;  5FG6 A;  4PCI A;  5DYA A;  5EI4 A;  5I83 A;  5LKU A;  4WHU A;  5L96 A;  4NRB A;  5L8T A;  5A5Q A;  2E7N A;  5DFB A;  5D3R A;  5F62 A;  5A5P A;  4CLB A;  2RNW A;  4NR4 A;  4O72 A;  3LQH A;  3QZS A;  3P1D A;  4Z6H A;  3MUL A;  5CRM A;  2H60 A;  5EM3 A;  4YH4 A;  5CUG A;  5FE7 A;  5CZG A;  5EPR A;  4O7A A;  2DVR A;  3IU6 A;  5L98 A;  5CTL A;  4IR4 A;  4NR6 A;  4QSQ A;  5DW2 A;  5CQT A;  4LYI A;  5EVA A;  4UIU A;  3P1F A;  4CFK A;  5KU3 A;  4KV1 A;  5D3L A;  4QUT A;  5I89 A;  3O35 A;  4NYX A;  4A9E A;  2G4A A;  5FH6 A;  2DAT A;  4NRA A;  4TU4 A;  4QZS A;  4A9J A;  4MR4 A;  4QSU A;  3Q2E A;  4CFL A;  5CS8 A;  4ZQL A;  4MR6 A;  4YC9 A;  5CY9 A;  3UVD A;  1E6I A;  5HRV A;  2F6N A;  2L5E A;  5II1 A;  4UYF A;  4A9L A;  3MXF A;  4TQN A;  5HM0 A;  5E9L A;  5D0C A;  2YEK A;  3UVY A;  4RVR A;  4BJX A;  5G4S A;  5CFW A;  5D3J A;  5FE2 A;  5ENB A;  5KTU A;  3NXB A;  5HRW A;  4Q0N A;  5H1V A;  3MUK A;  2L85 A;  4XY8 A;  2OUO A;  4YYN A;  4CUT A;  2D9E A;  4IR3 A;  5FE6 A;  3AQA A;  3FKM X;  4O74 A;  2I7K A;  5CQ5 A;  5HFR A;  1N72 A;  4TZ2 A;  5C89 A;  4QEU A;  5BT4 A;  3K2J A;  5FFW A;  5LJ0 A;  4QSX A;  4N3W A;  4TTE A;  5K29 A;  5CQ4 A;  4NQN A;  5FE8 A;  4QR5 A;  5FE4 A;  5LUU A;  2DVS A;  4A9I A;  4OGJ A;  4QB3 A;  5D25 A;  5C8G A;  5FB0 A;  4PS5 A;  3HMF A;  4QR3 A;  5KTX A;  4HXN A;  4LZS A;  4MR5 A;  5LVR A;  5EIC A;  2MJV B;  4Z6I A;  4J0S A;  3JVM A;  5L8U A;  5J0D A;  4QBM A;  2RNX A;  4HXM A;  3U5O A;  3UW9 A;  5AD2 A;  4O70 A;  3G0L A;  4A9N A;  4IR6 A;  4O7E A;  5IGK A;  2YEL A;  4UIY A;  5F5Z A;  4MEQ A;  5CU8 A;  4Z1Q A;  5DYX A;  3O34 A;  5LJ2 A;  5E3G A;  5IG6 A;  5A85 A;  4QSS A;  5I86 A;  4OUF A;  3DAI A;  4QYL A;  5F25 A;  4NR8 A;  5CUA A;  4YAX A;  5FE0 A;  5EP7 A;  4IOO A;  5FB1 A;  4IOQ A;  5EV9 A;  4YYK A;  4YAD A;  4IOR A;  3Q2F A;  5DW1 A;  4XY9 A;  5H1U A;  4NS5 A;  5EIS A;  4Q0O A;  3D7C A;  5F63 A;  5DFC A;  5EWV A;  5FE9 A;  2E3K A;  4HXK A;  4LYW A;  1ZS5 A;  5KHM A;  3O37 A;  2N9G A;  5CQ7 A;  4YY4 A;  4O78 A;  3P5O A;  4QSW A;  5CUB A;  4NRC A;  5FE3 A;  5E73 A;  2KTB B;  2R0S A;  4AKN A;  5C4Q A;  5TB6 A;  5D3S A;  5JWM A;  5A5O A;  3O36 A;  4N4F A;  5DLZ A;  5E9K A;  4UYE A;  4O7C A;  4BW3 A;  4QNS A;  5IGL A;  5C85 A;  5LJ1 A;  4YBS A;  5I40 A;  5I7Y A;  4DON A;  4HXO A;  2DKW A;  4GPJ A;  5I1Q A;  5H85 A;  4LZR A;  3ZYU A;  2YQD A;  4QEV A;  2YDW A;  4TYL A;  5D3H A;  4BW1 A;  3LQJ A;  5A82 A;  5EGU A;  1EQF A;  4UYH A;  2RO1 A;  4N4G A;  5FE1 A;  5FG4 A;  4LZ2 A;  4QEW A;  3JVJ A;  2DVQ A;  4QSR A;  2FSA A;  5HEN A;  5D3N A;  4Y03 A;  2YYN A;  2RFJ A;  5CQA A;  3UV5 A;  5BT3 A;  5A83 A;  5AME A;  4BHW A;  5IGM A;  5HEL A;  5I7X A;  4TZ8 A;  3MQM A;  5E9M A;  5CQ8 A;  3UV2 A;  5ETB A;  4HBY A;  5ENH A;  5F3A A;  4YYG A;  3U5M A;  5C87 A;  5IID A;  4FLP A;  5DKH A;  4NR7 A;  5EWC A;  4HXL A;  5DLX A;  4HXP A;  4O7F A;  2NXB A;  4YYD A;  2E7O A;  5HCL A;  4QC1 A;  5E9Y A;  4UIX A;  4C66 A;  5DY7 A;  4CUQ A;  5LKZ A;  4MR3 A;  5ENC A;  5BT5 A;  5ENE A;  4UYD A;  4F3I A;  4UYF B;  4TS8 A;  4QYD A;  4XUB A;  3SVF A;  5FDZ A;  5II2 A;  4E96 A;  4A9O A;  4UIT A;  4O7B A;  2DWW A;  4CUS A;  4LRG A;  4NR5 A;  1F68 A;  3LJW A;  5KO4 A;  5CUE A;  4NUD A;  1WUM A;  5I29 A;  4J1P A;  5D7X A;  3O33 A;  3QZV A;  4A9K A;  2F6J A;  5COI A;  5F1L A;  2OO1 A;  5EK9 A;  4WIV A;  4J3I A;  5EWW A;  3UVX A;  3U5K A;  4HBW A;  5ENG A;  5D3T A;  2GRC A;  2R10 A;  5DYC A;  4CL9 A;  4WHW A;  5G4R A;  5I80 A;  3UVW A;  4YYJ A;  4ALG A;  5CUD A;  4O71 A;  5CGP A;  5A5N A;  3MB3 A;  5DKD A;  4QUU A;  2DVV A;  4TT2 A;  5EU1 A;  3LXJ A;  3RCW A;  4Z1S A;  5AD3 A;  5KTW A;  4BW4 A;  3U5P A;  4QY4 A; 
#chains in the Genus database with same CATH topology
 4PKL A;  4UYG A;  4HBV A;  5D26 A;  4CUP A;  5E9V A;  5CQ3 A;  5HFQ A;  2I8N A;  5JI8 A;  4QR4 A;  2RS9 B;  4N4I A;  4N4H A;  4TT4 A;  4J0R A;  4MEN A;  5CP5 A;  5FH8 A;  5L99 A;  1JSP B;  4O76 A;  4KV4 A;  4QC3 A;  4X2I A;  3U5L A;  3IU5 A;  4YAT A;  5FBX A;  4NYW A;  5EA1 A;  5F36 A;  5CQ6 A;  5FFV A;  3UV4 A;  2D82 A;  5A81 A;  4QSP A;  5DFD A;  4UIZ A;  5HLS A;  4CUR A;  5LVQ A;  5CPE A;  5EWD A;  4TT6 A;  3LQI A;  3MB4 A;  4AI6 A;  3I3J A;  4XUA A;  4LC2 A;  5A7C A;  5I88 A;  5HQ6 A;  4YYM A;  5E74 A;  4Z93 A;  4BW2 A;  2YEM A;  5FG5 A;  3GG3 A;  3S91 A;  1WUG A;  4MEO A;  5E3D A;  5E7D A;  5IGN A;  4UIW A;  2R0Y A;  4LDF A;  4C67 A;  4YYH A;  4NR9 A;  2OSS A;  5DKC A;  3HME A;  3HMH A;  4YAB A;  4NXJ A;  2WP2 A;  2WP1 A;  5L97 A;  4O77 A;  3S92 A;  4NQM A;  3D1B A;  4PTB A;  4AKH A;  4LYS A;  5ACY A;  5HRX A;  4PCE A;  5EPS A;  4HXR A;  2YW5 A;  4NYV A;  2L84 A;  4PY6 A;  5ETD A;  5ENF A;  5H1T A;  5DYU A;  5HEM A;  4YH3 A;  3U5N A;  5EWH A;  4O75 A;  1X0J A;  2R0V A;  5A5R A;  4A9F A;  5D24 A;  5LKX A;  4HBX A;  5TCM A;  5C7N A;  4A9M A;  3AAD A;  4NUC A;  5F1H A;  3U5J A;  5LKT A;  3JVK A;  4QST A;  3SVG A;  5ENI A;  5ENJ A;  5F60 A;  4NUE A;  5IBN A;  3TLP A;  3QZT A;  4UIV A;  5FFY A;  3ONI A;  3SVH A;  5CRZ A;  4ZW1 A;  4KCX A;  4LR6 A;  3G0J A;  3DWY A;  4CUU A;  4OGI A;  4QSV A;  5EQ1 A;  4TU6 A;  5EPB A;  5AMF A;  5HJC A;  5F2P A;  5HQ5 A;  5FE5 A;  3P1E A;  2RNY A;  5CUC A;  5HQ7 A;  4MEP A;  4YBT A;  1JM4 B;  5E0R A;  4XYA A;  4YBM A;  5FH7 A;  4ZC9 A;  5DX4 A;  4YK0 A;  5F61 A;  4A9H A;  4ALH A;  5E9I A;  4IR5 A;  5D3P A;  2LSP B;  3JVL A;  5A5S A;  4HXS A;  5DBM A;  4YYI A;  4YY6 A;  2RI7 A;  3P1C A;  5FG6 A;  4PCI A;  5DYA A;  5EI4 A;  5I83 A;  5LKU A;  4WHU A;  5L96 A;  4NRB A;  5L8T A;  5A5Q A;  2E7N A;  5DFB A;  5D3R A;  5F62 A;  5A5P A;  4CLB A;  2RNW A;  1ZKR A;  4NR4 A;  4O72 A;  3LQH A;  3QZS A;  3P1D A;  4Z6H A;  3MUL A;  5CRM A;  2H60 A;  5EM3 A;  4YH4 A;  5CUG A;  5FE7 A;  5CZG A;  5EPR A;  4O7A A;  2DVR A;  3IU6 A;  5L98 A;  5CTL A;  4IR4 A;  4NR6 A;  4QSQ A;  5DW2 A;  5CQT A;  4LYI A;  5EVA A;  4UIU A;  3P1F A;  4CFK A;  4AKI A;  5KU3 A;  4KV1 A;  5D3L A;  4QUT A;  5I89 A;  3O35 A;  4NYX A;  4A9E A;  2G4A A;  5FH6 A;  2DAT A;  4NRA A;  4TU4 A;  4QZS A;  4A9J A;  4MR4 A;  4QSU A;  3Q2E A;  4CFL A;  5CS8 A;  4ZQL A;  4MR6 A;  4YC9 A;  5CY9 A;  3UVD A;  1E6I A;  5HRV A;  2F6N A;  2L5E A;  5II1 A;  4UYF A;  4A9L A;  3MXF A;  4TQN A;  5HM0 A;  5E9L A;  5D0C A;  2YEK A;  3UVY A;  4RVR A;  4BJX A;  5G4S A;  5CFW A;  5D3J A;  5FE2 A;  5ENB A;  5KTU A;  3NXB A;  5HRW A;  4Q0N A;  5H1V A;  3MUK A;  2L85 A;  4XY8 A;  2OUO A;  4YYN A;  4CUT A;  2D9E A;  4IR3 A;  5FE6 A;  3AQA A;  3FKM X;  4O74 A;  2I7K A;  5CQ5 A;  5HFR A;  1N72 A;  4TZ2 A;  5C89 A;  4QEU A;  5BT4 A;  3K2J A;  5FFW A;  5LJ0 A;  4QSX A;  4N3W A;  4TTE A;  5K29 A;  5CQ4 A;  4NQN A;  5FE8 A;  4QR5 A;  5FE4 A;  5LUU A;  2DVS A;  4A9I A;  4OGJ A;  4QB3 A;  5D25 A;  5C8G A;  5FB0 A;  4PS5 A;  3HMF A;  4QR3 A;  5KTX A;  4HXN A;  4LZS A;  4MR5 A;  5LVR A;  5EIC A;  2MJV B;  4Z6I A;  4J0S A;  3JVM A;  5L8U A;  5J0D A;  4QBM A;  2RNX A;  4HXM A;  3U5O A;  3UW9 A;  5AD2 A;  4O70 A;  3G0L A;  4A9N A;  4IR6 A;  4O7E A;  5IGK A;  2YEL A;  4UIY A;  5F5Z A;  4MEQ A;  5CU8 A;  4Z1Q A;  5DYX A;  3O34 A;  5LJ2 A;  5E3G A;  5IG6 A;  5A85 A;  4QSS A;  5I86 A;  4OUF A;  3DAI A;  4QYL A;  5F25 A;  4NR8 A;  5CUA A;  4YAX A;  5FE0 A;  5EP7 A;  4IOO A;  5FB1 A;  4IOQ A;  5EV9 A;  4YYK A;  4YAD A;  4IOR A;  3Q2F A;  5DW1 A;  4XY9 A;  1PUO A;  5H1U A;  4NS5 A;  5EIS A;  4Q0O A;  3D7C A;  5F63 A;  5DFC A;  5EWV A;  3VKH A;  5FE9 A;  2E3K A;  4HXK A;  4LYW A;  1ZS5 A;  5KHM A;  3O37 A;  2N9G A;  5CQ7 A;  4YY4 A;  4O78 A;  3P5O A;  4QSW A;  5CUB A;  4NRC A;  5FE3 A;  5E73 A;  2KTB B;  2R0S A;  4AKN A;  5C4Q A;  5TB6 A;  5D3S A;  5JWM A;  5A5O A;  3O36 A;  4N4F A;  5DLZ A;  5E9K A;  4UYE A;  4O7C A;  4BW3 A;  4QNS A;  5IGL A;  5C85 A;  5LJ1 A;  4YBS A;  5I40 A;  5I7Y A;  4DON A;  4HXO A;  2DKW A;  4GPJ A;  5I1Q A;  5H85 A;  4LZR A;  3ZYU A;  2YQD A;  3ERR A;  4QEV A;  2YDW A;  4TYL A;  5D3H A;  4BW1 A;  3LQJ A;  5A82 A;  5EGU A;  1EQF A;  4UYH A;  2RO1 A;  4N4G A;  5FE1 A;  5FG4 A;  4LZ2 A;  4QEW A;  3JVJ A;  2DVQ A;  4QSR A;  2FSA A;  5HEN A;  5D3N A;  4Y03 A;  2YYN A;  2RFJ A;  5CQA A;  3UV5 A;  5BT3 A;  5A83 A;  5AME A;  4BHW A;  5IGM A;  5HEL A;  4AKG A;  3VKG A;  5I7X A;  4TZ8 A;  3MQM A;  5E9M A;  5CQ8 A;  3UV2 A;  5ETB A;  4HBY A;  5ENH A;  5F3A A;  4YYG A;  3D1D A;  3U5M A;  5C87 A;  5IID A;  4FLP A;  5DKH A;  4NR7 A;  5EWC A;  4HXL A;  5DLX A;  4HXP A;  4O7F A;  2NXB A;  4YYD A;  2E7O A;  5HCL A;  4QC1 A;  5E9Y A;  4UIX A;  4C66 A;  5DY7 A;  4CUQ A;  5LKZ A;  4MR3 A;  5ENC A;  5BT5 A;  5ENE A;  4UYD A;  4F3I A;  4UYF B;  4TS8 A;  4QYD A;  4XUB A;  3SVF A;  5FDZ A;  5II2 A;  4E96 A;  4A9O A;  4UIT A;  4O7B A;  2DWW A;  4CUS A;  4LRG A;  4NR5 A;  1F68 A;  3LJW A;  5KO4 A;  5CUE A;  4NUD A;  1WUM A;  5I29 A;  4J1P A;  3O33 A;  3QZV A;  5D7X A;  4A9K A;  2F6J A;  5COI A;  5F1L A;  2OO1 A;  5EK9 A;  4WIV A;  4J3I A;  5EWW A;  3UVX A;  2EJN A;  3U5K A;  4HBW A;  5ENG A;  5D3T A;  2GRC A;  2R10 A;  5DYC A;  4CL9 A;  4WHW A;  5G4R A;  5I80 A;  3UVW A;  4YYJ A;  4ALG A;  5CUD A;  4O71 A;  5CGP A;  5A5N A;  3MB3 A;  5DKD A;  4QUU A;  2DVV A;  4TT2 A;  5EU1 A;  3LXJ A;  3RCW A;  4Z1S A;  5AD3 A;  5KTW A;  4BW4 A;  3U5P A;  4QY4 A; 
#chains in the Genus database with same CATH homology
 4PKL A;  4UYG A;  4HBV A;  5D26 A;  4CUP A;  5E9V A;  5CQ3 A;  5HFQ A;  2I8N A;  5JI8 A;  4QR4 A;  2RS9 B;  4N4I A;  4N4H A;  4TT4 A;  4J0R A;  4MEN A;  5CP5 A;  5FH8 A;  5L99 A;  1JSP B;  4O76 A;  4KV4 A;  4QC3 A;  4X2I A;  3U5L A;  3IU5 A;  4YAT A;  5FBX A;  4NYW A;  5EA1 A;  5F36 A;  5CQ6 A;  5FFV A;  3UV4 A;  2D82 A;  5A81 A;  4QSP A;  5DFD A;  4UIZ A;  5HLS A;  4CUR A;  5LVQ A;  5CPE A;  5EWD A;  4TT6 A;  3LQI A;  3MB4 A;  3I3J A;  4XUA A;  4LC2 A;  5A7C A;  5I88 A;  5HQ6 A;  4YYM A;  5E74 A;  4Z93 A;  4BW2 A;  2YEM A;  5FG5 A;  3GG3 A;  3S91 A;  1WUG A;  4MEO A;  5E3D A;  5E7D A;  5IGN A;  4UIW A;  2R0Y A;  4LDF A;  4C67 A;  4YYH A;  4NR9 A;  2OSS A;  5DKC A;  3HME A;  3HMH A;  4YAB A;  4NXJ A;  2WP2 A;  2WP1 A;  5L97 A;  4O77 A;  3S92 A;  4NQM A;  4PTB A;  4LYS A;  5ACY A;  5HRX A;  4PCE A;  5EPS A;  4HXR A;  2YW5 A;  4NYV A;  2L84 A;  4PY6 A;  5ETD A;  5ENF A;  5H1T A;  5DYU A;  5HEM A;  4YH3 A;  3U5N A;  5EWH A;  4O75 A;  1X0J A;  2R0V A;  5A5R A;  4A9F A;  5D24 A;  5LKX A;  4HBX A;  5TCM A;  5C7N A;  4A9M A;  3AAD A;  4NUC A;  5F1H A;  3U5J A;  5LKT A;  3JVK A;  4QST A;  3SVG A;  5ENI A;  5ENJ A;  5F60 A;  4NUE A;  5IBN A;  3TLP A;  3QZT A;  4UIV A;  5FFY A;  3ONI A;  3SVH A;  5CRZ A;  4ZW1 A;  4KCX A;  4LR6 A;  3G0J A;  3DWY A;  4CUU A;  4OGI A;  4QSV A;  5EQ1 A;  4TU6 A;  5EPB A;  5AMF A;  5HJC A;  5F2P A;  5HQ5 A;  5FE5 A;  3P1E A;  2RNY A;  5CUC A;  5HQ7 A;  4MEP A;  4YBT A;  1JM4 B;  5E0R A;  4XYA A;  4YBM A;  5FH7 A;  4ZC9 A;  5DX4 A;  4YK0 A;  5F61 A;  4A9H A;  4ALH A;  5E9I A;  4IR5 A;  5D3P A;  2LSP B;  3JVL A;  5A5S A;  4HXS A;  5DBM A;  4YYI A;  4YY6 A;  2RI7 A;  3P1C A;  5FG6 A;  4PCI A;  5DYA A;  5EI4 A;  5I83 A;  5LKU A;  4WHU A;  5L96 A;  4NRB A;  5L8T A;  5A5Q A;  2E7N A;  5DFB A;  5D3R A;  5F62 A;  5A5P A;  4CLB A;  2RNW A;  4NR4 A;  4O72 A;  3LQH A;  3QZS A;  3P1D A;  4Z6H A;  3MUL A;  5CRM A;  2H60 A;  5EM3 A;  4YH4 A;  5CUG A;  5FE7 A;  5CZG A;  5EPR A;  4O7A A;  2DVR A;  3IU6 A;  5L98 A;  5CTL A;  4IR4 A;  4NR6 A;  4QSQ A;  5DW2 A;  5CQT A;  4LYI A;  5EVA A;  4UIU A;  3P1F A;  4CFK A;  5KU3 A;  4KV1 A;  5D3L A;  4QUT A;  5I89 A;  3O35 A;  4NYX A;  4A9E A;  2G4A A;  5FH6 A;  2DAT A;  4NRA A;  4TU4 A;  4QZS A;  4A9J A;  4MR4 A;  4QSU A;  3Q2E A;  4CFL A;  5CS8 A;  4ZQL A;  4MR6 A;  4YC9 A;  5CY9 A;  3UVD A;  1E6I A;  5HRV A;  2F6N A;  2L5E A;  5II1 A;  4UYF A;  4A9L A;  3MXF A;  4TQN A;  5HM0 A;  5E9L A;  5D0C A;  2YEK A;  3UVY A;  4RVR A;  4BJX A;  5G4S A;  5CFW A;  5D3J A;  5FE2 A;  5ENB A;  5KTU A;  3NXB A;  5HRW A;  4Q0N A;  5H1V A;  3MUK A;  2L85 A;  4XY8 A;  2OUO A;  4YYN A;  4CUT A;  2D9E A;  4IR3 A;  5FE6 A;  3AQA A;  3FKM X;  4O74 A;  2I7K A;  5CQ5 A;  5HFR A;  1N72 A;  4TZ2 A;  5C89 A;  4QEU A;  5BT4 A;  3K2J A;  5FFW A;  5LJ0 A;  4QSX A;  4N3W A;  4TTE A;  5K29 A;  5CQ4 A;  4NQN A;  5FE8 A;  4QR5 A;  5FE4 A;  5LUU A;  2DVS A;  4A9I A;  4OGJ A;  4QB3 A;  5D25 A;  5C8G A;  5FB0 A;  4PS5 A;  3HMF A;  4QR3 A;  5KTX A;  4HXN A;  4LZS A;  4MR5 A;  5LVR A;  5EIC A;  2MJV B;  4Z6I A;  4J0S A;  3JVM A;  5L8U A;  5J0D A;  4QBM A;  2RNX A;  4HXM A;  3U5O A;  3UW9 A;  5AD2 A;  4O70 A;  3G0L A;  4A9N A;  4IR6 A;  4O7E A;  5IGK A;  2YEL A;  4UIY A;  5F5Z A;  4MEQ A;  5CU8 A;  4Z1Q A;  5DYX A;  3O34 A;  5LJ2 A;  5E3G A;  5IG6 A;  5A85 A;  4QSS A;  5I86 A;  4OUF A;  3DAI A;  4QYL A;  5F25 A;  4NR8 A;  5CUA A;  4YAX A;  5FE0 A;  5EP7 A;  4IOO A;  5FB1 A;  4IOQ A;  5EV9 A;  4YYK A;  4YAD A;  4IOR A;  3Q2F A;  5DW1 A;  4XY9 A;  5H1U A;  4NS5 A;  5EIS A;  4Q0O A;  3D7C A;  5F63 A;  5DFC A;  5EWV A;  5FE9 A;  2E3K A;  4HXK A;  4LYW A;  1ZS5 A;  5KHM A;  3O37 A;  2N9G A;  5CQ7 A;  4YY4 A;  4O78 A;  3P5O A;  4QSW A;  5CUB A;  4NRC A;  5FE3 A;  5E73 A;  2KTB B;  2R0S A;  4AKN A;  5C4Q A;  5TB6 A;  5D3S A;  5JWM A;  5A5O A;  3O36 A;  4N4F A;  5DLZ A;  5E9K A;  4UYE A;  4O7C A;  4BW3 A;  4QNS A;  5IGL A;  5C85 A;  5LJ1 A;  4YBS A;  5I40 A;  5I7Y A;  4DON A;  4HXO A;  2DKW A;  4GPJ A;  5I1Q A;  5H85 A;  4LZR A;  3ZYU A;  2YQD A;  4QEV A;  2YDW A;  4TYL A;  5D3H A;  4BW1 A;  3LQJ A;  5A82 A;  5EGU A;  1EQF A;  4UYH A;  2RO1 A;  4N4G A;  5FE1 A;  5FG4 A;  4LZ2 A;  4QEW A;  3JVJ A;  2DVQ A;  4QSR A;  2FSA A;  5HEN A;  5D3N A;  4Y03 A;  2YYN A;  2RFJ A;  5CQA A;  3UV5 A;  5BT3 A;  5A83 A;  5AME A;  4BHW A;  5IGM A;  5HEL A;  5I7X A;  4TZ8 A;  3MQM A;  5E9M A;  5CQ8 A;  3UV2 A;  5ETB A;  4HBY A;  5ENH A;  5F3A A;  4YYG A;  3U5M A;  5C87 A;  5IID A;  4FLP A;  5DKH A;  4NR7 A;  5EWC A;  4HXL A;  5DLX A;  4HXP A;  4O7F A;  2NXB A;  4YYD A;  2E7O A;  5HCL A;  4QC1 A;  5E9Y A;  4UIX A;  4C66 A;  5DY7 A;  4CUQ A;  5LKZ A;  4MR3 A;  5ENC A;  5BT5 A;  5ENE A;  4UYD A;  4F3I A;  4UYF B;  4TS8 A;  4QYD A;  4XUB A;  3SVF A;  5FDZ A;  5II2 A;  4E96 A;  4A9O A;  4UIT A;  4O7B A;  2DWW A;  4CUS A;  4LRG A;  4NR5 A;  1F68 A;  3LJW A;  5KO4 A;  5CUE A;  4NUD A;  1WUM A;  5I29 A;  4J1P A;  5D7X A;  3O33 A;  3QZV A;  4A9K A;  2F6J A;  5COI A;  5F1L A;  2OO1 A;  5EK9 A;  4WIV A;  4J3I A;  5EWW A;  3UVX A;  3U5K A;  4HBW A;  5ENG A;  5D3T A;  2GRC A;  2R10 A;  5DYC A;  4CL9 A;  4WHW A;  5G4R A;  5I80 A;  3UVW A;  4YYJ A;  4ALG A;  5CUD A;  4O71 A;  5CGP A;  5A5N A;  3MB3 A;  5DKD A;  4QUU A;  2DVV A;  4TT2 A;  5EU1 A;  3LXJ A;  3RCW A;  4Z1S A;  5AD3 A;  5KTW A;  4BW4 A;  3U5P A;  4QY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...